Dbfetch

ID   AB031389; SV 1; linear; mRNA; STD; MUS; 5921 BP.
XX
AC   AB031389;
XX
DT   23-FEB-2000 (Rel. 62, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for voltage-gated sodium channel alpha subunit
DE   NaT/Scn11a, complete cds.
XX
KW   voltage-gated sodium channel alpha subunit NaT/Scn11a.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5921
RA   Ogata K., Jeong S., Goto J., Murakami H., Hashida H., Suzuki T., Masuda N.,
RA   Hirai M., Isahara K., Uchiyama Y., Kanazawa I.;
RT   ;
RL   Submitted (23-AUG-1999) to the INSDC.
RL   Katsuhisa Ogata, Graduate School of Medicine, The University of Tokyo,
RL   Department of Neurology; 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-8655, Japan
RL   (E-mail:OGATA-NEU@h.u-tokyo.ac.jp, Tel:+81-3-5800-8672,
RL   Fax:+81-3-5800-6548)
XX
RN   [2]
RX   DOI; 10.1006/bbrc.1999.1858.
RX   PUBMED; 10623609.
RA   Ogata K., Jeong S.Y., Murakami H., Hashida H., Suzuki T., Masuda N.,
RA   Hirai M., Isahara K., Uchiyama Y., Goto J., Kanazawa I.;
RT   "Cloning and expression study of the mouse tetrodotoxin-resistant
RT   voltage-gated sodium channel alpha subunit NaT/Scn11a";
RL   Biochem. Biophys. Res. Commun. 267(1):271-277(2000).
XX
DR   MD5; 157884df0f788583455cb15bcc5cca0a.
DR   Ensembl-Gn; ENSMUSG00000034115; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035423; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035404; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035337; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035400; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035108; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035923; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034412; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035075; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035234; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035181; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035313; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035222; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035942; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034117; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034532; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000070617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215718; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0095198; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0095292; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0095243; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0095213; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0094775; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0095722; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0095385; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0094700; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0094907; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0094762; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0094930; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0094733; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0096062; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0094813; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0093759; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5921
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             111..5408
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="voltage-gated sodium channel alpha subunit
FT                   NaT/Scn11a"
FT                   /db_xref="GOA:Q9R053"
FT                   /db_xref="InterPro:IPR001696"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR010526"
FT                   /db_xref="InterPro:IPR028821"
FT                   /db_xref="MGI:MGI:1345149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R053"
FT                   /protein_id="BAA92154.1"
FT                   /translation="MEERYYPVIFPDERNFRPFTFDSLAAIEKRITIQKEKKKSKDKAA
FT                   TEPQPRPQLDLKASRKLPKLYGDVPPDLIAKPLEDLDPFYKDHKTFMVLNKKRTIYRFS
FT                   AKRALFILGPFNPIRSFMIRISVHSVFSMFIICTVIINCMFMANNSSVDSRPSSNIPEY
FT                   VFIGIYVLEAVIKILARGFIVDEFSYLRDPWNWLDFIVIGTAIAPCFLGNKVNNLSTLR
FT                   TFRVLRALKAISVISGLKVIVGALLRSVKKLVDVMVLTLFCLSIFALVGQQLFMGILSQ
FT                   KCIKDDCGPNAFSNKDCFVKENDSEDFIMCGNWLGRRSCPDGSTCNKTTFNPDYNYTNF
FT                   DSFGWSFLAMFRVMTQDSWEKLYRQILRTSGIYFVFFFVVVIFLGSFYLLNLTLAVVTM
FT                   GYEEQNRNVAAETEAKEKMFQEAQQLLKEEKEALVAMGIDRTSLNSLQASSFSPKKRKF
FT                   FGSKTRKSFFMRGSKTARASASDSEDDASKKPQLLEQTKRLSQNLPVELFDEHVDPLHR
FT                   QRALSAVSILTITMQEQEKSQEPCFPCGKNLASKYLVWECSPPWLCIKKVLQTIMTDPF
FT                   TELAITICIIVNTVFLAMEHHNMDNSLKDILKIGNWVFTGIFIAEMCLKIIALDPYHYF
FT                   RHGWNIFDSIVALVSLADVLFHKLSKNLSFLASLRVLRVFKLAKSWPTLNTLIKIIGHS
FT                   VGALGNLTVVLTIVVFIFSVVGMRLFGAKFNKTCSTSPESLRRRHMGDFYHSFLVVFRI
FT                   LCGEWIETMWDCMQEMEGSPLCVIVFVLIMVVGKLVVLNLFIALLLNSFSNEEKDGNPE
FT                   GETRKTKVQLALDRFSRAFYFMARALQNFCRKRCRRQNSPKPNEATESFAGESRDTATL
FT                   DTRSWKEYDSEMTLYTGQAGAPLAPLAKEEDDMECCGECDASPTSQPSEEAQACDLPLK
FT                   TKRLPSPDDHGVEMEVFSEEDPNLTIQSARKKSDAASMLSECSTIDLNDIFRNLQKTVS
FT                   PQKQPDRCFPKGLSCIFLCCKTIKKKSPWVLWWIFRKTCYQIVKHSWFESFIIFVILLS
FT                   SGALILEDVNLPSRPQVEKLLKCTDNIFTFIFLLEMILKWVAFGFRKYFTSAWCWLDFL
FT                   IVVVSVLSLTNLPNLKSFRNLRALRPLRALSQFEGMKVVVNALMSAIPAILNVLLVCLI
FT                   FWLIFCILGVNFFSGKFGRCINGTDINKYFNASNVPNQSQCLVSNHTWKVPNVNFDNVG
FT                   NAYLALLQVATYKGWLDIMNAAVDSRGKDEQPAFEANLYAYLYFVVFIIFGSFFTLNLF
FT                   IGVIIDNFNQQQKKLGGQDIFMTEEQKKYYNAMKKLGTKKPQKPIPRPLNKCQAFVFDL
FT                   VTSQVFDVIILGLIVTNMIIMMAESEGQPNEVQKIFDILNIVFVVIFTVECLIKVFALR
FT                   QHYFTNGWNLFDCVVVVLSIISTLVSGLENSNVFPPTLFRIVRLARIGRILRLVRAARG
FT                   IRTLLFALMMSLPSLFNIGLLLFLVMFIYAIFGMSWFSKVKRGSGIDDIFNFDTFSGSM
FT                   LCLFQITTSAGWDALLNPMLESKASCNSSSQESCQQPQIAIVYFVSYIIISLLIVVNMY
FT                   IAVILENFNTATEESEDPLGEDDFEIFYEIWEKFDPEATQFIQYSSLSDFADALPEPLR
FT                   VAKPNRFQFLMMDLPMVMGDRLHCMDVLFAFTTRVLGNSSGLDTMKAMMEEKFMEANPF
FT                   KKLYEPIVTTTKRKEEEECAAVIQRAYRRHMEKMIKLKLKGRSSSSLQVFCNGDLSSLD
FT                   VPKIKVHCD"
XX
SQ   Sequence 5921 BP; 1530 A; 1447 C; 1396 G; 1548 T; 0 other;
     gaaggtgcag ccagatctca gcgacagaaa tgagcagtgc cgtagttcgt ctggtgaggg        60
     tgggggctat aacaccccat ataagaagag tgtctgagcc aagggtgaag atggaggaga       120
     ggtactatcc agtgatcttc ccagacgaga ggaatttccg ccccttcact ttcgactctt       180
     tggctgcaat agagaagcgg atcaccatcc aaaaggagaa gaagaaatcc aaagacaagg       240
     cagcaactga gccccagcct cggcctcagc tcgacctaaa ggcctccagg aagttaccta       300
     agctctatgg cgacgttccc cctgacctta tagcgaagcc cctggaagat ctggacccat       360
     tttacaaaga ccataagaca ttcatggtat tgaacaagaa gagaacaatc tatcgcttca       420
     gcgccaagag ggccttgttc attctggggc cttttaatcc catcagaagc ttcatgattc       480
     gcatctctgt ccattcagtc ttcagcatgt tcattatctg cacagtgatc atcaactgta       540
     tgttcatggc taataattct tctgtggaca gtcgtcctag cagtaacatt cccgaatacg       600
     tcttcattgg gatttatgtt ttagaagctg tgattaaaat attggcaaga ggcttcattg       660
     tggatgagtt ttcctacctc cgagatcctt ggaactggct ggacttcatt gtcatcggaa       720
     cagcgatagc gccttgtttt ctcggtaaca aagtcaataa tctttccact ctacgtacct       780
     tccgagtgtt gagagctctg aaagccattt ctgtaatctc aggtctgaag gtcatcgtgg       840
     gtgccctgct gcgctccgtg aagaagctag tggacgtgat ggtcctcact ctcttttgcc       900
     tcagcatctt tgccctggtt ggtcagcagc tcttcatggg aattctgagc cagaaatgta       960
     ttaaggacga ctgtggccct aacgcttttt ccaacaagga ttgctttgta aaagaaaatg      1020
     atagcgagga cttcataatg tgtggcaact ggctcggcag aagatcctgc cccgatggtt      1080
     ccacgtgcaa taaaaccaca tttaacccag attataatta tacaaacttt gacagctttg      1140
     gctggtcttt tctcgccatg ttccgggtta tgactcaaga ctcctgggag aagctttatc      1200
     gacagatcct tcgcacctcc gggatctact ttgtcttctt cttcgtggtc gtcatcttcc      1260
     tgggctcttt ctacctgctt aacttaaccc tggctgtcgt caccatgggt tacgaggaac      1320
     agaacagaaa tgtcgctgcc gagacagaag ccaaggagaa gatgtttcag gaagcccagc      1380
     agctgttgaa ggaggaaaaa gaggctctgg ttgccatggg aattgacaga acttccctaa      1440
     attccctcca agcttcgtcc ttttccccaa agaagaggaa gttttttggc agtaagacaa      1500
     gaaagtcctt ctttatgaga gggtccaaga cggcccgagc ctcagcgtcc gattcagagg      1560
     acgatgcctc taaaaagcca caactccttg agcaaacaaa acgactatcc cagaacttgc      1620
     ccgtagaact ctttgatgag cacgtggacc ccctccatag gcagagagcg ctgagtgccg      1680
     tcagtatctt aaccatcacc atgcaggaac aagaaaaatc ccaggagcct tgtttcccgt      1740
     gtgggaaaaa cttggcatcc aagtacctgg tgtgggaatg tagccctccg tggctgtgca      1800
     taaagaaggt cctgcagact atcatgacag accccttcac tgagctggcc atcaccatct      1860
     gcatcatcgt caatactgtc ttcttggcca tggaacacca caatatggat aactctttaa      1920
     aagacatact gaaaatagga aactgggttt tcactggaat tttcatagcg gaaatgtgtc      1980
     tcaagatcat tgcgctagac ccttaccact acttccggca cggctggaac atctttgaca      2040
     gcattgtggc ccttgtgagt ctcgctgacg tgctcttcca caaactgtct aaaaacctct      2100
     ccttcttggc ttccctcaga gtgctgaggg tcttcaagtt agccaaatcc tggcccacat      2160
     taaacactct cattaagatc atcggccact ccgtgggtgc gctcggaaac ctgactgtgg      2220
     tcctaacgat cgtggtcttc atcttttccg tggttggcat gcggctcttt ggtgccaagt      2280
     ttaacaagac ttgctccacc tctccggagt ccctccggcg ccggcacatg ggtgatttct      2340
     accattcctt cctggtggtg ttccgcatcc tctgtgggga gtggatagag accatgtggg      2400
     actgcatgca ggagatggaa ggctccccgc tgtgtgtcat cgtctttgtg ctgatcatgg      2460
     tggtcgggaa gctcgtggtg cttaacctct tcattgcctt gctgctcaat tccttcagca      2520
     atgaggaaaa ggatgggaac ccagaaggag agaccaggaa aaccaaagtg cagctagccc      2580
     tggatcggtt cagccgagcg ttctacttca tggcgcgcgc tcttcagaat ttctgtcgca      2640
     agagatgcag gaggcaaaac tcgccaaagc caaatgaggc aacagaaagc tttgctggtg      2700
     agagtagaga cacagccacc ctggatacaa ggtcctggaa ggagtatgat tcagaaatga      2760
     ctctgtacac tgggcaggcc ggggctccac tggccccact ggcaaaagaa gaggacgata      2820
     tggaatgttg tggtgaatgt gatgcctcac ctacctcaca gcctagtgag gaagctcagg      2880
     cctgtgacct ccctctgaag accaagcggc tccccagccc agatgaccac ggggttgaaa      2940
     tggaagtgtt ttccgaagaa gatccgaatt taaccataca gagtgctcga aagaagtctg      3000
     atgcggcaag catgctctca gaatgcagca caatagacct gaatgatatc tttagaaatt      3060
     tacagaaaac agtttccccc caaaagcaac cagatcgatg ctttcccaag ggcctcagtt      3120
     gtatctttct atgttgcaaa acaatcaaaa aaaagtcccc ctgggtcctg tggtggatct      3180
     ttcggaaaac ctgctaccaa atcgtgaagc atagctggtt tgagagcttc ataatttttg      3240
     tcatcctgct gagcagcgga gcactgatat tggaagatgt caatcttccc agccggcccc      3300
     aagttgaaaa attactgaag tgtaccgata atattttcac atttattttt ctcctggaaa      3360
     tgattttgaa gtgggtggcc tttggattcc ggaagtattt caccagtgcc tggtgctggc      3420
     tcgatttcct cattgtggtg gtgtctgtgc tcagcctcac gaacttacca aacttgaagt      3480
     ccttccggaa tctgcgagcg ctgagacctc tgcgggcact gtctcagttt gaaggaatga      3540
     aggttgttgt caatgccctc atgagtgcca tacctgccat cctcaatgtc ttgctggtct      3600
     gcctcatttt ctggctcata ttttgtatcc tgggagtaaa ttttttttct gggaagtttg      3660
     gaagatgcat taatggaaca gacataaata aatatttcaa cgcttccaat gttccaaacc      3720
     aaagccaatg tttagttagt aatcacacgt ggaaagtccc gaatgtcaac tttgacaacg      3780
     tggggaatgc ctaccttgcc ctgctgcaag tggcgaccta taagggctgg ctggacatta      3840
     tgaatgcagc tgttgattcc agagggaaag atgagcagcc ggcctttgag gcgaatctat      3900
     acgcatacct ttacttcgtg gtttttatca tcttcggctc attctttacc ctgaacctct      3960
     ttatcggtgt tattattgac aacttcaatc agcagcagaa aaagttaggt ggccaagaca      4020
     tttttatgac agaagaacag aagaaatact acaatgccat gaaaaagtta ggaaccaaga      4080
     agcctcaaaa gcccatccca aggcccctga acaaatgtca agccttcgtg ttcgatttgg      4140
     tcacaagcca ggtctttgac gtcatcattc tgggtcttat tgtcacaaac atgattatca      4200
     tgatggctga atctgaaggc cagcccaacg aagtgcagaa aatctttgat attctcaaca      4260
     tagtcttcgt ggtcatcttt accgtagagt gtctcatcaa agtctttgct ttgaggcaac      4320
     actacttcac caatggctgg aacttatttg attgtgtggt cgtggttctt tccatcatta      4380
     gtaccttggt ttctggcttg gagaacagca acgtcttccc gcccacgctc ttcaggattg      4440
     tccgcttggc tcggatcggt cgaatcctca gactggtccg ggcggctcga ggaatcagga      4500
     cactcctttt cgcgttgatg atgtctctcc cctctctctt caacattggt ctgcttctct      4560
     ttctggtgat gttcatttat gccatctttg ggatgagctg gttttccaaa gtgaagagag      4620
     gctctgggat tgatgacatc ttcaactttg acactttctc gggcagcatg ctctgcctct      4680
     tccagataac cacttcagcc ggctgggatg ctctcctcaa ccccatgctg gaatcaaaag      4740
     cctcttgcaa ttcctcctcc caagagagct gtcagcagcc gcagatagcc atagtctact      4800
     tcgtcagcta catcatcatc tcccttctca ttgtggttaa catgtacata gctgtgattc      4860
     tagagaactt caacacagcc acagaggaga gcgaggaccc cctgggcgaa gacgactttg      4920
     agatcttcta tgagatctgg gagaagtttg accccgaagc aacacagttc atccagtact      4980
     catccctctc tgacttcgcc gacgccctgc ccgagccgtt gcgtgtggcc aagcccaaca      5040
     ggtttcagtt tctcatgatg gacttgccca tggtgatggg tgatcgcctc cattgcatgg      5100
     atgttctctt tgctttcacc accagggtcc tcgggaactc cagcggcttg gataccatga      5160
     aagccatgat ggaggagaag ttcatggagg ctaatccttt caagaagttg tacgagccca      5220
     ttgtcaccac cacaaagagg aaggaggagg aggaatgtgc cgctgtcatc cagagggcct      5280
     accggagaca catggagaag atgatcaagc tgaagctgaa aggcaggtca agttcatcgc      5340
     tccaggtgtt ttgcaatgga gacttgtcta gcttggatgt gcccaagatc aaggttcatt      5400
     gtgactgaaa cccccacctg cacgcctacc tcacagcctc acagctcagc ccccagcctc      5460
     tggcgaacaa gcggcggact caccgaacag gccgttcaac ttgttttttt gggtgaaaga      5520
     ggtgataggt tggtgtccat ttttaaatga ttcttggaaa gattgaacgt cggaacatgt      5580
     tagaaaggac tgccaaggac atccacagta acggaaggcc tgaaggacag ttcaaattat      5640
     gtaaagaaac gagaaggaaa ggtcacatgt ctgttcagtt ttaagtatgt gacctgccac      5700
     atgtagctcc tttgcatgtt aagtgagaag tcaaaaccct gccataagta aatagctttg      5760
     ttgcaggtgt ttctaccagt gctgcggatt tgggtgtatg gctcaaacct gaaagcatga      5820
     ctctgacttg tcagcacccc aactttcaga agctctgatc tctgtcctag gtgtttgaca      5880
     aataaataca taaaaaaaaa aaaaaaaaaa aaaaaaaaaa a                          5921
//