Dbfetch

ID   AB030950; SV 1; linear; genomic DNA; STD; HUM; 199 BP.
XX
AC   AB030950;
XX
DT   11-JAN-2000 (Rel. 62, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Homo sapiens TNFR2 gene for tumor necrosis factor receptor 2, partial cds.
XX
KW   TNFR2; tumor necrosis factor receptor 2.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-199
RA   Komata T., Tsuchiya N., Tokunaga K.;
RT   ;
RL   Submitted (09-AUG-1999) to the INSDC.
RL   Tae Komata, University of Tokyo, Department of Human Genetics, Graduate
RL   School of Medicine; 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033, Japan
RL   (E-mail:tae@m.u-tokyo.ac.jp, Tel:81-3-5841-3693, Fax:81-3-5802-8619)
XX
RN   [2]
RX   DOI; 10.1038/sj.gene.6363700.
RX   PUBMED; 11197692.
RA   Tsuchiya N., Komata T., Matsushita M., Ohashi J., Tokunaga K.;
RT   "New single nucleotide polymorphisms in the coding region of human TNFR2:
RT   association with systemic lupus erythematosus";
RL   Genes Immun. 1(8):501-503(2000).
XX
DR   MD5; a84446083894011ec8e13d918d738f46.
DR   Ensembl-Gn; ENSG00000028137; homo_sapiens.
DR   Ensembl-Tr; ENST00000376259; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..199
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <58..>151
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="TNFR2"
FT                   /product="tumor necrosis factor receptor 2"
FT                   /db_xref="GOA:P20333"
FT                   /db_xref="HGNC:HGNC:11917"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR020411"
FT                   /db_xref="InterPro:IPR033996"
FT                   /db_xref="PDB:1CA9"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20333"
FT                   /protein_id="BAA89053.1"
FT                   /translation="TETSDVVCKPCAPGTFSNTTSSTDICRPHQ"
FT   exon            58..151
FT                   /number=5
FT   variation       143
FT                   /replace="c"
XX
SQ   Sequence 199 BP; 40 A; 51 C; 62 G; 46 T; 0 other;
     gcccagctgt cccgcagagt gtctgagtgg ttgacaagtt cggattgttc cctgaaggaa        60
     ctgaaacatc agacgtggtg tgcaagccct gtgccccggg gacgttctcc aacacgactt       120
     catccacgga tatttgcagg cctcaccaga tgtgagtagc tgagtccttt ggttctggag       180
     gagcagggag gggctgtcc                                                    199
//