Dbfetch

ID   AB030949; SV 1; linear; genomic DNA; STD; HUM; 219 BP.
XX
AC   AB030949;
XX
DT   11-JAN-2000 (Rel. 62, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Homo sapiens TNFR2 gene for tumor necrosis factor receptor 2, partial cds.
XX
KW   TNFR2; tumor necrosis factor receptor 2.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-219
RA   Komata T., Tsuchiya N., Tokunaga K.;
RT   ;
RL   Submitted (09-AUG-1999) to the INSDC.
RL   Tae Komata, University of Tokyo, Department of Human Genetics, Graduate
RL   School of Medicine; 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-0033, Japan
RL   (E-mail:tae@m.u-tokyo.ac.jp, Tel:81-3-5841-3693, Fax:81-3-5802-8619)
XX
RN   [2]
RX   DOI; 10.1038/sj.gene.6363700.
RX   PUBMED; 11197692.
RA   Tsuchiya N., Komata T., Matsushita M., Ohashi J., Tokunaga K.;
RT   "New single nucleotide polymorphisms in the coding region of human TNFR2:
RT   association with systemic lupus erythematosus";
RL   Genes Immun. 1(8):501-503(2000).
XX
DR   MD5; 62d916b5f72fb11a861bf424ddd10386.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..219
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <64..>163
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="TNFR2"
FT                   /product="tumor necrosis factor receptor 2"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UIH2"
FT                   /protein_id="BAA89052.1"
FT                   /translation="VAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSP"
FT   exon            64..163
FT                   /number=2
FT   variation       153
FT                   /replace="a"
FT   variation       176
FT                   /replace="a"
XX
SQ   Sequence 219 BP; 42 A; 66 C; 72 G; 39 T; 0 other;
     atcaggcatg gcagaaccca ggggcggccc tgttgatggc agtcttccct tcttccttcc        60
     aaggtggcat ttacacccta cgccccggag cccgggagca catgccggct cagagaatac       120
     tatgaccaga cagctcagat gtgctgcagc aagtgctcgc cgggtgaggg cagccgcggg       180
     ggcactcggg gcccatgcct ggaggagcgt gtgtgtaca                              219
//