Dbfetch

ID   AB030013; SV 1; linear; genomic DNA; STD; MUS; 7692 BP.
XX
AC   AB030013;
XX
DT   11-JAN-2000 (Rel. 62, Created)
DT   11-JAN-2000 (Rel. 62, Last updated, Version 1)
XX
DE   Mus musculus V1aR gene for V1a arginine vasopressin receptor, complete cds.
XX
KW   V1a arginine vasopressin receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7692
RA   Tsujimoto G., Kikuchi S.;
RT   ;
RL   Submitted (13-JUL-1999) to the INSDC.
RL   Gozoh Tsujimoto, National Children's Medical Research Center, Molecular
RL   Pharmacology; 3-35-31 Taishido, Setagaya-ku, Tokyo-to 154-8509, Japan
RL   (E-mail:skikuchi@nch.go.jp, Tel:81-3-3414-8121(ex.2733),
RL   Fax:81-3-3419-1252)
XX
RN   [2]
RX   DOI; 10.1254/jjp.81.388.
RX   PUBMED; 10669045.
RA   Kikuchi S., Tanoue A., Goda N., Matsuo N., Tsujimoto G.;
RT   "Structure and sequence of the mouse V1a and V1b vasopressin receptor
RT   genes";
RL   Jpn. J. Pharmacol. 81(4):388-392(1999).
XX
DR   MD5; c95de481790949baa2b0685648bf01ee.
DR   Ensembl-Gn; ENSMUSG00000020123; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017789; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017764; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017727; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017728; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017552; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018183; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017112; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017521; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017627; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017622; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017701; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017650; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018223; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016897; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017173; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000020323; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027269; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027239; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027214; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027217; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027025; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027721; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026621; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0026949; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027073; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027070; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027188; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027048; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027745; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026326; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026549; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7692
FT                   /organism="Mus musculus"
FT                   /strain="129SVJ"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /dev_stage="4-8 weeks"
FT                   /tissue_lib="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             join(2060..3044,5333..5619)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="V1aR"
FT                   /product="V1a arginine vasopressin receptor"
FT                   /db_xref="GOA:Q62463"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001224"
FT                   /db_xref="InterPro:IPR001817"
FT                   /db_xref="InterPro:IPR015076"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1859216"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62463"
FT                   /protein_id="BAA89050.1"
FT                   /translation="MSFPRGSHDLPAGNSSPWWPLTTEGANSSREAAGLGEGGSPPGDV
FT                   RNEELAKLEFTVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQ
FT                   VLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQP
FT                   ARRSRLMIAASWGLSFVLSIPQYFIFSVIEFEVNNGTKAQDCWATFIPPWGTRAYVTWM
FT                   TSGVFVVPVIILGTCYGFICYHIWRNVRGKTASRQSKGGKGSGEAAGPFHKGLLVTPCV
FT                   SSVKSISRAKIRTVKMTFVIVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITAL
FT                   LASLNSCCNPWIYMFFSGHLLQDCVQSFPCCQSIAQKFAKDDSDSMSRRQTSYSNNRSP
FT                   TNSTGTWKDSPKSSKSIRFIPVST"
XX
SQ   Sequence 7692 BP; 2061 A; 1684 C; 1759 G; 2181 T; 7 other;
     tcctcattgt atcaaggctt agcacctggg tttcctggaa gccacnaacc attttcttgg        60
     gaaaaggcta cctattcctt cttctcagga aaacctaaag tcccaaatgt gtcagcccca       120
     agagctgtca agctcctggc tctgtctgac cagtggactg tttttgcaga cactagggtc       180
     agccattatt tctcacacaa aacattaata aagaaatttc tgtattcaaa aaataaatta       240
     taaagttacc actctaaggc agtgactata atctaactgc ttgaaggttt tgttttcttt       300
     ttctcagaca cgtgttttgg aaacctttct cttttgtact ttgccagcca tcttggaagg       360
     atgcgccgtc gagtttcatg ttcacagaac ctctctactg ggccgtggca ttgcttgatc       420
     ctccattgac tctgtaactg agagcaacac atacttccat tcccaatttt aagatgcata       480
     gacagacgct tatgtaacca tgatgagact gatccaagta ttccaagtcc ctggccctga       540
     gtttctagca aaccaaactt tacggaagaa aatcttttga tgtttatgat tgtatttcac       600
     aagagaaaat atttcttttc aggagcaatt aggtttgtat tattgccaca acacaccaac       660
     gctctgacca agaaactgaa gttcctgccc cggcatctgt gtttgtgtgt gtccttcttc       720
     agaaacagcg ccccctgctg tcctcagtat cattctctcc ccagagttaa gacagttgct       780
     ggagtctgta gaagtgtttg tctctacagc tggatgcaga aggccagagc aaataattaa       840
     ttaccggggc gggggggggg ggagggcgag gggcgaggga agtagttctt cttttccttc       900
     ggagtgcctc gttccctctc cctagctaca gagagagaga gagagagaga cagagagaga       960
     gacagacaga gagagagaga gagagacaga gagagacaga gagagagaga gagagagaag      1020
     agacgcacag agggagaagg aaacaagaca gagatacaga gacacagagt gatacaagag      1080
     acacagacag acagacagac cggcaggcag gcaggcaggc agagatggag atagactggt      1140
     agaccagaca ctggtcctca gctctctctg tctgccctaa gaaatgtcag cagatttagt      1200
     catttaattg gacaaggttt ccaccagcca gtgcagccca gttcttgccc cctgctgctt      1260
     tgggaattgg actttctaga gtcaccaagg tagattacgc acacccagca agaggagtga      1320
     agggtacaag tgagtgggcc tttcctgttc gcgaatgaag gcagtgtgac agagtcacca      1380
     gaaaaggagg tcacacgatt tttaccctca aagtgcaagg gtaaaccggg cagggaataa      1440
     aatcagccct agtggctagg ctagggatac gcgccgggca gggaaacaca gggcctgggg      1500
     gcttggaagg gtggacccca aatccaggcg cactgagttc gcagcagcag cagacgcgga      1560
     tctctacgta cgcttttact acacctgttg acgcgctgca tgactttaaa ttggcttata      1620
     aaggaggctg gagaaattcc gaggagccca gagaagtttg gggcagatcc ggaaagcgcc      1680
     cggctctgca gaggaatcta ggattctcag ctccacccct gcagcaccaa agagaaaagg      1740
     acaaatcacc aacgacttgg aggggttggg tgtaggggac agtctccagc cactaagatg      1800
     agaaggagcg catcctgagg cagcctaaga ctgctttggg agcagggaga gtccgctccc      1860
     ttgcctcgga caagccggag cagggacacg caagaacatc ccatccaaaa ccactctgag      1920
     cgcgcgtggg attgcgcacg aaagagagcg aggtaaggaa ggacggtgcg cagaacttag      1980
     gacgcgggtc ttcgggtcct ccgtggagaa gaggaagcag cccacgagga acagggttcc      2040
     ccggctctgt gccgacagca tgagtttccc gcgaggctcc cacgatctgc ccgcgggcaa      2100
     ctccagcccg tggtggcctc tgaccaccga gggcgccaac agcagccggg aagcagctgg      2160
     gctcggggaa ggcggcagcc cgccggggga cgtacgcaac gaggagctgg cgaagctgga      2220
     gtttaccgtg ctggcggtga ttttcgtggt ggccgtgctg ggtaatagca gtgtgctgct      2280
     ggcgctgcat cgcacgccac gcaagacatc ccgcatgcat ctcttcatcc gacacctcag      2340
     cctggcagac ctggcggtcg ccttcttcca agtgttacca cagctgtgct gggacatcac      2400
     ctaccgcttc cgcgggccgg actggctgtg ccgggtggtg aagcacttgc aggtgtttgc      2460
     catgttcgca tcttcctaca tgctggtggt gatgacggct gaccgctaca tcgccgtgtg      2520
     ccacccgctc aagaccctgc agcagcccgc gcgccgctcg cgcctcatga tcgccgcctc      2580
     ttgggggctg agtttcgttc tgagcatacc acagtacttt atcttctctg tgatcgaatt      2640
     tgaggtgaac aatggcacca aagcccaaga ttgctgggct accttcatcc cgccctgggg      2700
     tacccgtgcc tacgtgacct ggatgaccag cggggtcttc gtggtacccg tgatcatctt      2760
     gggtacctgc tatggcttca tctgttacca catctggcgc aatgtccgag ggaagacagc      2820
     atcgcgacag agcaaaggcg gcaagggctc tggggaagcc gcgggtccct tccacaaggg      2880
     gcttctggtc acgccttgtg tcagcagcgt gaagagcatt tcccgtgcca agatccgcac      2940
     agtgaagatg acctttgtga ttgtaagcgc ctacatcctc tgctggacac ctttcttcat      3000
     cgtccagatg tggtcagtct gggataccaa tttcgtttgg accggtatgt actgagacta      3060
     ctatggaaga ggtgngtgtg tgtgtgtgtg tgtgtgtgtg tgtgtgcccg tgtgtttgtg      3120
     gtgtgtgttg gggggggagt gtttgtggtg tgtgtgtgta tgtatgttat ttttcataca      3180
     acctattcaa tagttaagct tctatgtaag aagtcttaaa tgaacaaaat tgcaaattcc      3240
     tgggacctcc accccaggta cactggagcc caggattcag catctgcagc atgtgtgacc      3300
     accctaaggc caccagctgt gcctagagtc actagttaca aaacacttgt gacattttgc      3360
     caaattactt agggttcttg gatatcctgc cttcccatag aggctctggg gaatattctt      3420
     catgtcttgg ctactttttg ttggattaag gaaactatca caatcaacag aaaacttctc      3480
     atgagattct tccaagacca aggttagaga tagacacact gttctgaaac aaacagaacg      3540
     gatttaagaa gttagaaatt ccaaatttgc atttagtttg tgcaacccat cttcattata      3600
     acgttttcat ttttccaact gtaataactt tcttttcctg gcatccaaat cagaagtctt      3660
     gatcagctaa attcactgga cttcccgcgg gaagttaaca acaaaactat tcacgccaca      3720
     caaatccctc tgtagttaat tgtgaaagtt ccccatccca actggctggg ttttatttca      3780
     gttcattcac aaaacagaaa aatccatttc ccaggagttt attgtttatt tattttgatc      3840
     ttgtaatata tcttctttta attaggaaaa aaaaaaaaag actttccaaa ccaagtatgt      3900
     tacagaagat ttcctgatga aaactctaat caggatataa atatctagga gaagctatac      3960
     ctttctgtaa ttttaagatt ggggtttgga atatatgcaa tgcatttaaa tatattattt      4020
     tgaatgttca tagatttcgt ttaagcaaat acttttagag gctgcattgc tcatagtagt      4080
     aaataaatgc aaagtccttt agtcaatgcc aatcacattt taaaattctg tccattgctt      4140
     tattgtgatt tagacacagt tagtagaatt ttcccttgca ctacacatgt tgaagatgcc      4200
     tgttattttt aatattgtgc gtggcttatg gtcacctagc acagagcaac gaatggcttg      4260
     caccagtgac tctcaacctt ctcagtcctg ccacactcaa cacagttcct cgtgctgtga      4320
     tgacccccaa ccatgaaatt ggctttgtca ctacttcgta actgtaactt tgctacggct      4380
     tccaatcaga atgtgagtat ctgatatgca gccggtctca ggtgacttcg gtgacaaggc      4440
     tgttcatggt gagccacagg ttgagaacca ctggtctaca gtctcttttg catgacaaaa      4500
     gtggggtgtt aggagtcata taccaatcag aagacagttg atgtttgatg gttgttctta      4560
     ttttttaata acagttcaaa tagtttcacc atgaaaactt tgatagccat gtagcttact      4620
     aggggtcatt cactgaatag ttcaaaatcc tgttgggact ccctaactca gctactttgg      4680
     gatttttctt tttttgtccg ttttaatttt tgttttgttc ctgttgtttg aaatggggcc      4740
     atatacaacc cagatgtttt tcttattata atttaattgc ttgaactaca atcaaggaca      4800
     gtcttttaaa atcaaaccaa atgtctaatg attcacaaaa attcaattga agctggggat      4860
     tctattttaa atactctctt ccatacggtt ttcattgata tctgttgaac agcccatatg      4920
     gcattgccaa gttctaggat gaaacattca gtttatgtga ttataaacac ttcaaatgtc      4980
     cttctgttaa taccatgtct ttgtgaatac cttcacaaag gctcctgcca ctgtatagta      5040
     tacagtttta aaataagtta ttcagtatct tcatcttctt agactttata tccattgtat      5100
     tgaagagttc taacagtgac tggtttaaac tatttgaact aatcttaaga cattttcttt      5160
     tacaaccagt ctccaaaaag tactcatttc cctgaaacac catttcccta acaaataaga      5220
     tgtccatttt tatcactaat atggagcttt ttgacttgtt agtcggtagg gcatagggtc      5280
     ggggtctccc tctggctgtt gatatgatct ctctcctcgt ttccccacac agattccgaa      5340
     aacccttcca ccacgatcac ggcgttactg gcttccttga acagctgctg caacccgtgg      5400
     atctacatgt tttttagtgg tcatctccta caagattgtg tccagagctt cccatgctgc      5460
     caaagcatag cgcagaaatt cgccaaggat gactcggata gcatgagccg gagacagaca      5520
     tcttattcta acaaccgaag cccaacaaac agcactggga cgtggaagga ttcacctaaa      5580
     tcttcaaagt ccatcagatt tatccctgtc tccacttgag ccgcatatcc acgcagccag      5640
     actcttggac ggggcttgtg tgtccagcta gagagcttaa gagtaaatat gtttatgtga      5700
     catagacata aatcaactca gtgtatacat tgtttctaca acttggtgta tacattgttt      5760
     ctacaattca gtgtatacat tgtttctagc tgtgtttttc ccattgctgt gaccaaaacc      5820
     tgaattcttt tgcatagcat attaatgaaa atgtaccaca tgggaaatgt ataggcctgg      5880
     ttcgtaagca tactgacttt atattttgtg gttgattttt ttttattgta tttttatgtc      5940
     taatgtgagg cttggattgg tttaagtcat gtgataagca ctgttgtttc tacacaaagt      6000
     gaaactggtc cgtgattgaa aacccagtgt tgctgtcaat ctgtgtgtgc ataaaaatgt      6060
     acagacaaga ggtagagagg agttgggttg agggtgggaa ggaaggtagc ttggtacctg      6120
     gctgcccttc cttcagagtc ctgacactct attagcactg aaaatcatgc tcaccaacag      6180
     acagaaggtt tgagaatgtt ttaggacaat aatttgtatg gggggggggg tgccacactt      6240
     tatagaggca taagagaaaa gatttctaca gacattcttt gggatatttt aaacatccat      6300
     ggaccagcac cataaggtag tctgtgctac accagatgtt aacacttagt acctagtcgg      6360
     tgaatccaga ttcagagatt ctaagtctcc tagataactc cagacataag atactcaaaa      6420
     catgttgatt taaatcagtt tatttatttc ttcacatttc ccatccacac agcagggcca      6480
     gaacacagag ggtgaagaca tgtggagaaa cgggagacag acagaaagag aggggggtct      6540
     gagccttgtg tctgttcctt catgaatgta tgattttcag aaagatactt aaaaatattt      6600
     aaagccttgg tttcttggct gtacaatggg cttggtaaca ctcacctcac agggttgttg      6660
     tgaagattaa ataatgttaa atgtgtgaag agttattttt aaaaaaaatg taaagtgcta      6720
     cccatggtcc agcaagttga tttttactgt tctcttggga tcttcagaac tacagttttg      6780
     ttttgttttg ctttcagttt atttttttgt gaactaacat ttgttgcttc atgtctggga      6840
     ccgaaaacct agcatttaaa tatagatctg ctgattcact atagagcctt gccagccact      6900
     actgagcttg ccttgcttat gccaccgcag tctgccagtg catagctaga actcgctttc      6960
     agtgcagatc atcacattct ttccttgcta attgaagata aatgacaaca cctcttggct      7020
     gtggtcttta cattttttat cagtgagccc ctgctgtctg gctagctctt caagatcaag      7080
     taatggttgg atgatgaatc agaactttta gcaattcttg agtaagaaat agctgctttt      7140
     aatagtatcg tcgggtttct ttttttaacc ctatagataa gagaccttag gctggatggc      7200
     acccggtaac ccagaatcac aagctcggct cttcttcatt ctactgcatt tcccagttct      7260
     cagccctcag agtctctggg ttgataggtc aaaaacagtt tccaaacatt cgggagagat      7320
     tgttccctta ggttttagaa ttcttcttcc taaaataaca aatggggctg tgatgtggta      7380
     aagcacttgc ctttcaatct atctccatca tcagaaaaat aaccatacca agtaaaattc      7440
     acacacacac acacacacac gatatatatg tgtgcatatg tgtgtgtatg catgagtgca      7500
     tgtgtgtgtg gggtgtgcaa tgtgtgtttg ttaaaaagtc cagttcaaca tgagccatca      7560
     acccaggtcc caaaatcttt attgtttgaa gttataaccg ccccgncnat agcctgtgtt      7620
     agaatggtct attttaacaa ttttccctga atattaaaaa nctaaancct ttgggggaaa      7680
     gttaaaaaaa na                                                          7692
//