spacer

EBI Dbfetch

ID   AB029886; SV 1; linear; mRNA; STD; HUM; 1473 BP.
XX
AC   AB029886;
XX
DT   16-JUL-1999 (Rel. 60, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens mRNA for choline/ethanolamine kinase, complete cds.
XX
KW   choline/ethanolamine kinase.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1473
RA   Yamazaki N.;
RT   ;
RL   Submitted (09-JUL-1999) to the INSDC.
RL   Naoshi Yamazaki, University of Tokushima, Faculty of Pharmaceutical
RL   Sciences; Syomachi, Tokushima, Tokushima 770-8505, Japan
RL   (E-mail:yamazaki@fc.ph.tokushima-u.ac.jp, Tel:+81-88-633-7279,
RL   Fax:+81-88-633-7280)
XX
RN   [2]
RX   DOI; 10.1074/jbc.M006322200.
RX   PUBMED; 10918069.
RA   Yamazaki N., Shinohara Y., Kajimoto K., Shindo M., Terada H.;
RT   "Novel expression of equivocal messages containing both regions of
RT   choline/ethanolamine kinase and muscle type carnitine palmitoyltransferase
RT   I";
RL   J Biol Chem 275(41):31739-31746(2000).
XX
DR   MD5; 5d931afe275634a2d195a0c5b6ab2d0c.
DR   Ensembl-Gn; ENSG00000100288; homo_sapiens.
DR   Ensembl-Tr; ENST00000406938; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1473
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             69..1256
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="choline/ethanolamine kinase"
FT                   /db_xref="GOA:Q9Y259"
FT                   /db_xref="H-InvDB:HIT000058973.12"
FT                   /db_xref="HGNC:HGNC:1938"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="PDB:2IG7"
FT                   /db_xref="PDB:3FEG"
FT                   /db_xref="PDB:3LQ3"
FT                   /protein_id="BAA82512.1"
FT                   /translation="MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDA
FT                   ERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLR
FT                   LYGAILQGVDSLVLESVMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVL
FT                   SAAIATKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEM
FT                   GNLRKLLESTPSPVVFCHNDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHF
FT                   CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLV
FT                   EVSRYALASHFFWGLWSILQASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS"
FT   polyA_signal    1452..1457
XX
SQ   Sequence 1473 BP; 318 A; 423 C; 437 G; 295 T; 0 other;
     ggaaggaacc gagcccgtcc gaagggagcg gagcgcagcc tggcctgggg cccggtcgag        60
     cccgcgccat ggcggccgag gcgacagctg tggccggaag cggggctgtt ggcggctgcc       120
     tggccaaaga cggcttgcag cagtctaagt gcccggacac taccccaaaa cggcggcgcg       180
     cctcgtcgct gtcgcgtgac gccgagcgcc gagcctacca atggtgccgg gagtacttgg       240
     gcggggcctg gcgccgagtg cagcccgagg agctgagggt ttaccccgtg agcggaggcc       300
     tcagcaacct gctcttccgc tgctcgctcc cggaccacct gcccagcgtt ggcgaggagc       360
     cccgggaggt gcttctgcgg ctgtacggag ccatcttgca gggcgtggac tccctggtgc       420
     tagaaagcgt gatgttcgcc atacttgcgg agcggtcgct ggggccccag ctgtacggag       480
     tcttcccaga gggccggctg gaacagtaca tcccaagtcg gccattgaaa actcaagagc       540
     ttcgagagcc agtgttgtca gcagccattg ccacgaagat ggcgcaattt catggcatgg       600
     agatgccttt caccaaggag ccccactggc tgtttgggac catggagcgg tacctaaaac       660
     agatccagga cctgccccca actggcctcc ctgagatgaa cctgctggag atgtacagcc       720
     tgaaggatga gatgggcaac ctcaggaagt tactagagtc taccccatcg ccagtcgtct       780
     tctgccacaa tgacatccag gaagggaaca tcttgctgct ctcagagcca gaaaatgctg       840
     acagcctcat gctggtggac ttcgagtaca gcagttataa ctataggggc tttgacattg       900
     ggaaccattt ttgtgagtgg gtttatgatt atactcacga ggaatggcct ttctacaaag       960
     caaggcccac agactacccc actcaagaac agcagttgca ttttattcgt cattacctgg      1020
     cagaggcaaa gaaaggtgag accctctccc aagaggagca gagaaaactg gaagaagatt      1080
     tgctggtaga agtcagtcgg tatgctctgg catcccattt cttctggggt ctgtggtcca      1140
     tcctccaggc atccatgtcc accatagaat ttggttactt ggactatgcc cagtctcggt      1200
     tccagttcta cttccagcag aaggggcagc tgaccagtgt ccactcctca tcctgactcc      1260
     accctcccac tccttggatt tctcctggag cctccagggc aggaccttgg agggaggaac      1320
     aacgagcaga aggccctggc gactgggctg agcccccaag tgaaactgag gttcaggaga      1380
     ccggcctgtt cctgagtttg agtaggtccc catggctggc aggccagagc cccgtgctgt      1440
     gtatgtaaca caataaacaa gcttcttctt ccc                                   1473
//


spacer
spacer