Dbfetch

ID   AB028640; SV 1; linear; mRNA; STD; MUS; 2848 BP.
XX
AC   AB028640;
XX
DT   15-JUN-1999 (Rel. 60, Created)
DT   15-MAY-2009 (Rel. 100, Last updated, Version 5)
XX
DE   Mus musculus Capn7 mRNA for PalBH, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2848
RA   Futai E., Sorimachi H., Maeda T., Suzuki K.;
RT   ;
RL   Submitted (07-JUN-1999) to the INSDC.
RL   Contact:Hiroyuki Sorimachi University of Tokyo, Graduate School of
RL   Agricultural and Life Sciences; 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657,
RL   Japan
XX
RN   [2]
RX   DOI; 10.1016/S0167-4781(00)00256-6.
RX   PUBMED; 11342116.
RA   Futai E., Kubo T., Sorimachi H., Suzuki K., Maeda T.;
RT   "Molecular cloning of PalBH, a mammalian homologue of the Aspergillus
RT   atypical calpain PalB";
RL   Biochim. Biophys. Acta 1517(2):316-319(2001).
XX
DR   MD5; b5420be081a172bcebd65225d4b7eb5b.
DR   Ensembl-Gn; ENSMUSG00000021893; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021127; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021075; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021052; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021079; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020862; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021511; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020387; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020829; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020951; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020935; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021020; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020961; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021544; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020135; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020442; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022451; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0038798; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0038758; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0038719; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0038761; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0038505; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0039216; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0038512; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0038425; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0038566; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0038536; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0038655; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0038524; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0039261; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0038126; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0037908; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2848
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             159..2600
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="Capn7"
FT                   /product="PalBH"
FT                   /EC_number="3.4.22.52"
FT                   /note="calpain-like protease"
FT                   /db_xref="GOA:Q9R1S8"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="InterPro:IPR036181"
FT                   /db_xref="InterPro:IPR036213"
FT                   /db_xref="MGI:MGI:1338030"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R1S8"
FT                   /protein_id="BAA78731.1"
FT                   /translation="MDASALERDAVQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEM
FT                   AGSSLERIQEKINEYLERVQALHSAVQSKSTDPLKSKHQLDLERAHFLVTQAFDEDEKG
FT                   NVEDAIELYTEAVELCLKTSSETADKTLQNKLKQLARQALDRAEALSEPLTKPFCKLKS
FT                   ANMKTKTPPVRTHFPLGPNPFVEKPQAFISPQSCDAQGQKYTAEEIEVLRTTSKINGVE
FT                   YVPFMSVDLRERFAYPMPFCDRLGKLPLSPKQKTTFSKWVRPEDLTNNPTMIYTVSSFS
FT                   IKQTIVSDCSFVASLAISAAYERRFNKKLITSIIYPQNKDGEPEYNPCGKYMVKLHLNG
FT                   VPRKVIIDDQLPVDHKGELLCSYSNNKSELWVSLIEKAYMKVMGGYDFPGSNSNIDLHA
FT                   LTGWIPERIAMHSDSQTFSKDNSFRMLYQRFHKGDVLITASTGVMTEAEGEKWGLVPTH
FT                   AYAVLDIREFKGLRFIQLKNPWSHLRWKGRYSENDVKNWTPELQKYLNFDPRTAQKIDN
FT                   GIFWISWDDLCQYYDVVYLSWNPALFKESTCIHSTWDAKQGPVKDAYSLANNPQYKLEV
FT                   QCPQGGAAVWVLLSRHITDKDDFANNREFITMVVYKTDGKKVYYPADPPPYIDGIRINS
FT                   PHYLTKIKLTTPGTHTFTLVVSQYEKQNTIHYTVRVYSACSFTFSKIPSPYTLSKRING
FT                   KWSGQSAGGCGNFQETHKNNPIYQFHIDKTGPLLIELRGPRQYSVGFEVVAVSIMGDPG
FT                   PHGFQRKSSGDYRCGFCYLELENIPAGIFNIIPSTFLPKQEGPFFLDFNSTVPIKTTQL
FT                   Q"
XX
SQ   Sequence 2848 BP; 848 A; 594 C; 662 G; 744 T; 0 other;
     gtctgaggta gtggggctcc gtcatctctt ccgccgccct cgaaagtaaa ctttgccact        60
     ccacccgcgg ggtccccagt tctcgccgca gtgcctccgg gcgtcggggt tccgcgtcag       120
     ggcctgtctg cctcccccgg cgtggggcct tgggcgccat ggacgcgtcg gcgctggagc       180
     gggacgccgt gcagttcgcg cggctggcag tgcagcgcga ccacgaaggc cgctactctg       240
     aggcggtgtt ttactacaag gaagctgccc aagctttaat ttatgctgag atggcaggat       300
     ccagcctaga aaggatccaa gagaagatca atgagtatct ggaaagagtg caagcccttc       360
     actctgcagt tcagtcaaag agtactgatc ctttgaaatc aaaacaccag ttggatctag       420
     aacgtgccca ttttcttgtt acacaagctt tcgatgaaga tgaaaagggg aatgtggaag       480
     atgccataga attatataca gaagctgtgg aactctgtct aaaaacctct tctgaaactg       540
     ctgacaagac tctgcaaaat aaattgaaac agttggctcg acaggcacta gatagagcag       600
     aagcattgag tgaacctttg acaaagccat tttgcaaact caagtcagca aatatgaaaa       660
     caaagactcc tccagtaaga acacactttc ctctaggacc taatcctttc gttgaaaagc       720
     ctcaagcatt tataagtcca cagtcatgtg atgcgcaagg acagaagtac acagcagaag       780
     agatagaagt gctcaggaca acatcaaaaa taaatggtgt agaatatgtt cctttcatga       840
     gtgttgatct aagggaacgc tttgcttatc caatgccttt ttgtgatagg ttgggcaagc       900
     ttccattatc acctaaacaa aaaactacat tttctaaatg ggtacgaccg gaagatctca       960
     ccaacaatcc tacaatgata tacactgtgt ccagttttag cataaagcag acaatagtat      1020
     cagattgttc ctttgtggca tcgttggcta tcagtgcagc gtatgagaga cgattcaata      1080
     agaagttaat taccagcata atttaccccc agaataagga tggagaacca gagtacaatc      1140
     cctgtggaaa gtatatggta aagcttcacc tcaatggtgt tccgagaaag gtgataattg      1200
     atgaccagtt acctgttgat cacaaaggag aattgctgtg ttcttattcc aacaataaaa      1260
     gtgaattgtg ggtgtcactt atagagaaag catacatgaa agttatggga ggatatgatt      1320
     tcccaggatc caactcaaat attgatctgc atgcactgac tgggtggata ccagaaagga      1380
     ttgccatgca ttcagatagc cagacgttca gtaaggataa ctcattcaga atgctttatc      1440
     aaagatttca caaaggagat gtcctcatca ccgcatcgac gggagtaatg actgaagctg      1500
     aaggggagaa gtggggcctg gttcccactc atgcctatgc ggttttggat attagagagt      1560
     tcaaggggct gagatttatt cagttaaaaa acccttggag ccatttacgc tggaaaggaa      1620
     ggtacagtga gaatgatgtg aaaaactgga ccccagaatt gcagaagtat ttaaactttg      1680
     atccacgaac agctcagaaa atagataatg gaatattttg gatttcctgg gatgatcttt      1740
     gccagtatta tgatgtagtt tatttgagtt ggaatccagc tctttttaaa gaatcaactt      1800
     gcattcacag tacttgggat gctaaacaag gacctgtgaa agatgcttat agcctggcca      1860
     acaaccccca gtacaaattg gaggtgcagt gtccacaagg gggtgctgca gtttgggttt      1920
     tgcttagtag acacataaca gacaaggatg acttcgcaaa taaccgtgag tttatcacaa      1980
     tggttgtgta caagactgat ggcaagaagg tttactaccc agctgaccca cctccataca      2040
     ttgatgggat tcgaattaac agccctcatt acttgactaa gataaagctg accacgcccg      2100
     ggactcacac cttcacccta gtggtttctc agtatgagaa acagaatacg attcattaca      2160
     cagtccgggt gtattcagcc tgcagcttta ctttttcgaa gatcccttca ccatacacct      2220
     tatccaaacg gataaatgga aagtggagtg gtcaaagtgc tggaggatgt ggaaattttc      2280
     aggagactca caaaaataac cccatctacc aattccatat agataagact ggaccgttat      2340
     tgattgagct gagaggacca aggcaataca gtgttggatt tgaggttgta gcagtttcca      2400
     taatgggaga tcctggtcct catggctttc agaggaaatc tagtggtgac tataggtgtg      2460
     gattttgcta cttagaactg gaaaacatac ctgctgggat ctttaatatc atccctagta      2520
     cttttttgcc taaacaagaa ggaccttttt tcttggactt taatagtact gtccccatca      2580
     agacaacaca actccaatga ttgagaactc tcagctatta ctggattcca tatttcccag      2640
     tctcagctct tcagacaagg agacaaatca cgatggtgaa ccatcagaat ggaattaaat      2700
     caaaagcatg ttacggagtc tggtgctcgt tgtggtgttt ggtaaggatt ttagatagtg      2760
     gaattacctt aatcacctga aatactgttt acatggtttg tgcacacaga gctggcgtgt      2820
     actcggtggc ggctctgtgt aaatcaca                                         2848
//