spacer

EBI Dbfetch

ID   AB028459; SV 1; linear; genomic DNA; STD; MUS; 1488 BP.
XX
AC   AB028459;
XX
DT   20-OCT-1999 (Rel. 61, Created)
DT   05-NOV-1999 (Rel. 61, Last updated, Version 2)
XX
DE   Mus musculus gene for SCM1 receptor mXCR1, complete cds.
XX
KW   SCM1 receptor mXCR1.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1488
RA   Yoshida T., Yoshie O.;
RT   ;
RL   Submitted (04-JUN-1999) to the INSDC.
RL   Tetsuya Yoshida, Shionogi Institute for Medical Science; 2-5-1, Mishima,
RL   Settsu, Osaka 566, Japan (E-mail:tetsuya.yoshida@shionogi.co.jp,
RL   Tel:06-382-2612, Fax:06-382-2598)
XX
RN   [2]
RX   DOI; 10.1016/S0014-5793(99)01114-X.
RX   PUBMED; 10518929.
RA   Yoshida T., Izawa D., Nakayama T., Nakahara K., Kakizaki M., Imai T.,
RA   Suzuki R., Miyasaka M., Yoshie O.;
RT   "Molecular cloning of mXCR1, the murine SCM-1/lymphotactin receptor";
RL   FEBS Lett. 458(1):37-40(1999).
XX
DR   MD5; a662ce96048a8c358c15da37108b8436.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1488
FT                   /organism="Mus musculus"
FT                   /strain="129SVJ"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /tissue_lib="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             204..1172
FT                   /codon_start=1
FT                   /product="SCM1 receptor mXCR1"
FT                   /note="single cysteine motif 1 receptor"
FT                   /db_xref="GOA:Q9R0M1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR005393"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1346338"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0M1"
FT                   /protein_id="BAA85419.1"
FT                   /translation="MESSTAFYDYHDKLSLLCENNVIFFSTISTIVLYSLVFLLSLVGN
FT                   SLVLWVLVKYENLESLTNIFILNLCLSDLMFSCLLPVLISAQWSWFLGDFFCKFFNMIF
FT                   GISLYSSIFFLTIMTIHRYLSVVSPISTLGIHTLRCRVLVTSCVWAASILFSIPDAVFH
FT                   KVISLNCKYSEHHGFLASVYQHNIFFLLSMGIILFCYVQILRTLFRTRSRQRHRTVRLI
FT                   FTVVVAYFLSWAPYNLTLFLKTGIIQQSCESLQQLDIAMIICRHLAFSHCCFNPVLYVF
FT                   VGIKFRRHLKHLFQQVWLCRKTSSTVPCSPGTFTYEGPSFY"
XX
SQ   Sequence 1488 BP; 364 A; 366 C; 307 G; 450 T; 1 other;
     ggaaaaaaaa atgttcctta atgactttta tgtagtagcc caattctcaa tcttgttata        60
     aatagttcac tagtggaatc tggcccacag actttacttt tttgcagcat ggataataat       120
     gatccccatt ccaactatgt ggatttaaac ccaacatgtc tatcatttca gatgctctca       180
     gtatccctgc atcccgcgtc cagatggagt cctctacagc cttttatgat tatcatgata       240
     aattgagtct tctatgtgag aacaatgtca tcttcttttc caccatctct accattgtcc       300
     tgtactctct ggtatttctc ctcagccttg tgggtaacag cctggttttg tgggtcttgg       360
     tgaagtatga gaatctagag tcactcacca atatcttcat cctcaacctg tgtctctcag       420
     acctgatgtt ctcctgtcta ctgcctgtgt tgatctcagc acaatggagt tggtttctag       480
     gtgacttctt ctgcaagttc ttcaacatga tcttcggcat cagcctctac agcagcatct       540
     tcttccttac catcatgacc atccaccgat acctgtctgt agtgagcccc atctctactc       600
     tgggtatcca taccctccgc tgccgtgtgc tggtgacatc atgtgtgtgg gcagccagca       660
     tcctgttctc catccctgat gctgtcttcc acaaagtgat ctccttaaat tgtaaatatt       720
     ctgaacatca tgggttcttg gcctcagtct accagcacaa catcttcttc ctcctctcca       780
     tgggaatcat cctattctgt tatgtacaga ttctcaggac tttgtttcgc acaaggtcca       840
     gacagagaca ccgaacagtc aggctcatct tcaccgtcgt ggtagcatac ttcctcagct       900
     gggctcccta caacctcaca ctcttcctga aaactggaat catccagcag agctgtgaga       960
     gccttcagca actggacatt gctatgatta tctgtcgcca tttggccttc tctcattgct      1020
     gtttcaaccc agtgctttat gtctttgttg ggatcaagtt ccgcagacac ctaaaacatc      1080
     tcttccagca ggtctggctg tgccggaaga catccagcac tgttccctgc tcccctggta      1140
     cctttacata tgagggaccc tccttctact gagaggagag gatgggcaca tggagatgac      1200
     tatgggaggt aaaggaagac aaggagaagt ggatcaggaa ggaaaatata actgaagata      1260
     ctacagaggt gtggaggaaa gacatgatac ctatgggaaa gtggcttcca gctgggcaag      1320
     ccaaagcaac actttgtgca ctcagttcat catttattct cttacgtaga catagattgc      1380
     ttgttagtga tggtcagaag atcctaaata gaaggatttc tagactttan gagggcttga      1440
     agcttatagt atgtgctaac tgtgcagtga tgttgctggt acataggg                   1488
//


spacer
spacer