Dbfetch

ID   AB025313; SV 1; linear; mRNA; STD; MUS; 991 BP.
XX
AC   AB025313;
XX
DT   08-SEP-1999 (Rel. 61, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus UCH-L1 mRNA, complete cds.
XX
KW   Mouse UCH-L1 protein; UCH-L1.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-991
RA   Saigoh K., Wang Y., Wada K.;
RT   ;
RL   Submitted (25-MAR-1999) to the INSDC.
RL   Keiji Wada, National Institute of Neuroscience, N.C.N.P., Department of
RL   Degenerative Neurological Diseases; 4-1-1. Ogawahigashi, Kodaira, Tokyo
RL   187-6502, Japan (E-mail:wada@ncnp.go.jp, Tel:81-42-341-2711(ex.5141),
RL   Fax:86-42-346-1745)
XX
RN   [2]
RX   DOI; 10.1038/12647.
RX   PUBMED; 10471497.
RA   Saigoh K., Wang Y.L., Suh J.G., Yamanishi T., Sakai Y., Kiyosawa H.,
RA   Harada T., Ichihara N., Wakana S., Kikuchi T., Wada K.;
RT   "Intragenic deletion in the gene encoding ubiquitin carboxy-terminal
RT   hydrolase in gad mice";
RL   Nat Genet 23(1):47-51(1999).
XX
DR   MD5; 0bda700e474ea6d008925453053cced3.
DR   Ensembl-Gn; ENSMUSG00000029223; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029590; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029558; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029506; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029567; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029290; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030021; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028698; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029259; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029405; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029365; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029490; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029393; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030054; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028422; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028778; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031131; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071926; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0072010; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0071923; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071941; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071581; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072414; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072123; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0071534; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0071674; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0071572; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0071723; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071597; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072612; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071595; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070733; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..991
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /sub_species="BALB-c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             21..692
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="UCH-L1"
FT                   /note="PGP9.5"
FT                   /db_xref="GOA:Q9R0P9"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR030297"
FT                   /db_xref="InterPro:IPR036959"
FT                   /db_xref="MGI:MGI:103149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0P9"
FT                   /protein_id="BAA84083.1"
FT                   /translation="MQLKPMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSP
FT                   ACALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQD
FT                   KLEFEDGSVLKQFLSETEKLSPEDRAKCFEKNEAIQAAHDSVAQEGQCRVDDKVNFHFI
FT                   LFNNVDGHLYELDGRMPFPVNHGASSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKA
FT                   A"
XX
SQ   Sequence 991 BP; 217 A; 279 C; 279 G; 216 T; 0 other;
     tgcaggtgcc atccgcgaag atgcagctga agccgatgga gattaacccc gagatgctga        60
     acaaagtgtt ggccaagctg ggggtcgccg gccagtggcg cttcgccgac gtgctagggc       120
     tggaggagga gactctgggc tcagtgccat cccctgcctg cgccctgctg ctcctgtttc       180
     ccctcacggc ccagcatgaa aacttcagga aaaagcaaat tgaggaactg aagggacagg       240
     aagttagccc taaagtttac ttcatgaagc agaccatcgg aaactcctgt ggtaccatcg       300
     ggttgatcca cgcagtggcc aacaaccaag acaagctgga atttgaggat ggatccgtcc       360
     tgaaacagtt tctgtctgaa acggagaagc tgtcccccga agatagagcc aagtgtttcg       420
     agaagaacga ggccatccag gcggcccatg actccgtggc ccaggagggc cagtgtcggg       480
     tagatgacaa agtgaatttc cattttattc tgttcaacaa cgtggacggc catctgtacg       540
     agctcgatgg gcgaatgccc tttccagtga accatggcgc cagctcagag gactctctgc       600
     tgcaggatgc tgccaaggtc tgcagagaat tcactgagcg cgagcagggg gaggtccgct       660
     tctctgccgt ggctctctgc aaagcagctt aagtctgggg agagagaacc agccgatccc       720
     cccttccctg ggcaggtgcg cgcggcccgc ccttggtttg cagctttagc acttagaacc       780
     acagctgtct tcttgcgttc tacagcccca tcccctccac cccacccagg ccaccagggg       840
     gctctgtcac agccacacca ggctgagcac tttccctcct gtgtgtctcg taccttgctc       900
     tctacggtct ctttggtttc tgtctgtaag ttacggccct ggatgtggtt tgtctagtcc       960
     ttaagaggaa gaataaaact ttgctggtga g                                      991
//