Dbfetch

ID   AB024565; SV 1; linear; mRNA; STD; MUS; 1937 BP.
XX
AC   AB024565;
XX
DT   11-JAN-2000 (Rel. 62, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for heparan sulfate 6-sulfotransferase 2, complete cds.
XX
KW   heparan sulfate 6-sulfotransferase 2.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1937
RA   Habuchi H.;
RT   ;
RL   Submitted (04-MAR-1999) to the INSDC.
RL   Hiroko Habuchi, Aichi Medical University, Institute for Molecular Science
RL   of Medicine; Yasago, Nagakute, Aichi 480-1195, Japan
RL   (E-mail:habuc@amugw.aichi-med-u.ac.jp, Tel:81-52-254-4811(ex.2087),
RL   Fax:81-561-63-3532)
XX
RN   [2]
RX   DOI; 10.1074/jbc.275.4.2859.
RX   PUBMED; 10644753.
RA   Habuchi H., Tanaka M., Habuchi O., Yoshida K., Suzuki H., Ban K.,
RA   Kimata K.;
RT   "The occurrence of three isoforms of heparan sulfate 6-O-sulfotransferase
RT   having different specificities for hexuronic acid adjacent to the targeted
RT   N-sulfoglucosamine";
RL   J Biol Chem 275(4):2859-2868(2000).
XX
DR   MD5; f46c8f178dcb6783c2a164b4be6cd106.
DR   Ensembl-Gn; ENSMUSG00000062184; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035712; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035695; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035615; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035681; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035385; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036211; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034676; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035359; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035514; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035462; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035601; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035501; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036228; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034375; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034820; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000088172; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114871; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096103; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0096193; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0096131; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096112; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095666; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096624; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096263; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0095587; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0095791; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0095637; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0095825; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095607; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0096965; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095681; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094651; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1937
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             2..1522
FT                   /codon_start=1
FT                   /product="heparan sulfate 6-sulfotransferase 2"
FT                   /db_xref="GOA:Q80UW0"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR010635"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1354959"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80UW0"
FT                   /protein_id="BAA89247.1"
FT                   /translation="MDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVP
FT                   DPYRSEDESSARFVPRYNFSRGDLLRKVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNI
FT                   QLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSCVPAVVDGKRD
FT                   ARLRPSRWRIFQILDGTSKDRWGSSNFNSGANSPSSTKPRSTSKSGKNFHYITILRDPV
FT                   SRYLSEWRHVQRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPLKEFMDCPYNLAN
FT                   NRQVRMLSDLTLVGCYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEFQRKTQYLFEK
FT                   TFNMNFISPFTQYNTTRASSVEINEEIQKRIEGLNFLDMELYSYAKDLFLQRYQFMRQK
FT                   EHQDARRKRQEQRKFLKGRFLQTHFQSQSQGQSQSQSPGQNLSQNPNPNPNQNLTQNLS
FT                   HNLTPSSNPNSTQRENRGSQKQGSGQGQGDSGTSNGTNDYIGSVETWR"
XX
SQ   Sequence 1937 BP; 527 A; 488 C; 489 G; 433 T; 0 other;
     catggatgag aaatctaaca agctgctgct ggctttggtg atgctcttcc tatttgcggt        60
     gatcgtcctc caatacgtgt gccccggcac agaatgccag ctcctccgcc tgcaggcgtt       120
     cagctccccg gtgccggatc cgtaccgctc ggaggatgag agttcggcca ggtttgtacc       180
     ccgctacaat ttcagccgcg gcgatctcct gcgcaaggta gacttcgaca tcaagggcga       240
     tgacctgatc gtgttcctgc acatccagaa gactgggggc accacttttg gccgtcacct       300
     ggtgcgcaac atccagctgg agcagccatg tgagtgccgc gtggggcaga agaaatgcac       360
     ttgccaccgg ccgggtaaga gggagacctg gctcttctcc aggttctcca ccggctggag       420
     ctgcgggctg catgccgact ggaccgagct caccagctgc gtgccggcgg tggtggatgg       480
     caagcgcgac gccaggctga gaccttccag gtggaggatt tttcagattc tagatggaac       540
     aagtaaggat agatggggtt cttcaaactt caactcaggc gccaactctc catcctccac       600
     aaagccccgg agcacatcga agagtgggaa gaacttccat tacattacca tcctgagaga       660
     cccagtgtca cggtacttga gtgaatggag gcatgtccag agaggagcaa cttggaaagc       720
     atccctgcac gtctgtgatg gaaggccccc aacctctgaa gagctgccca gctgctacac       780
     cggtgatgac tggtctggat gccctctcaa agagttcatg gactgtccct ataatctggc       840
     caacaaccgc caagttcgca tgctatctga cctgactcta gtgggatgct acaacctctc       900
     tgtcatgcct gaaaagcaaa gaaacaaagt ccttctggaa agtgccaaat ccaatctgaa       960
     gcacatggcg ttctttggcc tcactgagtt tcagcgcaag acccagtacc tgtttgagaa      1020
     gaccttcaac atgaacttta tctcgccgtt tacccagtat aataccacta gggcctctag      1080
     tgttgagatc aatgaggaaa tccaaaagcg tattgaggga ctgaattttc tggatatgga      1140
     gttgtacagc tatgctaaag acctctttct gcaaaggtat cagttcatga ggcagaaaga      1200
     acatcaggat gccaggcgga agcgtcagga gcaacgcaaa tttctgaagg gaaggttcct      1260
     tcagacccat ttccagagtc agagtcaggg tcagagccag agccagagtc caggtcagaa      1320
     tctgagtcag aatccaaatc ctaacccaaa tcagaacctg actcagaacc tgagtcacaa      1380
     tctgactccg agttcaaatc ccaattcgac ccagagggag aaccggggaa gtcagaagca      1440
     gggctcaggc cagggacaag gtgatagcgg caccagcaat ggcaccaatg actacatagg      1500
     gagcgtagag acatggcgct aactggcact caaaggcttg tgcacactgc ttcccaaagc      1560
     atcaccaaaa agatggcgtg tatcttacaa gatgaaaatg tccaaacaca tcctgcttcc      1620
     ttcatttggg aagttcaaaa aaaaaaagtg tagacgttgc ctttacagtt gccttttgat      1680
     tcagtgttat gctgtgtgtg ggtacaacaa atctcagtgt gtaattaaat tgtctgtttt      1740
     gggatgaact acttctgaaa tccaagagcc aaaccagact caccagaaat tgcagcttag      1800
     atattttaag acgttcttaa attaggtatg ggagacacaa agaaaacatg aaatgtggcc      1860
     gtttaaactt atggctaaga aacagacttt aagtgattcc ggatactctg ttaaaaccca      1920
     gtcttgaaag caccccg                                                     1937
//