spacer

EBI Dbfetch

ID   AB023958; SV 1; linear; mRNA; STD; MUS; 3460 BP.
XX
AC   AB023958;
XX
DT   09-MAR-2000 (Rel. 63, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus MmLATS2 mRNA for warts/lats-like kinase, complete cds.
XX
KW   MmLATS2; warts/lats-like kinase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3460
RA   Nojima H., Fujii T.;
RT   ;
RL   Submitted (22-FEB-1999) to the INSDC.
RL   Hiroshi Nojima, Research Institute for Microbial Diseases, Osaka
RL   University, Department of Molecular Genetics; Yamadaoka 3-1, Suita, Osaka,
RL   565-0871, Japan (E-mail:snj-0212@biken.osaka-u.ac.jp, Tel:81-6-6875-3980,
RL   Fax:81-6-6875-5192)
XX
RN   [2]
RX   DOI; 10.1006/geno.1999.6065.
RX   PUBMED; 10673337.
RA   Yabuta N., Fujii T., Copeland N.G., Gilbert D.J., Jenkins N.A.,
RA   Nishiguchi H., Endo Y., Toji S., Tanaka H., Nishimune Y., Nojima H.;
RT   "Structure, expression, and chromosome mapping of LATS2, a mammalian
RT   homologue of the Drosophila tumor suppressor gene lats/warts";
RL   Genomics 63(2):263-270(2000).
XX
DR   MD5; f272e8d288489a636d1592cfe87738b6.
DR   Ensembl-Gn; ENSMUSG00000021959; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022531; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3460
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             134..3262
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="MmLATS2"
FT                   /product="warts/lats-like kinase"
FT                   /note="WALK"
FT                   /db_xref="GOA:Q7TSJ6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="InterPro:IPR028742"
FT                   /db_xref="MGI:MGI:1354386"
FT                   /db_xref="PDB:2COS"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7TSJ6"
FT                   /protein_id="BAA92380.1"
FT                   /translation="MRPKTFPATTYSGNSRQRLQEIREGLKQPSKASTQGLLVGPNSDT
FT                   SLDAKVLGSKDASRQQQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQ
FT                   ELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLAP
FT                   TPVTRRPSFEGTGEALPSYHRLGGANYEGPAALEEMPRQYLDFLFPGAGAGTHGAQAHQ
FT                   HPPKGYSTAVEPSAHFPGTHYGRGHLLSEQPGYGVQRSSSFQNKTPPDAYSSMAKAQGG
FT                   PPASLTFPAHAGLYTASHHKPAATPPGAHPLHVLGTRGPTFTGESSAQAVLAPSRNSLN
FT                   ADLYELGSTVPWSAAPLARRDSLQKQGLEASRPHVAFRAGPSRTNSFNNPQPEPSLPAP
FT                   NTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVAAPTAPATESLETKEGSAGPHP
FT                   LDVDYGGSERRCPPPPYPKHLLLPSKSEQYSVDLDSLCTSVQQSLRGGTEQDRSDKSHK
FT                   GAKGDKAGRDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQ
FT                   QKVSRRLQLEQEVAKAGLCEAEQEQMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIG
FT                   AFGEVCLACKLDTHALYAMKTLRKKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQ
FT                   DKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIESVHKMGFIHRDIKPD
FT                   NILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGNHMRQDSMEPGDLWDDVSNCRCGDRL
FT                   KTLEQRAQKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFEMLVGQPPF
FT                   LAPTPTETQLKVINWESTLHIPTQVRLSAEARDLITKLCCAADCRLGRDGADDLKAHPF
FT                   FNTIDFSRDIRKQPAPYVPTISHPMDTSNFDPVDEESPWHEASGESAKAWDTLASPSSK
FT                   HPEHAFYEFTFRRFFDDNGYPFRCPKPSEPAESADPGDADLEGAAEGCQPVYV"
FT   polyA_site      3440
XX
SQ   Sequence 3460 BP; 861 A; 992 C; 963 G; 644 T; 0 other;
     ggacagcaat tttttgaaag gaagttgttc tgaaagcatg tttacaattc actgacactg        60
     ttgactgttc tctttaaaat aataagacgc tttgagaaga ttgtatttat ggtaaaagga       120
     aactggacta acaatgaggc caaagacttt tcctgccaca acttactctg gaaatagccg       180
     gcagcgattg caagagattc gagaggggct gaagcagcca tccaaggctt ccacccaggg       240
     gctgctggtg ggaccaaaca gtgacacttc cctggatgcc aaagtcctgg ggagcaaaga       300
     tgcctccagg cagcagcaaa tgagagccac cccgaagttt ggaccttatc aaaaagctct       360
     cagggaaatc cgatattccc tcctgccttt tgccaacgag tcaggcactt cggcagctgc       420
     agaggtgaac cggcagatgc ttcaggagtt ggtgaatgcg ggatgtgacc aggagatggc       480
     tggcagagcg ctcaagcaga cgggcagtag gagtatcgaa gctgccttgg agtacatcag       540
     taagatgggc tacctggacc ccaggaatga gcagattgtg cgagtcatca agcagacctc       600
     cccaggaaag ggcctggcgc ccaccccggt gactcggcgg cccagtttcg agggcacagg       660
     ggaagcactc ccatcctacc accggctggg tggtgcaaac tacgagggcc ccgccgcact       720
     ggaggagatg ccgcggcaat atttagactt tctcttccct ggagccggag ccggcaccca       780
     cggtgcccag gctcaccagc atcctcccaa agggtacagc acagcagtag agccaagtgc       840
     gcactttccg ggcacacact atggtcgtgg tcatctacta tcggagcagc ctgggtatgg       900
     ggtgcagcgc agttcctcct tccagaacaa gacgccacca gatgcctatt ccagcatggc       960
     caaggcccag ggtggccctc ccgccagcct cacctttcct gcccatgctg ggctgtacac      1020
     tgcctcgcac cacaagccgg cggctacccc acctggggcc cacccattac atgtgttggg      1080
     cacccggggt cccacgttta ctggcgaaag ctctgcacag gctgtgctgg caccgtccag      1140
     gaacagcctc aatgctgact tgtacgagct gggctccacg gtgccctggt ctgcagctcc      1200
     actggcacgc cgcgactcgc tgcagaagca gggtctagaa gcctcgcggc cgcatgtggc      1260
     ttttcgggct ggccccagca ggaccaactc cttcaacaac ccacaacctg agccctcact      1320
     gcccgccccc aacacggtca ccgccgtgac ggccgcacac atccttcacc ctgtgaagag      1380
     cgtgcgtgtg ctgcggcccg agccccagac agccgtgggg ccctcgcacc ccgcctgggt      1440
     ggctgccccc acagcacctg ccactgagag cctggagacg aaggagggca gcgcaggccc      1500
     acacccgctg gatgtggact atggcggctc cgagcgcagg tgcccaccgc ctccgtaccc      1560
     aaagcacttg ctgctgccca gtaagtctga gcagtacagc gtggacctgg acagcctgtg      1620
     caccagtgtg cagcagagtc tgcgaggggg cactgagcaa gacaggagtg acaagagcca      1680
     caaaggtgcg aagggagaca aagctggcag agacaaaaag cagattcaga cctccccggt      1740
     gcctgtccgc aagaatagca gagatgaaga gaagagagag tctcgcatca agagttactc      1800
     cccttatgcc ttcaaattct tcatggagca acacgtggag aatgtcatca aaacctacca      1860
     gcagaaggtc agccggaggc tacagctgga gcaggaagtg gccaaagctg ggctctgtga      1920
     ggccgagcag gagcagatga ggaagatcct ctaccagaag gagtctaact acaaccggct      1980
     gaagagggcc aagatggaca agtccatgtt tgtgaaaatc aagactctag gcatcggtgc      2040
     ctttggggaa gtgtgcctcg cttgtaagct ggacactcac gctctgtacg ccatgaagac      2100
     tctcaggaag aaggatgtcc tgaaccggaa tcaagtggcc catgtcaagg ctgagaggga      2160
     catcctggct gaagcagaca atgagtgggt ggtcaaactc tactactcct tccaggacaa      2220
     ggacagcctg tactttgtga tggactacat accaggcggg gatatgatga gcctgctgat      2280
     caggatggag gtcttccctg agcacctggc ccgcttctac attgcagagt tgaccctggc      2340
     cattgaaagt gtccacaaga tgggctttat ccaccgggac atcaagcctg acaacatact      2400
     catcgacctg gatggtcata ttaagctgac agattttggc ctctgcactg gattcaggtg      2460
     gactcacaat tccaagtact accagaaagg gaaccacatg agacaggaca gcatggagcc      2520
     cggtgacctc tgggacgatg tttccaactg tcgctgtgga gacaggttaa agaccctgga      2580
     gcagagggcg cagaagcaac accagaggtg cctggcacat tctcttgtcg ggacaccaaa      2640
     ttacatcgct ccggaggtgc ttctccgcaa agggtacacg cagctctgtg actggtggag      2700
     cgtcggtgtg attctctttg agatgctggt tgggcagccg cctttcttgg cccccacccc      2760
     cacagagacg cagctgaagg tgatcaactg ggagagcacg ctgcatatcc ctacgcaggt      2820
     gaggctcagc gctgaggccc gagacctcat cacgaagctg tgctgcgcgg ctgactgccg      2880
     cctgggcagg gatggggcag atgacctcaa ggcacacccg ttcttcaaca ccatcgactt      2940
     ttcccgtgac atccgaaagc agcctgcacc ctacgtcccc accatcagcc accccatgga      3000
     cacctccaat tttgacccgg tggatgaaga aagcccctgg cacgaggcca gcggagagag      3060
     cgccaaggcc tgggacacgc tggcctcccc cagcagcaag catccagagc acgccttcta      3120
     tgagttcacc ttccgcaggt tcttcgatga caacggctat cccttccggt gcccgaagcc      3180
     ctcagagccc gcagagagtg cagacccagg ggatgcggac ttggaaggtg cggccgaggg      3240
     ctgccagccg gtgtacgtgt aagcctcagt taaccacaac tcgaggaaac ccaaaatgag      3300
     atttcttttc agaagacaaa ctcaagctta ggaatccttc atttttagtt ctggtaaatg      3360
     ggcaacagga agagtcaaca tgatatcaaa ttagccctct gaggaccttc actgcattaa      3420
     aacagtattt ttaaaaaatt aaaaaaaaaa aaaaaaaaaa                            3460
//


spacer
spacer