spacer

EBI Dbfetch

ID   AB022342; SV 1; linear; mRNA; STD; MUS; 2951 BP.
XX
AC   AB022342;
XX
DT   19-JAN-1999 (Rel. 58, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for glutamate receptor channel alpha3 subunit, complete
DE   cds.
XX
KW   GluR alpha3; glutamate receptor channel alpha3 subunit.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2951
RA   Sakimura K., Yamazaki M.;
RT   ;
RL   Submitted (12-JAN-1999) to the INSDC.
RL   Kenji Sakimura, Niigata University, Department of Cellular Neurobiology
RL   Brain Reserch Institute; Asahimachidohri1-757, Niigata, Niigata 951-8585,
RL   Japan (E-mail:npsaki01@bri.niigata-u.ac.jp, Tel:81-25-227-0619,
RL   Fax:81-25-227-0816)
XX
RN   [2]
RP   1-2951
RA   Sakimura K., Yamazaki M.;
RT   "Mouse glutamate receptor channel alpha3 subunit";
RL   Unpublished.
XX
DR   MD5; 57b0f635a60c6b10776326710642dac2.
DR   Ensembl-Gn; ENSMUSG00000001986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076349; mus_musculus.
DR   EuropePMC; PMC2248168; 18215271.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2951
FT                   /organism="Mus musculus"
FT                   /strain="C57BL6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             55..2721
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="GluR alpha3"
FT                   /product="glutamate receptor channel alpha3 subunit"
FT                   /db_xref="GOA:Q9Z2W9"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95810"
FT                   /db_xref="PDB:3LSW"
FT                   /db_xref="PDB:3LSX"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2W9"
FT                   /protein_id="BAA37124.1"
FT                   /translation="MGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAF
FT                   RFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSM
FT                   NTLTSFCGALHTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGYYKWEKFVYLYDTER
FT                   GFSILQAIMEAAVQNNWQVTARSVGNIKDIQEFRRIIEEMDRRQEKRYLIDCEVERINT
FT                   ILEQVVILGKHSRGYHYMLANLGFTDIVLERVMHGGANITGFQIVNNENPMVQQFIQRW
FT                   VRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAV
FT                   PWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERF
FT                   VPFSDQQISNDSSSSENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAK
FT                   HVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSK
FT                   PFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWH
FT                   LEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT
FT                   LIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYE
FT                   KMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNL
FT                   DSKGYGVATPKGSALGTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSA
FT                   LSLSNVAGVFYILVGGLGLAMMVALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNY
FT                   ATYREGYNVYGTESVKI"
XX
SQ   Sequence 2951 BP; 854 A; 636 C; 712 G; 749 T; 0 other;
     cgcccatgct cttgtcagct tcgttttagg cgtagcacag ccaggcagaa gaaaatgggg        60
     caaagcgtgc tccgggcggt cttcttttta gtcctggggc ttttgggtca ttctcacgga       120
     ggattcccca acaccatcag cataggtgga cttttcatga gaaacacggt acaggagcac       180
     agtgctttcc gctttgctgt gcagttatac aacaccaacc agaacaccac tgagaagccc       240
     ttccatttga actaccacgt agaccacttg gattcctcca atagtttttc tgtgactaat       300
     gctttctgct cccagttctc cagaggggtg tatgctatct ttggattcta tgaccagatg       360
     tcaatgaaca cactgacctc cttctgtggg gccctgcata catctttcgt cacacctagc       420
     tttcccactg atgccgatgt gcagtttgtc atccagatgc gcccagcctt aaagggtgcc       480
     attctgagtc ttctgggtta ctacaagtgg gagaagtttg tgtacctcta tgacacagaa       540
     cgagggtttt ccatcctgca agcaattatg gaagcagcag tgcaaaacaa ctggcaagtg       600
     acagcaaggt ctgtgggaaa cataaaggac atccaggaat tcagacgcat cattgaagaa       660
     atggacagaa ggcaggaaaa acgatacttg attgactgtg aagtcgaaag gattaacaca       720
     attttggaac aggttgtgat cctggggaaa cattcaagag gttatcacta catgcttgct       780
     aacctgggtt ttactgacat tgtactggaa agagtcatgc atgggggagc caacattaca       840
     ggtttccaga ttgtcaacaa tgaaaaccca atggtccagc aattcataca gcgctgggtg       900
     agactggatg aaagggaatt ccctgaagcc aagaatgcac cactaaagta tacatctgca       960
     ctgacacacg acgcaatact ggtcatagca gaagccttcc gatacctgag gaggcagcga      1020
     gtggatgtat cccgcagagg cagtgctgga gactgcttag caaatcctgc tgtgccctgg      1080
     agtcaaggaa ttgatattga gagagctctg aaaatggtgc aagtacaagg aatgactgga      1140
     aacatccaat ttgacactta tggacgtagg acaaattata ccattgatgt atatgaaatg      1200
     aaagtctcag gctctcgaaa agctggttac tggaatgagt atgaaaggtt tgtgcccttc      1260
     tcagatcaac aaatcagcaa tgacagctca tcctccgaga acaggaccat cgtagtgact      1320
     accattctgg aatcaccata tgtaatgtat aaaaagaatc atgagcaact ggaaggaaat      1380
     gagcgctatg aaggctattg tgtcgattta gcctatgaaa tagccaaaca cgtaaggatc      1440
     aaatacaaat tgtccattgt cggtgatggg aaatatggcg caagggatcc agagactaaa      1500
     atatggaatg gcatggttgg ggaacttgtc tatggaagag ctgatatagc tgttgctcca      1560
     ctcactataa cattggtccg tgaagaagtc atagattttt caaagccatt tatgagcctg      1620
     gggatctcca tcatgataaa gaagcctcag aaatcaaagc caggcgtatt ttcattcctg      1680
     gatcctttag cttatgaaat ctggatgtgc attgtcttcg cttacattgg agtcagtgta      1740
     gttctcttcc tagtcagcag atttagccct tatgagtggc acttggaaga caacaatgaa      1800
     gaacctcgtg acccacaaag ccctcctgat cctcccaatg aatttggaat atttaacagt      1860
     ctttggtttt ccttgggtgc ttttatgcag caaggatgtg atatttctcc aagatcactt      1920
     tctgggcgca ttgttggagg ggtttggtgg ttcttcaccc tgatcataat ctcttcctac      1980
     actgcaaacc ttgctgcttt cctgactgtg gagaggatgg tgtcccccat agagagcgct      2040
     gaagatttag ccaagcagac tgaaattgca tacgggaccc tggactctgg ttcaacaaaa      2100
     gaatttttca gaagatccaa aattgctgtg tatgagaaaa tgtggtctta catgaaatcc      2160
     gcagagccat ctgtgtttac caaaacaaca gctgatgggg tagcccgagt tcggaagtcc      2220
     aagggaaagt tcgccttcct gctggagtca accatgaatg agtacattga gcagagaaag      2280
     ccgtgtgata cgatgaaagt tggtggaaat ctggattcca aaggctatgg tgtggcaacc      2340
     cctaaaggct cagcattagg aacgcctgta aaccttgcag tattgaaact cagtgaacaa      2400
     ggcatcttag acaagctgaa aaacaaatgg tggtacgata agggggaatg tggagccaag      2460
     gactccggga gtaaggacaa gaccagtgct ctaagcctga gcaatgtggc aggcgtgttc      2520
     tatatacttg tcggaggtct ggggctggcc atgatggtgg ctttgataga attctgttac      2580
     aaatcacggg cagagtccaa acgcatgaaa ctcacaaaga acacccaaaa ctttaagcct      2640
     gctcctgcca ccaacactca gaattacgct acatacagag aaggctacaa cgtgtatgga      2700
     acagaaagtg ttaagatcta gggatccctt cccaccggaa gcatgcaatg agaggaaatc      2760
     actgaaaacg tggctgcttc aaggatcctg agccagattt cactctcctt ggtgtcgggc      2820
     atgacacgaa tattgctgat ggtgcaatga cctttcaata ggaaaaactg attttttttt      2880
     ccttcagtgc cttatggaac actctgagac ttgcgacaat gcaaaccatc attgaaatct      2940
     ttctcgtgcc g                                                           2951
//


spacer
spacer