spacer

EBI Dbfetch

ID   AB021228; SV 1; linear; mRNA; STD; MUS; 2055 BP.
XX
AC   AB021228;
XX
DT   04-JUN-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for membrane-type-3 matrix metalloproteinase, complete
DE   cds.
XX
KW   membrane-type-3 matrix metalloproteinase; MT3-MMP.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2055
RA   Seiki M.;
RT   ;
RL   Submitted (15-DEC-1998) to the INSDC.
RL   Motoharu Seiki, Institute of Medical Science, University of Tokyo,
RL   Department of Cancer Cell Research; 4-6-1 Shirokanedai, Minato-ku, Tokyo
RL   108-8639, Japan (E-mail:mseiki@ims.u-tokyo.ac.jp, Tel:81-3-5449-5255,
RL   Fax:81-3-5449-5414)
XX
RN   [2]
RA   Kinoh H.;
RT   "Identification of a new membrane-type matrix metalloproteinase, MT5-MMP,
RT   that is expressed predominantly in cerebellum";
RL   Unpublished.
XX
DR   MD5; d6d101be81b716be8661738d57aea66d.
DR   Ensembl-Gn; ENSMUSG00000028226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029881; mus_musculus.
DR   EuropePMC; PMC2755707; 19542530.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2055
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             55..1878
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="mt3-mmp"
FT                   /product="membrane-type-3 matrix metalloproteinase"
FT                   /note="MT3-MMP"
FT                   /db_xref="GOA:Q9WTR0"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR016293"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR021805"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028697"
FT                   /db_xref="MGI:MGI:1276107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTR0"
FT                   /protein_id="BAA78420.1"
FT                   /translation="MILLAFSSGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEV
FT                   WLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVP
FT                   DQTRGSSKFNIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVT
FT                   PLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHF
FT                   DSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPND
FT                   DLQGIQKIYGPPDKIPPPTRPLPTVPPHRSVPPADPRRHDRPKPPRPPTGRPSYPGAKP
FT                   NICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENS
FT                   DGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDR
FT                   YWRYSEEMKTMDPGYPKPITIWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKV
FT                   EPGYPRSILKDFMGCDGPTDRDKEGLSPPDDVDIVIKLDNTASTVKAIAIVIPCILALC
FT                   LLVLVYTVFQFKRKGTPRHILYCKRSMQEWV"
XX
SQ   Sequence 2055 BP; 579 A; 478 C; 479 G; 519 T; 0 other;
     gaaagaggga gaaaacgcag gggagctcgt ccatccgttg aagcacagtt cactatgatc        60
     ttactcgcat tcagctctgg aagaaggttg gatttcgtgc atcattcggg tgtgtttttc       120
     ttgcaaacct tgctttggat tttatgtgct acagtctgcg gaacggagca gtatttcaat       180
     gtggaggttt ggttacaaaa atacggctac cttccaccga ctgaccccag aatgtcagtg       240
     ctgcgctctg cagagaccat gcagtcagct ctagctgcca tgcagcagtt ctatggcatt       300
     aacatgacag gaaaagtgga cagaaacaca atcgactgga tgaagaagcc tcgatgcggt       360
     gtaccagacc agacaagagg cagctctaaa ttcaacattc gtcgaaagcg ctacgcatta       420
     actggacaga aatggcaaca caaacatatc acttacagta taaagaacgt aactccaaaa       480
     gttggagatc ctgagacccg gagagcaatt cgccgtgcct ttgatgtgtg gcagaatgta       540
     actcctctaa cgtttgaaga agttccctac agtgaattag aaaacggcaa acgtgatgtg       600
     gatataacca tcatttttgc ttctggtttt catggagaca gttccccatt tgatggggag       660
     ggaggatttt tggcacatgc ttatttccct ggacccggaa ttggaggcga cacccatttt       720
     gattctgatg agccatggac actgggaaat cccaatcatg atggaaacga tttatttctt       780
     gtagcagtcc atgagctggg acatgctcta ggactggaac attccaacga ccccaccgct       840
     atcatggccc cattttatca gtacatggaa acagacaact tcaagcttcc taatgatgat       900
     ttacagggca tccagaagat atatggtcca cctgacaaga tccctccacc tacaagacct       960
     ctaccgacag tgcccccgca ccgatctgtt cctccagcag acccaaggag acatgacagg      1020
     cccaaacctc ctcggcctcc cactggcaga ccctcctatc caggagccaa acccaacatc      1080
     tgtgatggga acttcaacac tctagctatt cttcgaaggg agatgtttgt tttcaaggac      1140
     cagtggtttt ggcgagtgag aaacaacagg gtgatggatg gatacccaat gcaaattact      1200
     tacttctggc ggggccttcc tcccagtatt gatgcagttt atgaaaacag tgacggaaat      1260
     ttcgtgttct ttaaaggcaa caaatactgg gtgttcaaag acacaactct tcaacctggt      1320
     taccctcatg acttgataac ccttgggaat ggaatccccc ctcatggtat tgattctgcc      1380
     atatggtggg aagatgttgg caaaacctat ttcttcaaag gtgacaggta ttggagatat      1440
     agtgaagaaa tgaaaaccat ggaccctggt taccccaagc ccatcaccat ctggaagggg      1500
     atccctgaat cacctcaggg agctttcgtc cacaaagaaa atggctttac ctatttctac      1560
     aaaggaaagg agtattggaa attcaacaat cagatactca aagtagaacc tggttatcca      1620
     agatccatcc tcaaggactt tatgggctgt gatggaccaa cagaccgaga taaagaagga      1680
     ctcagcccac cagatgatgt agacattgtc atcaaactgg acaacacagc cagcactgtg      1740
     aaagccatag ctattgtcat tccctgcatc ttggccttat gcctccttgt attggtttac      1800
     actgtgttcc agttcaagag gaaaggaaca ccccgccaca tactgtactg taaacgctct      1860
     atgcaagagt gggtgtgatg tagggatttc ttttttcttt cttttctggg agtttgtggt      1920
     aacttgagat tcaagacaag agctgttatg ctgtttccta gctaggagca ggcttgtggc      1980
     agcctgatgg aggctgacct ttcaaaccag agggttgctg gtcctgcaca tgagtggaaa      2040
     tacactcatg gggaa                                                       2055
//


spacer
spacer