Dbfetch

ID   AB021224; SV 2; linear; mRNA; STD; MUS; 3490 BP.
XX
AC   AB021224;
XX
DT   04-AUG-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for membrane-type-4 matrix metalloproteinase, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3490
RA   Seiki M.;
RT   ;
RL   Submitted (15-DEC-1998) to the INSDC.
RL   Motoharu Seiki, Institute of Medical Science, University of Tokyo,
RL   Department of Cancer Cell Research; 4-6-1 Shirokanedai, Minato-ku, Tokyo
RL   108-8639, Japan (E-mail:mseiki@ims.u-tokyo.ac.jp, Tel:81-3-5449-5255,
RL   Fax:81-3-5449-5414)
XX
RN   [2]
RX   DOI; 10.1016/S0014-5793(99)01065-0.
RX   PUBMED; 10471807.
RA   Kajita M., Kinoh H., Ito N., Takamura A., Itoh Y., Okada A., Sato H.,
RA   Seiki M.;
RT   "Human membrane type-4 matrix metalloproteinase (MT4-MMP) is encoded by a
RT   novel major transcript: isolation of complementary DNA clones for human and
RT   mouse mt4-mmp transcripts";
RL   FEBS Lett. 457(3):353-356(1999).
XX
DR   MD5; f15f36cc60bd4c70cf4d32beda306ab2.
DR   Ensembl-Gn; ENSMUSG00000029436; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030126; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030093; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030027; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030103; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029820; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030556; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029229; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029790; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029940; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029896; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030029; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029927; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030597; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028943; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029303; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031390; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0074610; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0074689; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0074590; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0074627; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0074261; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0075097; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0074811; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0074212; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0074350; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0074255; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0074411; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0074258; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0075330; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0074261; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0073386; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3490
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             86..1822
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="mt4-mmp"
FT                   /product="membrane-type-4 matrix metalloproteinase"
FT                   /note="MT4-MMP"
FT                   /db_xref="GOA:Q9R0S3"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028726"
FT                   /db_xref="InterPro:IPR033739"
FT                   /db_xref="MGI:MGI:1346076"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0S3"
FT                   /protein_id="BAA82708.2"
FT                   /translation="MGRRPRGPGSPRGPGPPRPGPGLPPLLLVLALAAHGGCAAPAPRA
FT                   EDLSLGVEWLSRFGYLPPADPASGQLQTQEELSKAITAMQQFGGLETTGILDEATLALM
FT                   KTPRCSLPDLPPGAQSRRKRQTPPPTKWSKRNLSWRVRTFPRDSPLGRDTVRALMYYAL
FT                   KVWSDITPLNFHEVAGNAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGDHHTAGDTH
FT                   FDDDEPWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAPSSIMQPYYQGPVGDPVRYGL
FT                   PYEDRVRVWQLYGVRESVSPTAQLDTPEPEEPPLLPEPPNNRSSTPPQKDVPHRCTAHF
FT                   DAVAQIRGEAFFFKGKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDH
FT                   KIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAVFSWAHNDRTYFFKDQLYWRY
FT                   DDHTRRMDPGYPAQGPLWRGVPSMLDDAMRWSDGASYFFRGQEYWKVLDGELEAAPGYP
FT                   QSTARDWLVCGEPLADAEDVGPGPQGRSGAQDGLAVCSCTSDAHRLALPSLLLLTPLLW
FT                   GL"
FT   polyA_site      3490
FT                   /note="27 a nucleotides"
XX
SQ   Sequence 3490 BP; 708 A; 1051 C; 1027 G; 704 T; 0 other;
     ggcacgaggg cgcggagccg agcgaggcgc ggagctggct gctggcgggt gcggggaccc        60
     tcgccacccg acctgggaga gcgggatggg acgccgcccg cggggacctg ggtccccccg       120
     gggacctggc cctccacgcc ccgggccggg gctgccacca ctgctgcttg tactggcgct       180
     ggcggcccat gggggctgcg cagcgcccgc gccccgcgcg gaggacctca gcctcggggt       240
     ggagtggcta agcaggtttg gctacctgcc gcctgcagat ccggcatcag ggcagctaca       300
     gacccaggag gaactgtcca aagcgattac tgccatgcag cagtttggtg gtctggagac       360
     cactggcatc ctagatgagg ccactctggc cctgatgaaa acccctcgat gctcccttcc       420
     ggacctgccc cctggggccc aatcgagaag gaagcggcag actccacccc caaccaaatg       480
     gagcaagagg aacctttctt ggagggtccg gacattccca cgggactcac ccctgggccg       540
     ggatactgtg cgtgcactca tgtactacgc cctcaaagtc tggagtgaca tcacaccctt       600
     gaacttccac gaggtagcgg gcaacgcggc ggacatccag atcgacttct ccaaggccga       660
     ccacaatgac ggctacccct tcgatggccc tggtggcacg gtggcccacg cattcttccc       720
     tggtgaccac cacacggcag gggacaccca ctttgatgac gatgagccat ggaccttccg       780
     ttcctcagat gcccacggga tggacctgtt tgcagtggcc gtccatgagt ttggtcatgc       840
     cattggtctg agccatgttg ccgccccaag ctccatcatg caaccgtact accagggccc       900
     cgtgggtgac cccgtacgct atggacttcc ctatgaggac agggtgcgtg tctggcagtt       960
     gtacggtgtg cgggaatccg tgtcccctac tgcccagctg gataccccag agcccgagga      1020
     gccacccctc ctgccagagc cccccaacaa tcggtctagc actccgcccc agaaggacgt      1080
     gcctcacagg tgcactgccc actttgatgc tgtggcccag attcgaggcg aagcattctt      1140
     tttcaaaggc aagtatttct ggaggctgac ccgggaccga cacttggtgt cgctgcagcc      1200
     ggctcaaatg catcgcttct ggcggggcct gccgctgcac ctggacagtg tggacgccgt      1260
     gtatgagcgt accagtgacc acaagattgt cttcttcaaa ggagacagat actgggtgtt      1320
     taaggacaac aacgtagagg aagggtaccc gcgacctgtc tccgacttca gcctcccgcc      1380
     aggtggcatc gatgctgtct tctcctgggc ccacaatgac aggacttatt tctttaagga      1440
     ccagctgtac tggcgctatg atgaccacac acggcgcatg gaccctggct accctgccca      1500
     gggacccctg tggagaggtg tccccagcat gttggatgat gccatgcgct ggtctgatgg      1560
     tgcatcctat ttcttccgag gccaggagta ctggaaagtg ctggatggcg agctggaagc      1620
     agcccccggg tacccacagt ctacagcccg cgactggctg gtatgcggtg agccgctggc      1680
     ggatgcggag gatgtagggc ctggacccca gggccgcagt ggggcccaag atggtctggc      1740
     agtatgttcc tgcacttcag acgcacacag gttggcactg ccatctctgc tgcttctgac      1800
     tccactgctg tggggcctgt gaacctcagt ctctgccaag gcatcctgag ggcagtgcta      1860
     gccttgcgga tcaaggagcc aggggagcag ggacacactg gccagtactc agcaggactt      1920
     gtgctccaag cttccggtcc ctcgctcctt ccttccttcc ttccttgaac ccaggggtgc      1980
     tgtgccatct gctggagtgg tctccagctg ggacaggacg tcccaccaag ggcatccatg      2040
     cacaccttgc ctacctggag cagccatagg cagctcccct tccctcctct gcacatcacg      2100
     ctgcttcgtt gcaccttgcc gggctgccca agcccagctg tcacaacccc aggatgcctt      2160
     gtctgcacct gagcggctct gatggcatct gcacgtgggc tgatgagggg caaacagggg      2220
     ttcctcgtgg tatccgtagg ggccaccatg cctgtttcac aagtaagaga gttgatgccc      2280
     cgatggggga acagggtggg agaaaggcac ctacccagaa gtctgatcca ctgccgtttg      2340
     cagcagccag cgccgtatct gctgggatag gggaccagtc acactcagga tctgcccaca      2400
     gattcccaga tgctggcaag gggccttgct ccaactacca ggagcacagc cacctctccc      2460
     cgtcctagat aggttagcca tggaggctgt gtcctgttat ctccctctct ttggccagga      2520
     gagcattgtg ggtctccctc gggtgctgtt gatgggggtg gggggcgccc atagagatat      2580
     ttcttcatct gtcagtaccc attgcttcag caagatgccc ccatatagtt ctggcctgag      2640
     accctgcagc ttggactcac agctgtcccc tccccagctg cagaagggct tctaacacct      2700
     ggaataaagg tgggcgttca gtttagggaa ggaggatggt tgggggagcc cagggtgata      2760
     gcaaggggga gctgcaggga taagtgtcag ggtcctcggg gagtcatgac aatgttaccg      2820
     cctaacttgg agatgtagga gctgtgcacg gattgcttct ctgggtgaca aacctccatg      2880
     gtccagaaag gggctgaggt tgaacccaag atgggttaat gagctccaga aaggaacagc      2940
     caagttcaaa ggttctggga caagacgggc ctgaggaaca gggccaccca ggtaggcgtg      3000
     gctgtagggt aagcagtttc tgtcattggg cacgagatga aaattagtga tcacacgcac      3060
     atacccccct ccccaactgg cccggtccca tctcaggtaa gaaaggcttc tgtctacccc      3120
     aggccaggtt tgagtgttgt caggatgagt gagcagctag cggggcctaa gtttctaccc      3180
     tccatttccc aagcctggcc acaccctaga cccctgtcag actaggcagg acagagtcag      3240
     gggtaggggc atctgaggtt tccctgtctt ggaagccacc ctactctgcc ctcatatcaa      3300
     agcacgctcc tatgatgtcc catgttgtcc accagcctgc aggacacaga tgtcctatac      3360
     agcaacaggg aaagtccaaa aatctttgtc acatagcact gaaaaccaga cccgcaggct      3420
     ggagctgtct agatgctggt gtcacactca ttttaaaacc caaactctta ataaaaattt      3480
     tgtacactgg                                                             3490
//