spacer

EBI Dbfetch

ID   AB019577; SV 1; linear; mRNA; STD; MUS; 5275 BP.
XX
AC   AB019577;
XX
DT   10-MAY-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for UNC-51-like kinase (ULK) 2, complete cds.
XX
KW   ULK2; UNC-51-like kinase (ULK) 2.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5275
RA   Muramatsu M.;
RT   ;
RL   Submitted (09-NOV-1998) to the INSDC.
RL   Masa-aki Muramatsu, Helix Research Institute, Third Department; Yana
RL   1532-3, Kisarazu, Chiba 292-0812, Japan (E-mail:mmasaaki@hri.co.jp,
RL   Tel:81-438-52-3951, Fax:81-438-52-3952)
XX
RN   [2]
RX   DOI; 10.1038/sj.onc.1202988.
RX   PUBMED; 10557072.
RA   Yan J., Kuroyanagi H., Tomemori T., Okazaki N., Asato K., Matsuda Y.,
RA   Suzuki Y., Ohshima Y., Mitani S., Masuho Y., Shirasawa T., Muramatsu M.;
RT   "Mouse ULK2, a novel member of the UNC-51-like protein kinases: unique
RT   features of functional domains";
RL   Oncogene 18(43):5850-5859(1999).
XX
DR   MD5; 0072a32103caca6aaf0fda685bad7979.
DR   Ensembl-Gn; ENSMUSG00000004798; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004920; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5275
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /db_xref="taxon:10090"
FT   CDS             42..3155
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="ULK2"
FT                   /product="UNC-51-like kinase (ULK) 2"
FT                   /db_xref="GOA:Q9QY01"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016237"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR022708"
FT                   /db_xref="MGI:MGI:1352758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QY01"
FT                   /protein_id="BAA77341.1"
FT                   /translation="MEVVGDFEYCKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKN
FT                   LSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVMEYCNGGDLADYLQAKGTLS
FT                   EDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSNVSGIRIKIADFGFAR
FT                   YLHSNTMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDL
FT                   RMFYEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQVPVKKSCP
FT                   VPVPVYSGPVPGSSCSSSPSCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSAS
FT                   NSSKNSSCDTDDFVLVPHNISSDHSYDMPMGTTARRASNEFFMCGGQCQPTVSPHSETA
FT                   PIPVPTQVRNYQRIEQNLISTASSGTNPHGSPRSAVVRRSNTSPMGFLRVGSCSPVPGD
FT                   TVQTGGRRLSTGSSRPYSPSPLVGTIPEQFSQCCCGHPQGHEARSRHSSGSPVPQTQAP
FT                   QSLLLGARLQSAPTLTDIYQNKQKLRKQHSDPVCPSHAGAGYSYSPQPSRPGSLGTSPT
FT                   KHTGSSPRNSDWFFKTPLPTIIGSPTKTTAPFKIPKTQASSNLLALVTRHGPAESQSKD
FT                   GNDPRECSHCLSVQGSERHRSEQQQSKAVFGRSVSTGKLSEQQVKAPLGGHQGSTDSLN
FT                   TERPMDVAPAGACGVMLALPAGTAASARAVLFTVGSPPHSATAPTCTHMVLRTRTTSVG
FT                   SSSSGGSLCSASGRVCVGSPPGPGLGSSPPGAEGAPSLRYVPYGASPPSLEGLITFEAP
FT                   ELPEETLMEREHTDTLRHLNMMLMFTECVLDLTAVRGGNPELCTSAVSLYQIQESVVVD
FT                   QISQLSKDWGRVEQLVLYMKAAQLLAASLHLAKAQVKSGKLSPSMAVKQVVKNLNERYK
FT                   FCITMCKKLTEKLNRFFSDKQRFIDEINSVTAEKLIYNCAVEMVQSAALDEMFQQTEDI
FT                   VYRYHKAAVLLEGLSKILQDPTDVENVHKYKCSIERRLSALCCSTATV"
XX
SQ   Sequence 5275 BP; 1463 A; 1176 C; 1167 G; 1469 T; 0 other;
     cgcctgccca ccctagcgtt ctatgtcccg ggggcgcggc catggaggtg gtgggcgact        60
     tcgagtactg caagcgggac ctcgtgggac acggggcctt cgctgtggtc ttccgggggc       120
     ggcaccgcca gaaaactgat tgggaggtgg ctattaaaag tattaataaa aagaacttgt       180
     caaaatcaca aattctgctt ggaaaggaaa taaaaatctt aaaggagctt cagcatgaaa       240
     acatcgtagc gctctatgat gttcaggaat tgcccaactc tgtctttctg gtgatggagt       300
     attgcaatgg tggagacctg gcagattatt tgcaagctaa aggaactctg agtgaagata       360
     ctatcagagt gtttctccat cagattgcgg cagccatgcg aatcctgcac agcaaaggga       420
     taatccacag ggatctcaaa ccacagaata tcctgttgtc ttatgccaat cgaaggaagt       480
     cgaatgtcag tggtattcgt attaaaatag ctgattttgg tttcgcacgg tacctacata       540
     gtaacacaat ggcagcgaca ctgtgtggat ccccaatgta catggctccc gaggttatta       600
     tgtctcaaca ttatgatgct aaggcagatt tatggagcat aggaacagtg atctatcaat       660
     gcctagttgg aaaaccacct tttcaggcta atagtcctca ggacctaagg atgttttatg       720
     aaaaaaacag gagcttaatg cctagtattc ccagagaaac atcaccttac ttggctaatc       780
     tccttttggg tttgcttcag agaaatcaaa aggatagaat ggactttgaa gcatttttca       840
     gccatccttt ccttgagcaa gttccagtta aaaaatcttg cccagtccca gtgcctgtgt       900
     attctggccc tgtccctgga agctcctgca gcagctcacc atcttgtcgc tttgcttctc       960
     caccatccct tccagatatg cagcatattc aggaagaaaa cttatcctcc ccaccgttgg      1020
     gtcctcccaa ctatctacag gtgtccaaag actctgcgag taatagtagc aagaactctt      1080
     cttgtgacac ggatgacttt gttttggttc cacacaacat ctcgtcagac cactcatatg      1140
     acatgccaat ggggactacg gccagacgcg cttcaaatga attctttatg tgtggagggc      1200
     agtgtcaacc tactgtgtca cctcacagcg aaacagcccc aattccagtt cctactcaag      1260
     taaggaatta tcagcgcata gaacagaatc ttatatccac tgccagctct ggcacaaacc      1320
     cacatggttc tccaagatct gcagtagtac gaaggtctaa taccagcccc atgggcttcc      1380
     tccgggttgg gtcctgctcc cctgtaccag gagacacagt gcagacagga ggacgaagac      1440
     tctctactgg ctcttccagg ccttactcac catccccctt ggttggtacc attcctgaac      1500
     agtttagtca gtgctgctgt ggacatcctc agggccatga agccaggagt aggcactcct      1560
     caggttctcc agtgccacag acccaggcac cacagtcact cttactgggt gctagactgc      1620
     agagtgcacc caccctcacc gatatctatc agaacaagca gaagctcaga aagcagcact      1680
     ctgaccctgt gtgtccgtcc catgctggag ctgggtatag ttactcacct cagcctagtc      1740
     ggcctggcag ccttgggacc tctcccacca agcacacggg gtcctctcca cggaattctg      1800
     actggttctt taaaactcct ttaccaacaa tcattggctc tcctactaag actacagctc      1860
     ctttcaaaat ccctaaaaca caagcatctt ctaacctgtt agccttggtt actcgtcatg      1920
     ggcctgctga aagccagtcc aaagatggga atgaccctcg tgagtgttcc cactgcctct      1980
     cagtacaagg aagcgagagg catcgatctg agcagcagca gagcaaggca gtgtttggca      2040
     gatctgtcag tactgggaag ttatcagaac aacaagtaaa ggcaccttta ggtggacacc      2100
     agggcagcac ggatagttta aacacagaac gaccaatgga tgtagctcct gcaggagcct      2160
     gtggtgttat gctggcattg ccagcaggaa cagcagcaag cgccagagct gtcctcttca      2220
     ccgtggggtc tcctccacac agtgccacag cccccacttg tactcatatg gtccttcgaa      2280
     caagaaccac ctcagtgggg tccagcagct caggaggttc cttgtgttct gcaagtggcc      2340
     gagtatgtgt gggctcccct cctggaccag ggttgggctc ttccccacca ggagcagagg      2400
     gagctcccag cctaagatac gtgccttatg gtgcttcacc acccagccta gagggtctca      2460
     tcacctttga agcccctgaa ctaccagagg agacactgat ggagcgagag cacacagaca      2520
     ccttacgcca tctgaacatg atgttaatgt ttactgagtg tgtgctggac ctgacggcag      2580
     tgaggggtgg gaaccctgag ctgtgcacat ctgctgtgtc cttgtaccag attcaggaga      2640
     gtgtagttgt ggaccagatc agccagctaa gcaaagattg ggggcgggtg gagcagctgg      2700
     tgttgtacat gaaggcagca cagctgctgg cggcttccct gcatctcgcc aaagctcagg      2760
     tcaagtctgg gaagctgagc ccatccatgg ctgtgaaaca agttgttaaa aatctgaatg      2820
     aaagatacaa attctgcatc accatgtgca agaaacttac agaaaagctg aatcgcttct      2880
     tctccgataa acagagattt attgatgaaa tcaacagtgt gactgcagag aaactcatct      2940
     ataattgtgc tgtggaaatg gttcaatctg cagccctgga tgagatgttt cagcagactg      3000
     aagacatcgt ttatcgctac cacaaggcag ccgttctttt ggaaggctta agtaagatcc      3060
     tgcaggaccc tacagatgtt gaaaatgtgc ataagtataa atgtagtatt gaaagaagat      3120
     tgtcagcact ctgctgtagc actgcaactg tgtgagtagc aggcttgtcc gtggactggc      3180
     atggaacagg aggtgataca tttgggatta cgtcttggtt ctgtcaccca tcccaggaca      3240
     gtgtggtgac taccaaagaa caagcagcag cttaagaagg aagaacaata caaaaccact      3300
     acatattgta gaaaacctgc cttattggag aagtcactcc ccctttcctt tctcttcata      3360
     aaagcagaac aaaaagtttt ccacatggct caagttattt gaacctggca aataataaat      3420
     gtaccttaga actagcatca taagtacagt tattcttgtg gataattaaa caggaaacaa      3480
     agtgagtggc ttcattcagc tctctgagca atacatgaaa ttccgtgttt tgctaaagca      3540
     tacacaagca aaagcgtata cagctcgtcc agacgatctg aggtttgggg taagtttgtc      3600
     tgaatctgag cctgcatctt taaacagctc aggaggagga atcttaagaa gaaacaaaag      3660
     gtgactcttg gatgaattgt gaaatcttca acttgatcta atgtggacat gattttaatc      3720
     ttccaaaaat ctttcatatt gcactaattt attaaaataa ctgtgtattg gattttgcaa      3780
     tttaaaacta actgaggcac aatggacttg tttaaatatt ttacttgatt atatacatgt      3840
     ccttttcaga attcatgtgt aatctccact gaacttttaa atggttggaa attgcgttca      3900
     tgtgaacctt tgcatttttc tcacctgtta tcttcaccaa cagatcttag tggaattttg      3960
     agttgctggt tgtttgcatt ttttgttgtg cgtgcagaat gtgcatcgac tcctgtgatc      4020
     ataggtttac taaaggctaa gtttatttgg gcagtattag aaagccatca tgaatcaaga      4080
     aatactcttg agaattttaa tagggccaaa tcaaagtgat gaataatggc ttgttagtga      4140
     tgtggagttt ctacatgaaa ttagtaagaa atgaggttcg ttttccctta ggaaatgggc      4200
     agctctctcc agactaatgt gtacttctca gtgttaaccc tgagttcacc atagctagtc      4260
     atggcagatc agcacctctc caagaatggt tcctgtgttg tatattattt ggtatctttt      4320
     acttacctgc ttgaatactt gaataaacca ttcaccggtt ttaatccttt tacttcaaaa      4380
     cttacacata ctgacctact ctctgatagc tgcacagaaa ctctttggcg ccacacttgc      4440
     tttagtgtgc tgattaaagt taacagagaa aacatggttt tcatttactt ggtgaacaaa      4500
     gtaatgtaat ttttacatta tttatctgta tgaaattcca gcagttaatt tgaacgttta      4560
     tgtataggat gtttgtatcc ttaggtcttt actacagtgt ttctacccct catttgtaac      4620
     tgcattatct tcaaaatagg taaaacccac taagtcattg tggaatagcc ttttttaaat      4680
     tgcttataca aatgtatatt aaggttaaat aaaactgaca gtgtttttag gttatagttg      4740
     ggttaatatg aaggcttgtc aagccagatg cttccttaga gagtgggttg gaaacttggc      4800
     catcaatatt ctttgccctg ctccaggatt caaaactctt gtaagctgtc atgcaggctc      4860
     ctacagacaa gactatatcc ctccttatat tagtggtaaa atgccttctg taatttttac      4920
     actaaattct ttcatgttct cccaattacc ccgtttatct cagttgattt tccaagtaac      4980
     tagatgtagt tggcctcctc ttctaccact ttttaaaaat ataatatgaa caagcttgga      5040
     gagggtaagg ttggtgtgaa gacaggaagt aggcaagtgt tgaaactgca ctggactctc      5100
     aagctcttct tgtatgacaa aggtcttgta ggtggtgtgt ataaagcagt gatgtctcag      5160
     cagtggagaa cagctgtaaa cttagtgagt aacggttctg atatactacc attatcaagg      5220
     ctagttgttt aaagaaaagt ttgccttgat tatagcaata ataaataaat gcttt           5275
//


spacer
spacer