spacer

EBI Dbfetch

ID   AB019280; SV 1; linear; mRNA; STD; MUS; 1131 BP.
XX
AC   AB019280;
XX
DT   18-MAY-1999 (Rel. 59, Created)
DT   18-MAY-1999 (Rel. 59, Last updated, Version 1)
XX
DE   Mus musculus mRNA for sprouty-4, complete cds.
XX
KW   sprouty-4.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1131
RA   Itoh N.;
RT   ;
RL   Submitted (28-OCT-1998) to the INSDC.
RL   Nobuyuki Itoh, Kyoto University Graduate School of Pharmaceutical Sciences,
RL   Department of Genetic Biochemistry; Yoshida-Shimoadachi, Sakyo, Kyoto
RL   606-8501, Japan (E-mail:itohnobu@pharm.kyoto-u.ac.jp, Tel:81-75-753-4540)
XX
RN   [2]
RX   DOI; 10.1016/S0925-4773(98)00241-X.
RX   PUBMED; 10330503.
RA   de Maximy A.A., Nakatake Y., Moncada S., Itoh N., Thiery J.P., Dellusci S.;
RT   "Cloning and expression pattern of a mouse homologue of drosophila sprouty
RT   in the mouse embryo";
RL   Mech. Dev. 81(1-2):213-216(1999).
XX
DR   MD5; 0774b0c050d7bc71aa8bd2a83ce06bad.
DR   Ensembl-Gn; ENSMUSG00000024427; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025295; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1131
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /db_xref="taxon:10090"
FT   CDS             216..1118
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="sprouty-4"
FT                   /db_xref="GOA:Q9WTP2"
FT                   /db_xref="InterPro:IPR007875"
FT                   /db_xref="MGI:MGI:1345144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTP2"
FT                   /protein_id="BAA77689.1"
FT                   /translation="MEPPVPQSSVPVNPSSVMVQPLLDSRAPHSRLQHPLTILPIDQMK
FT                   TSHVENDYIDNPSLAPATGPKRPRGGPPELAPTPARCDQDITHHWISFSGRPSSVSSSS
FT                   STSSDQRLLDHMAPPPVAEQASPRAVRLQPKVVHCKPLDLKGPTAPPELDKHFLLCEAC
FT                   GKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCAD
FT                   HPCSCSGSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNS
FT                   VICKAASGDTKTSRSDKPF"
XX
SQ   Sequence 1131 BP; 221 A; 381 C; 312 G; 217 T; 0 other;
     ggcatgtcag cgaacagagc tgacagcgcg gatctggcgc tgcagggccc agggaagctt        60
     tgccggctcc tccgactgac gtctgcgact tcaacggcga ctgacccact cgggttcggg       120
     gatttacaca gacgtggagc gatgcttgtg actctgcagc tcctcaaaga cccctagaag       180
     cctgtccctt ggtgcagttc aggacctcca gcctcatgga gcccccggtt ccacagagca       240
     gcgtccctgt gaatcccagc tcagtcatgg tgcagcccct ccttgacagc agagcgcccc       300
     acagccggct ccagcaccca ctcaccatct tacccattga ccagatgaag accagccacg       360
     tggagaatga ctacatagac aaccctagcc tggcccctgc cacgggtccc aagcggcccc       420
     ggggcgggcc accagagctg gctcctacac ctgcccgctg tgaccaggat attactcacc       480
     actggatctc cttcagcggt cggcccagct ctgtaagcag cagtagcagc acttcctccg       540
     accagaggct cctagatcac atggctccac cgcccgtggc tgagcaggcc tcacccaggg       600
     ctgtgcgcct ccagcccaag gtggttcact gtaagccgct ggacctcaaa ggcccgacag       660
     ctccgccaga gctagacaag cacttcttgc tgtgtgaggc ctgtggaaag tgtaagtgca       720
     aagagtgtgc gtcccctcgg acgttacctt cctgctgggt ctgcaaccag gagtgcctgt       780
     gctcggctca gacgctggtc aactatggca catgcatgtg tctggtgcaa ggtatcttct       840
     atcactgtac taatgaggat gatgagggct cttgcgccga ccacccctgc tcctgttccg       900
     gctccaactg ctgcgcccgc tggtccttca tgggcgccct ctctgtggtg ctgccctgtc       960
     tgctgtgcta cctgccggcc acaggctgcg tcaagctggc ccagcgaggc tacgaccgcc      1020
     tgagacgccc cggttgccgc tgcaagcaca cgaacagcgt catctgcaag gcagcaagtg      1080
     gggacaccaa gaccagcagg tctgacaagc ctttctgaca ctttggatga a               1131
//


spacer
spacer