Dbfetch

ID   AB018562; SV 1; linear; genomic DNA; STD; MUS; 1081 BP.
XX
AC   AB018562;
XX
DT   19-OCT-1998 (Rel. 57, Created)
DT   27-DEC-2005 (Rel. 86, Last updated, Version 3)
XX
DE   Mus musculus gene for interleukin-2-inducible T cell kinase, 5'-flanking
DE   region and partial cds.
XX
KW   interleukin-2-inducible T cell kinase; Itk.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1081
RA   Tate G., Mitsuya T.;
RT   ;
RL   Submitted (11-OCT-1998) to the INSDC.
RL   Genshu Tate, Showa University Fujigaoka Hospital, Department of Surgical
RL   Pathology; Fujigaoka 1-30, Aoba-ku, Yokohama, Kanagawa 227-8501, Japan
RL   (E-mail:six10352@super.win.or.jp, Tel:81-45-974-6632, Fax:81-45-972-6242)
XX
RN   [2]
RA   Tate G., Mitsuya T.;
RT   "Mouse Itk(interleukin-2-inducible T cell kinase) gene, first exon";
RL   Unpublished.
XX
DR   MD5; a1ed24e5fda876bf3e11b782f2156d61.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1081
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             944..>1081
FT                   /codon_start=1
FT                   /gene="Itk"
FT                   /product="interleukin-2-inducible T cell kinase"
FT                   /db_xref="GOA:Q76N02"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:Q76N02"
FT                   /protein_id="BAA33864.1"
FT                   /translation="MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRH
FT                   G"
XX
SQ   Sequence 1081 BP; 295 A; 251 C; 270 G; 265 T; 0 other;
     gaattcaaac cgataggtag aataaacagc cctgtgcaga tctctgcatg ccctaatccc        60
     tataacctgt gactgtgtgt tgttgggtga taaaggggaa tttacattcc aaatggagtt       120
     atagcgccca tctgctgacc ttaaaatagg gagcctgccc tagacgacca ctgtgagaag       180
     ggcccagtgt ggttctcagg atccttaaat ggagcagagg taggaggaag agattttggc       240
     aatacagagc aagcagggct cgacctgcag tttgggggtt tgaagatgga gaaaaagagt       300
     caagacagag gccaccagag tgtccctcag tagggaggat ggtcgcagag gcagtgtccc       360
     ctagagatct gcaagaaagg cgcacagtcc cacagtcacc atgactgtca ctcaaccaga       420
     cacatttcag acttctaaac tagagaattg taaggcgctt tgagccttgt ggctctatgg       480
     cgctttgagc cactaagcct gtggcaggca gtccatgata atagcaatgg gaaacttaca       540
     tacaagctga gctccattga cccctggatc cctgttctta gccccttgtt tacatgactt       600
     aactgttgtc aaggctaaac caggagctag aagaattata agtgaactcc tcttataatt       660
     ctaggtttct tcaaacctct ttttcaaacc atatagctaa gggtacgcat gtgcctccca       720
     gcttggtgaa ttttgaaagg atgtggtcat ggcctttgac atcagaggag ggagctcagc       780
     ggtgaggctg gctgatgctg atagaaaaga taaggttaga ggcaagttgc ctttgaacga       840
     ctctctaaag atcaactgca tcctgtctca gtctccgctg ctcctctcct tcagtcgcac       900
     tgcggggtga tgccaaaggc gcatcacttt tcagaactgg accatgaaca acttcatcct       960
     cctggaagaa cagctgatca agaagtccca acagaagaga aggacttctc cctcgaattt      1020
     taaagttcgt ttctttgtct taacgaaagc cagcctggcc tactttgagg accgccacgg      1080
     g                                                                      1081
//