spacer

EBI Dbfetch

ID   AB017027; SV 1; linear; mRNA; STD; MUS; 3917 BP.
XX
AC   AB017027;
XX
DT   09-SEP-1998 (Rel. 56, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mRNA for neurotensin receptor type 1, complete cds.
XX
KW   neurotensin receptor type 1.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3917
RA   Snider J., Sano H., Ohta M.;
RT   ;
RL   Submitted (20-AUG-1998) to the INSDC.
RL   Hideki Sano, Banyu Pharmaceutical CO.,LTD, Department of Human Genetics,
RL   Tsukuba Research Institute; Okubo 3, Tsukuba, Ibaraki 300-2611, Japan
RL   (E-mail:sanohd@banyu.co.jp, Tel:+81-298-77-2000, Fax:+81-298-77-2027)
XX
RN   [2]
RP   1-3917
RA   Snider J., Sano H., Ohta M.;
RT   "Neurotensin receptor type 1";
RL   Unpublished.
XX
DR   MD5; 7459206ec366f692435008b95b0954b3.
DR   Ensembl-Gn; ENSMUSG00000027568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029084; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3917
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="whole brain"
FT                   /db_xref="taxon:10090"
FT   CDS             444..1718
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="neurotensin receptor type 1"
FT                   /db_xref="GOA:O88319"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003984"
FT                   /db_xref="InterPro:IPR003985"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97386"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88319"
FT                   /protein_id="BAA33013.1"
FT                   /translation="MHLNSSVQQGAPSEPGAQPFPHPQFGLETMLLALSLSNGSGNSSE
FT                   SILEPNSNLDVNTDIYSKVLVTAVYLALFVVGTVGNSVTAFTLARKKSLQSLQSTVHYH
FT                   LGSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLS
FT                   VERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGLQNRSADGQHPGGL
FT                   VCTPTVDTATVKVVIQVNTFMSFLFPMLIISILNTVIANKLTVMVHQAAEQGRGVCTVG
FT                   THNSLEHSTFNMSIEPGRVQALRHGVLVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWT
FT                   TFLFDFYHYFYMLTNALFYVSSAINPILYNLVSANFRQVFLSTLACLCPGWRRRRKKRP
FT                   TFSRKPNSMSSNHAFSTSATRETLY"
XX
SQ   Sequence 3917 BP; 895 A; 1180 C; 1009 G; 833 T; 0 other;
     gaagcagaag agggagaacg agggtgagca cgctgggcag ccgtgcgtgc gctcctctct        60
     gcgccacagg ctcgcccaac gaagcacaag ccagcagggt cgcggtcctg aggacatcgc       120
     tgccacccag gagtgcagag aaccaaccac agaatctgga ggtcggtagc agccccgatc       180
     taggcaggct cggagccagg gggggtgccg aggaagaacc ggaaagcaga tcccagactc       240
     tgaaggagaa agaagagtgg atccctgagc cggcacgtct cgagccccag agctcccagg       300
     atctcctgga tagctggctt cgccgccgga cggcacgccc cccttagctt ccacaccctc       360
     tcctctgagc gcctcctcat ctgcccctgg agggactttc accttcaaag gtgcaggaca       420
     aagccgcata tctggcgccc accatgcacc tcaacagctc cgtgcagcag ggagccccaa       480
     gtgaacccgg tgcccagccc ttcccacatc cacagttcgg actggagacg atgctcctgg       540
     cgctcagctt gagcaatggt tctggcaatt cctcagaatc catcctggag cccaacagca       600
     acctggacgt gaacactgac atttattcca aggtgctggt gaccgctgta tacctggcac       660
     tttttgtggt gggcactgtg ggcaactcgg tgacagcctt cactctagcg cggaagaagt       720
     cgctgcagag cctgcagagc actgtgcatt accacctggg tagcctggca ctgtctgacc       780
     tgctcatcct gctgctggcc atgcccgtgg agctgtacaa cttcatctgg gtgcaccatc       840
     cctgggcctt tggggatgct ggctgccgtg gctactattt cctgcgagat gcctgcacct       900
     atgccacagc cctcaatgta gccagcctga gtgtggagcg ctacttggcc atctgccatc       960
     ccttcaaggc caagaccctc atgtcccgca gccgcaccaa gaaattcatc agtgccatat      1020
     ggctagcctc ggcgctgctg gctgtaccca tgcttttcac catgggcctg cagaaccgca      1080
     gtgccgatgg ccagcaccct ggtggcctgg tgtgcacacc cacggtggac acagccaccg      1140
     tcaaggtcgt catccaggtt aacaccttca tgtccttcct gtttcccatg ctgatcatct      1200
     ccatcctaaa cactgtgata gccaacaaac tgaccgtcat ggtgcaccag gctgccgagc      1260
     agggccgtgg tgtgtgcacc gtgggcaccc acaacagttt agagcacagc acgttcaaca      1320
     tgtccatcga gccaggccgt gtccaggccc tgcgccatgg agtcctcgtc ttacgtgctg      1380
     tggtaatcgc ctttgtggtc tgctggctgc cctaccacgt gcggcgcctc atgttctgct      1440
     atatctcaga tgaacagtgg actacgttcc tcttcgactt ctaccactat ttctatatgc      1500
     tgaccaacgc tctcttctac gtcagctcag ccatcaatcc catcctttac aacctcgtct      1560
     ccgccaactt ccgccaggtc ttcctgtcca cactggcttg cctctgtcct gggtggcgcc      1620
     gccgccgaaa gaagaggcca acgttctcca ggaagccaaa cagcatgtcc agcaaccatg      1680
     cgttttccac cagcgccacc cgggaaaccc tgtactaggc catgaggagg tagcctgtgc      1740
     acagggcagc aactccccca accccccacc cccaccccaa agcctcccaa ggttaagtag      1800
     tggcccatct aagccatgcc ggtgaggctg gggcaccctc agcggaggct tctttcttcc      1860
     cagtttctct ttcttccctt cctctggttc tcccctccct agtcctttat tcttgcccct      1920
     tatccctctc ctacctccac ctttaaaaac agaaaagagg cggtttctct cctggcccta      1980
     caaaaggcct ttaacaagaa gaaattagca ctcaccaagg acggtctcct ttgttcccag      2040
     actaatggat gttttagaag caagaaatga aagcaccaca ttgggcctgg acagatgagc      2100
     tgttgtaacc ataacagcac cttggaactg cactggcagg gcgagacagt gtctgatgtt      2160
     ggacttgggt tcagagacac aggctccatc tcagcccctt tatgcctcta ctcctgccct      2220
     ggtccagcag ataccatagc actctctgag ccttatgtcc agaccctttc ttggcaggct      2280
     ggtacactgc ccttcccaga gtggtccaga gaagccccaa aattactgtg taaggtccag      2340
     ggcccacagc tggaagctgt gggaatccat gccacacctg gatggctatg gcccactaaa      2400
     gagaccccaa ttcccacatg cccaggaagg ataaaagggc tggcctggaa tcaacacagg      2460
     acaagcttca agtggctttg cacggggacc ttcacctctt ggatctgcag aaggatggaa      2520
     gataagtggg gtccagcctc cccagtccag gtggctttgc tggggacatg catggttctg      2580
     cgtctcatat acagatgtat agactaaggt ctgacagcag ctggcttcag gctgggactt      2640
     ctgagaaggg gcactgagcc aggtcctcag caagatgcca gtgtctgaga ctccacaggt      2700
     aaggggaggc caagcacccc agcatctagc tggccagcag ccctggactg aggcatatgt      2760
     caatttgtta accagccgcc aagcagccac cctggcccag gttctaggcg cctggaaaag      2820
     caggcaccct tcatctctgg gagctgtctc caaacaagac aggcccattc agcctccagc      2880
     caacaagctg gctgggcact tggagacagt cccaggatgc catgcaccaa caaggtagaa      2940
     gtagcaggag agtcaagtgt agccttttgc aaaagagcct tagctctgtt gtctgggaga      3000
     gagatggctg gacatgcagc tgctctgtaa ggatgaaatt gccacgggac atgggaggct      3060
     cagtcacagc ccaggctagc ctctgctccc tctgaactat aaaacaatgg gtgaaaagtc      3120
     agggtatctg tggtcaccca gagaaatggg gagggtgttc aagtacttga accccacaaa      3180
     acactgctac tagtaatgtg attcctcagg ccatcaaggg caggacctgg gtgagtccgg      3240
     atcaaggctg acaccaggaa gatgtgatca cccaagaggg aagcccctcc tcctaagaaa      3300
     tgtctgcatg ggagcccctc acagccacct tgcccagtga gtgggtcaaa ggctagcggt      3360
     tggtcatgag gattttgact tagactcaag ccaggcagcc cagccccagg actctaccct      3420
     gggtttctag accttaagcc attcttctga gccttgattt cctcatctcg gcggaccggg      3480
     actgtcttga aggactcagc ctggagtaca cagaagtggg acacctgagg ctgggtagag      3540
     ccaatgccct cttacatgat tcctcagaaa tgtggtggcc tcattatagg ggtggtccag      3600
     gcagtcacca gaagtctctg ctgtagtcta tagcatcttg tctgtgtgct tggtgtaatt      3660
     agggacatac atccatgcac caccagacac acctgtgacc ctggctgggt atcctatgct      3720
     ctgggccaag tgaagatgaa aatagttctg gaggctgtcc tgagcatcct ggctagagtc      3780
     tcatgagccc agtcgtgatg tggaaacaag tcgtgtgccc caaatatctg tcagaatgcc      3840
     acccaccctc cacacttcaa taaaagaaca ccctcctcat atgtctcaat aaagaataaa      3900
     ggaagctgtg tatatcg                                                     3917
//


spacer
spacer