spacer

EBI Dbfetch

ID   AB016602; SV 1; linear; mRNA; STD; MUS; 1997 BP.
XX
AC   AB016602;
XX
DT   05-AUG-1998 (Rel. 56, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for G-protein coupled receptor, complete cds.
XX
KW   G-protein coupled receptor.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1997
RA   Matsuo N., Kawamoto S., Matsubara K., Okubo K.;
RT   ;
RL   Submitted (29-JUL-1998) to the INSDC.
RL   Naoki Matsuo, Institute for Moecular and Cellular Biology, Osaka
RL   University, Cellular Interactions and Morphogenesis; Yamada-oka 1-3, Suita,
RL   Osaka 565-0871, Japan (E-mail:matsuo@imcb.osaka-u.ac.jp,
RL   Tel:+81-6-879-7970, Fax:+81-6-877-1955)
XX
RN   [2]
RP   1-1997
RA   Matsuo N., Kawamoto S., Matsubara K., Okubo K.;
RT   "Cloning of a cDNA encoding a novel G-protein coupled receptor uniquely
RT   expressed in the adult brain";
RL   Unpublished.
XX
DR   MD5; cb6c4df4483b7849575673696f0f00eb.
DR   Ensembl-Gn; ENSMUSG00000026424; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027682; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1997
FT                   /organism="Mus musculus"
FT                   /strain="C57BL6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="GS6696"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             320..1366
FT                   /codon_start=1
FT                   /product="G-protein coupled receptor"
FT                   /db_xref="GOA:Q99JG2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003909"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1928503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99JG2"
FT                   /protein_id="BAA32062.1"
FT                   /translation="MLLALVVFAVGIVGNLSVMCIVWHSYYLKSAWNSILASLALWDFL
FT                   VLFFCLPIVIFNEITKQRLLGDVSCRAVPFMEVSSLGVTTFSLCALGIDRFHVATSTLP
FT                   KVRPIERCQSILAKLAVIWVGSMMLAVPELLLWQLAQEPAPTAGTVDSCIMKPSADLPE
FT                   SVYSLVMTYQNARMWWYFGCYFCLPILFTVTCQLVTWRVRGPPGRKPECRAGRHEQCES
FT                   QLNSTVVGLTVVYAFCTLPENVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPV
FT                   LLLCICRPLGQAFLDCCCCCCCEECGGASDSSATVSADSKLKAEVSSSIYFHKPRESPP
FT                   LLPLGTPC"
XX
SQ   Sequence 1997 BP; 385 A; 592 C; 525 G; 495 T; 0 other;
     ctcatcttta ggtgggcata gagccaaggt ccaggagcag cagagtcgac cccgaagagg        60
     caccaaggac gaggggccca aggaggtaca gcactatgta cccgaggagt gggctgaata       120
     tcccaagccc atccatcctg ctggcctgca gcccaccaag actttggagg ccactagccc       180
     caacccagac aaggatgggg ccaccccagg taatggacaa gagctgaggg tcaacctgac       240
     cgggacgcca agtcagaggc tgcagattca gaatcccctg tatccggtga ccgagagctc       300
     ctacagcgcc tacgccatca tgctcctggc tctggtggtg tttgctgtgg gtatcgttgg       360
     caatctgtct gtcatgtgca ttgtgtggca cagctactac ttgaagagtg cctggaactc       420
     tatccttgcc agcctggctc tctgggattt cctggtcctc ttcttctgcc tcccaattgt       480
     catcttcaat gagattacca agcaaaggct actcggggat gtttcttgcc gggcagtgcc       540
     cttcatggag gtctcctccc tgggagtcac aaccttcagt ctctgtgccc tgggcataga       600
     ccgattccat gtggccacca gcaccctgcc aaaggtgagg cccattgagc gatgtcaatc       660
     aattctggct aaactagctg tcatctgggt gggctccatg atgctggccg tgcccgaact       720
     cctgctatgg cagctggccc aggagccggc tcccaccgca ggaactgtgg actcgtgtat       780
     catgaaacct tcagccgacc tgcccgaatc cgtctattcg ctggtgatga cctaccagaa       840
     tgcccgcatg tggtggtatt ttggttgcta cttctgtctg cccatcctct tcaccgtcac       900
     ctgtcagctg gtgacgtggc gggtgcgggg cccaccaggc aggaagcctg agtgtagagc       960
     gggcaggcat gagcagtgtg agagccagct caacagcacc gtggtcggcc tgactgtggt      1020
     ctatgccttc tgtacactcc ctgagaacgt ctgcaatatc gtggtggctt acctctctac      1080
     cgagctcacg cggcagaccc tggacctcct gggcctcatc aaccagttct ccaccttctt      1140
     taagggcgcc atcacccctg tgctcctcct gtgcatctgc aggccactgg gccaggcctt      1200
     tctggattgc tgctgctgct gctgctgcga ggagtgcggc ggggcctcag actcctcagc      1260
     cacagtcagc gcggacagca agctgaaggc ggaagtgtcc tcttctatct acttccacaa      1320
     gcccagggag tcgcccccac tcctgcccct gggcacccct tgctgagtct atgggggatc      1380
     tggagcaggt gcagagccgg cgggggaggg gtgccatccc ggtccatgat ggtctgctga      1440
     ttctttgaca cggtctcact ttgacccctc tctcatcttg ctgtttagag atggacttgg      1500
     ctcatcttgt caaagtctgg gcttttcaaa gctccatcta caaacaatgc tgttcttatc      1560
     ctccgagggg cctgccagat ctccacctcc ttgtagatgg agatctgtct aggtcattag      1620
     agttgcccag aatctcaatc tggccaccct agagccaggg cttggccttt tgcctattct      1680
     ccctttggtc ttaggatctg actattggct gagcctgtcc atcatgatgg attgtgtgct      1740
     ggtgagctcc aacatcattt ctactcctac ctagcctcct atactggact agggacttct      1800
     agggggctaa cctaaccaag ccctggactc cactttctaa agtgggtctg tcttagccct      1860
     gcatgtgttt tcccttttcc ccagagcatt ctctcactct gtcttccgtt ctcagaggtt      1920
     atcagttgca ttgttcccgt taggtgcttt tctgtagaag gccattctgg aaaaaacaat      1980
     aaagtaggta ccacaaa                                                     1997
//


spacer
spacer