spacer

EBI Dbfetch

ID   AB015790; SV 1; linear; mRNA; STD; MUS; 6648 BP.
XX
AC   AB015790;
XX
DT   30-JUN-1998 (Rel. 56, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for LR11, complete cds.
XX
KW   LR11.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-6648
RA   Kanaki T.;
RT   ;
RL   Submitted (20-JUN-1998) to the INSDC.
RL   Tatsuro Kanaki, Chiba University School of Medicine, Second Department of
RL   Intermal Medicine; 1-8-1 Inohara, Chuo-ku, Chiba 260, Japan
RL   (Tel:+81-43-222-7171(ex.5257), Fax:+81-43-226-2095)
XX
RN   [2]
RX   PUBMED; 9726247.
RA   Kanaki T., Bujo H., Hirayama S., Tanaka K., Yamazaki H., Seimiya K.,
RA   Morisaki N., Schneider W.J., Saito Y.;
RT   "Developmental regulation of LR11 expression in murine brain";
RL   DNA Cell Biol. 17(8):647-657(1998).
XX
DR   MD5; f4ac38c91bacaddf9fe1957772d37083.
DR   Ensembl-Gn; ENSMUSG00000049313; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060989; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6648
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="mouse brain lambda-gt10 cDNA library"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             1..6648
FT                   /codon_start=1
FT                   /product="LR11"
FT                   /db_xref="GOA:O88307"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR023415"
FT                   /db_xref="MGI:MGI:1202296"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88307"
FT                   /protein_id="BAA31219.1"
FT                   /translation="MATRSSRRESRLPFLFALVALLPRGALGGGWTQRLHGGPAPLPQD
FT                   RGFFVVQGDPRDLRLGTHGDAPGASPAARKPLRTRRSAALQPQPIQVYGQVSLNDSHNQ
FT                   MVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFSKISEKLNFGVGNNSEAV
FT                   ISQFYHSPADNKRYIFVDAYAQYLWITFDFCSTIHGFSIPFRAADLLLHSKASNLLLGF
FT                   DRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDQPNAIYIERHEPFGFSTVLRST
FT                   DFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLPGSQQQSSVQLWVSFGRKPMRAAQF
FT                   VTKHPINEYYIADAAEDQVFVCVSHSNNSTNLYISEAEGLKFSLSLENVLYYSPGGAGS
FT                   DTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAF
FT                   TGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASK
FT                   TNVYISSSAGARWREALPGPHYYTWGDHGGIIMAIAQGMETNELKYSTNEGETWKTFVF
FT                   SEKPVFVYGLLTEPGEKSTVFTIFGSNKESVHSWLILQVNATDALGVPCTENDYKLWSP
FT                   SDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDL
FT                   SLEVCVPDPEFSGKPYSPPVPCPVGSSYRRTRGYRKISGDTCSGGDVEARLEGELVPCP
FT                   LAEENEFILYAMRKSIYRYDLASGATEQLPLWGLRAAVALDFDYERNCLYWSDLALDTI
FT                   QRLCLNGSTGQEVIINSGLETVEALAFEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVN
FT                   SSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSYMDGSAAYRLVSEDVKWPNGISVDS
FT                   QWIYWTDAYLDCIERITFSGQQGSVILDSLPHPYAIAVFKNEIYWDDWSQLSIFRASKH
FT                   SRSQVEILASQLTGLMDMKVFYKGKNAGSNACVPQPCSLLCLPKANNSKSCRCPEGVAS
FT                   SVLPSGDLMCDCPQGYQRKNNTCVKEENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMS
FT                   DERNCPTTVCDADTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEFNCS
FT                   SGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCHNGHCIPQRWACDGDADCQ
FT                   DGSDEDPVSCEKKCNGFHCPNGTCIPSSKHCDGLRDCPDGSDDEHCEPFCTRFMDFVCK
FT                   NRQQCLFHSMVCDGIVQCRDGSDEDAAFAGCSQDPEFHKECDEFGFQCQNGVCISLIWK
FT                   CDGMDDCGDYSDEANCENPTEAPNCSRYFQFHCENGHCIPNRWKCDRENDCGDWSDEKD
FT                   CGDSHVLPSPTPGPSTCLPNYFACSSGACVMGTWVCDGYRDCADGSDEEACPSLANSTA
FT                   ASTPTQLGQCDRFEFECHQPKKCIPNWKRCDGHQDCQDGQDEANCPTHSTLTCTSREFK
FT                   CEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPK
FT                   KMPSASCVYNVYYRVVGESIWKTLETHSNKTSTVLKVLKPDTTYQVKVQVHCLNKVHNT
FT                   NDFVTLRTPEGLPDAPRNLQLSLNREEEGVILGHWAPPVHTHGLIREYIVEYSRSGSKM
FT                   WASQRAASNSTEIKNLLLNALYTVRVAAVTSRGIGNWSDSKSITTIKGKVIQAPNIHID
FT                   SYDENSLSFTLTMDGDIKVNGYVVNLFWSFDAHKQEKKTLSFRGGSALSHKVSNLTAHT
FT                   SYEISAWAKTDLGDSPLAFEHILTRGSSPPAPSLKAKAINQTAVECIWTGPKNVVYGIF
FT                   YATSFLDLYRNPKSVTTSLHNKTVIVSKDEQYLFLVRVLIPYQGPSSDYVVVKMIPDSR
FT                   LPPRHLHAVHIGKTSALIKWESPYDSPDQDLFYAIAVKDLIRKTDRSYKVRSRNSTVEY
FT                   SLSKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKE
FT                   KQFNETRGYEIHMSDSAVNLTAYLGNTTDNFFKVSNLKMGHNYTFTVQARCLFGSQICG
FT                   EPAVLLYDELSSGADAAVIHAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSS
FT                   FSAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA"
XX
SQ   Sequence 6648 BP; 1589 A; 1778 C; 1808 G; 1473 T; 0 other;
     atggcgacac ggagcagcag gagggagtcg agactccctt tcctattcgc cctggtcgcg        60
     ctgctacccc gcggggctct cggcgggggc tggacgcaga gattgcacgg tggcccggcg       120
     cccttgcccc aggaccgggg cttcttcgtg gtgcagggcg acccgcgcga tctccggcta       180
     ggaacgcacg gggatgcccc gggggcgagc ccggcggcca ggaagccact caggacccgg       240
     cggagcgctg ctctgcagcc ccagcctatc caggtgtatg gacaggtcag tctgaatgac       300
     tcccacaatc agatggtggt gcactgggcc ggagagaaaa gcaacgtgat cgtggcatta       360
     gcccgagaca gcctggcgtt ggcaaggccc aagagcagtg atgtgtatgt gtcttacgac       420
     tatggaaaat cattcagtaa gatttcagag aagctgaact ttggcgtggg caacaacagc       480
     gaagctgtga tctcccagtt ctaccacagc cctgccgaca acaagaggta catctttgtg       540
     gatgcttacg cccaatacct ctggatcacg tttgacttct gcagcactat ccatggcttc       600
     tccatcccat tccgggcggc tgatctcctc ctccatagca aggcctccaa cctcctcttg       660
     ggctttgaca ggtctcaccc caacaagcag ctatggaagt cagatgattt tggccagacc       720
     tggatcatga ttcaggaaca cgtgaagtcc ttctcttggg gaatcgaccc ctatgatcag       780
     ccaaacgcta tctacattga gcgacatgaa ccctttgggt tctccacagt gctccgcagt       840
     acagacttct tccagtcccg ggaaaaccag gaagtgatcc tggaggaagt gagagacttt       900
     cagcttcggg acaagtacat gtttgctaca aaggtggtgc atcttccggg cagccagcag       960
     cagtcatctg tccagctctg ggtctccttt ggccggaagc ctatgagagc agcccagttt      1020
     gtcacaaagc atcctattaa tgaatattac atcgctgatg ccgccgagga ccaggtgttt      1080
     gtgtgtgtta gccacagtaa caacagcact aacctataca tctcagaggc ggaggggctg      1140
     aagttctccc tctccttgga gaatgtgctg tattacagcc caggaggggc cggcagtgac      1200
     actctggtga ggtattttgc aaatgagccg tttgccgact ttcaccgcgt ggaaggctta      1260
     caaggggtct atattgccac cctgattaat ggttctatga atgaggagaa catgaggtcg      1320
     gtcatcacct ttgacaaagg gggaacctgg gaatttcttc aggccccagc cttcacagga      1380
     tatggagaga aaatcaattg tgagctttct cagggttgtt ccctccacct ggcccagcgc      1440
     ctcagtcaac tgctcaacct ccaacttcgg aggatgccta tcctatccaa ggagtcagcc      1500
     cccggtctca tcattgctac cggctctgtg ggaaagaact tggccagcaa gaccaatgtg      1560
     tacatctcta gcagtgctgg agccaggtgg agagaggctc ttcccggacc tcattactat      1620
     acttggggtg accatggagg catcatcatg gcgattgccc agggcatgga gaccaacgag      1680
     ctgaagtaca gcaccaatga aggggagacc tggaagacgt tcgtcttctc ggagaagcct      1740
     gtgtttgtgt atgggcttct cacagaacct ggtgagaaga gcaccgtctt caccatcttc      1800
     ggctcgaaca aggagagtgt ccacagctgg ctcatcctgc aagtcaatgc cactgatgcc      1860
     ttgggggttc cttgcacaga aaacgactac aagctgtggt ccccatctga tgagcgagga      1920
     aatgagtgtt tgctaggaca caagacagtt ttcaaaagga ggacccctca cgccacatgc      1980
     tttaatgggg aagactttga ccggccagtg gttgtgtcca actgctcctg cacccgggag      2040
     gactacgaat gtgactttgg cttcaagatg agcgaagatc tctccttaga ggtttgtgtt      2100
     ccagaccctg agttttctgg gaagccctac agccctcctg tgccttgtcc tgtgggttct      2160
     tcatacagga gaacgagagg ctatcggaag atttctgggg atacgtgcag tggaggagac      2220
     gttgaagcac ggctggaagg ggagctggtc ccctgtcccc ttgcagaaga gaatgagttc      2280
     atcctatacg ccatgcgcaa gtccatctac cgctacgact tggcctcggg agccacagag      2340
     cagcttcctc tctggggctt gcgggcggct gtggccctgg actttgacta tgaacgcaac      2400
     tgcttgtatt ggtctgacct ggcactggac accatccagc gtctctgctt gaacgggagc      2460
     acagggcagg aggtgatcat caattccggc ctggagaccg tggaggcttt ggccttcgaa      2520
     cccctcagcc aattacttta ctgggtggat gccggcttta aaaagatcga ggtagctaat      2580
     ccagatggtg acttccgact gacaatcgtc aattcatctg tgcttgatcg acccagggct      2640
     ctagtccttg taccccaaga aggggtgatg ttctggactg actgggggga cctgaagcct      2700
     gggatttacc ggagctacat ggacggctct gctgcctacc gccttgtgtc agaggacgtg      2760
     aagtggccca atggcatctc tgtggacagc cagtggatct actggacgga tgcttacctg      2820
     gactgtatcg agcgcatcac tttcagtggc cagcagggtt cagtcatcct tgacagcctc      2880
     ccacacccct acgccatcgc tgtctttaag aatgagatct actgggacga ctggtcacag      2940
     ctcagcatct tcagagcttc gaagcacagc agatcccagg tggagattct agcaagccag      3000
     ctcacgggcc tcatggacat gaaggttttc tacaagggaa agaatgctgg aagcaatgct      3060
     tgcgtccctc agccctgcag tctactgtgc ctccctaagg ccaacaacag caaaagctgc      3120
     aggtgtccag aaggtgtggc cagcagtgtc ctcccctctg gggacctgat gtgtgactgc      3180
     cctcagggct atcaaaggaa gaacaacacc tgtgtcaaag aagagaacac ctgtctccgc      3240
     aaccagtacc gctgcagcaa cggcaactgt atcaacagca tttggtggtg tgatttcgac      3300
     aatgactgtg gagacatgag tgacgagaga aattgcccca cgacggtctg tgatgcagac      3360
     actcagttcc ggtgccagga gtcggggact tgcattccac tctcctataa gtgtgacctt      3420
     gaagatgact gtggagataa cagtgatgag agtcactgtg agatgcacca gtgtcgtagc      3480
     gacgagttca actgcagctc tgggatgtgc atccggtcct cctgggtgtg tgatggagac      3540
     aacgactgta gggactggtc tgatgaagcc aactgtactg ccatctatca tacctgtgag      3600
     gcctccaact tccagtgcca caatgggcac tgcatccccc agcgatgggc atgtgacggt      3660
     gatgcggatt gccaggatgg ctctgatgaa gatcccgtca gctgtgagaa aaagtgcaac      3720
     ggattccact gcccaaacgg cacgtgcatc ccgtccagca agcattgtga tgggctgagg      3780
     gactgccccg acggctccga tgatgagcac tgtgagccct tctgcacgcg cttcatggac      3840
     ttcgtgtgta agaaccgtca gcagtgtctg ttccactcca tggtgtgtga cgggatcgtc      3900
     cagtgccgag atggctctga tgaggatgcg gccttcgctg gatgctcgca agaccccgag      3960
     ttccacaagg agtgcgatga gttcggcttc cagtgtcaga acggagtgtg catcagcttg      4020
     atttggaaat gcgatgggat ggatgactgc ggggactact ctgacgaggc caactgtgaa      4080
     aaccccacag aagccccaaa ctgttcccgt tactttcagt tccactgtga gaatggccac      4140
     tgcatcccca acaggtggaa atgtgacaga gagaacgact gtggggactg gtctgatgag      4200
     aaggattgtg gagattcaca tgttctgccc tccccgaccc ccgggccctc cacgtgtttg      4260
     cccaattact tcgcgtgcag cagcggggcc tgtgtgatgg gcacctgggt gtgcgacggc      4320
     tacagggact gtgcagatgg ctctgatgag gaggcctgcc cctctctagc aaactccact      4380
     gccgcctcca ctcccaccca gctcgggcag tgcgaccgat ttgagttcga gtgtcaccaa      4440
     ccaaagaaat gtatccccaa ctggaagcgc tgtgacggcc accaagattg ccaagacggc      4500
     caggatgaag ccaactgccc cactcacagc accttgacct gtacgagcag ggagttcaag      4560
     tgtgaggacg gcgaggcatg catcgtgctc tcagagcgct gtgatggctt cctggattgc      4620
     tccgatgaga gcgatgagaa ggcctgcagc gatgagttaa ctgtatacaa agtgcagaat      4680
     ctccagtgga cagctgattt ctccggggat gtgactttga cctggatgcg gccaaagaaa      4740
     atgccatctg cttcttgtgt atacaatgtc tactacaggg tggttggaga gagcatatgg      4800
     aagaccctgg aaacccacag caataaaaca agcactgtgc tcaaggtcct gaagccagac      4860
     accacgtacc aggttaaggt ccaggtgcac tgcctcaaca aggtgcacaa caccaatgac      4920
     tttgtgaccc tcaggactcc agaagggttg ccagatgccc ctcggaatct ccagctctcc      4980
     ctgaacaggg aagaggaagg tgtgattctc gggcactggg ctcctcccgt ccacacccat      5040
     ggcctcatcc gtgagtacat tgtggaatac agcaggagtg ggtccaagat gtgggcctcc      5100
     cagagagctg ctagcaactc tacagaaata aagaacttac tgctcaatgc cctctacact      5160
     gtcagagtgg ctgcggtgac tagtcgtggg ataggaaact ggagtgattc taagtccatc      5220
     accaccataa aaggaaaagt gatccaagca ccaaatatcc acattgacag ctacgatgaa      5280
     aattctctga gctttaccct gaccatggat ggtgacatca aggtcaatgg ctacgtggtg      5340
     aaccttttct ggtcatttga tgcccacaaa caagaaaaga aaaccctgag cttccgcgga      5400
     gggagtgcac tgtcacacaa agttagcaac ctgacagctc atacatccta tgagatttct      5460
     gcctgggcca agacagactt gggagatagc ccactggcct ttgagcacat cttgaccaga      5520
     ggcagcagtc caccagctcc tagtctcaaa gccaaggcca tcaatcagac tgcagtggag      5580
     tgcatctgga ctggccccaa gaatgtggtg tatggtattt tctatgccac atccttcctt      5640
     gacctctacc gaaaccctaa gagcgtaact acttcgctcc acaataagac agtcatcgtc      5700
     agcaaggatg agcagtatct gtttctggtc cgggtgttga tcccttacca agggccgtct      5760
     tctgactacg ttgtagtgaa gatgatccca gacagcaggc tcccacctcg ccatctgcac      5820
     gcggtccaca taggcaaaac ctcagcactc atcaaatggg aatcgcccta tgactctcct      5880
     gaccaggact tgttttacgc cattgcagtg aaagatctga tcaggaagac ggacagaagc      5940
     tacaaagtca gatcccgcaa cagtactgtg gagtacagcc taagcaagct ggaacctgga      6000
     gggaaatacc acatcattgt ccagctggga aacatgagca aggattccag cataaaaatc      6060
     accacagttt cgttatcagc acctgatgcc ttaaaaatca taacggaaaa cgaccacgtt      6120
     ctcctctttt ggaaaagcct agcattgaag gaaaagcagt tcaatgaaac caggggctat      6180
     gagatccaca tgtctgacag tgctgtgaat ctcaccgctt acctcgggaa tactacggac      6240
     aatttcttta aagtgtccaa cctgaagatg ggtcataact acactttcac ggtccaagcg      6300
     cggtgtctct ttggtagcca gatctgtggg gagcccgccg tgctgctgta tgatgaactg      6360
     agctcaggtg cagatgcggc agtgatccac gctgcccggt ctactgatgt tgcagctgtg      6420
     gtggttccca tcctgttcct gatcctgctg agcctgggtg tcggcttcgc catcctctac      6480
     acgaagcacc gtcgcttaca gagcagcttc agcgctttcg ccaatagcca ctacagctcc      6540
     aggctgggct cggccatctt ctcctcaggg gatgacctag gagaggacga tgaagatgct      6600
     cccatgatta ctggattctc agacgatgtc cccatggtga tagcgtga                   6648
//


spacer
spacer