Dbfetch

ID   AB015671; SV 1; linear; genomic DNA; STD; HUM; 5508 BP.
XX
AC   AB015671;
XX
DT   03-AUG-1999 (Rel. 60, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Homo sapiens NBPhox gene, complete cds.
XX
KW   NBPhox.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5508
RA   Yokoyama M.;
RT   ;
RL   Submitted (19-JUN-1998) to the INSDC.
RL   Masahiro Yokoyama, Japan Tobacco, Inc., Pharmaceutical Frontier Research
RL   Laboratories; 13-2 Fukuura 1-chome, Kanazawa-ku, Yokohama, Kanagawa
RL   236-0004, Japan (E-mail:masahiro.yokoyama@ims.jti.co.jp, Tel:045-786-7693,
RL   Fax:045-786-7692)
XX
RN   [2]
RX   DOI; 10.1006/geno.1999.5845.
RX   PUBMED; 10395798.
RA   Yokoyama M., Watanabe H., Nakamura M.;
RT   "Genomic structure and functional characterization of NBPhox (PMX2B), a
RT   homeodomain protein specific to catecholaminergic cells that is involved in
RT   second messenger-mediated transcriptional activation";
RL   Genomics 59(1):40-50(1999).
XX
DR   MD5; 44f887df1352b82a1bda999668ee0b0e.
DR   Ensembl-Gn; ENSG00000109132; homo_sapiens.
DR   Ensembl-Tr; ENST00000226382; homo_sapiens.
DR   EuropePMC; PMC1773584; 12631670.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5508
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(886..1126,1962..2149,3176..3691)
FT                   /gene="NBPhox"
FT                   /function="transcriptional factor"
FT                   /db_xref="GOA:Q99453"
FT                   /db_xref="HGNC:HGNC:9143"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99453"
FT                   /protein_id="BAA82670.1"
FT                   /translation="MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYN
FT                   PIRTTFGATSGCPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTT
FT                   FTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAA
FT                   AAAAKNGSSGKKSDSSRDDESKEAKSTDPDSTGGPGPNPNPTPSCGANGGGGGGPSPAG
FT                   APGAAGPGGPGGEPGKGGAAAAAAAAAAAAAAAAAAAAGGLAAAGGPGQGWAPGPGPIT
FT                   SIPDSLGGPFGSVLSSLQRPNGAKAALVKSSMF"
XX
SQ   Sequence 5508 BP; 1271 A; 1401 C; 1392 G; 1444 T; 0 other;
     cctgagtctc ttgaaagcac atttagctgc aagaagaaat gcaatttata agatgctttc        60
     tctctgtctc tctttgtttt taaccccctc taaccaggtg tatttttaaa gaaatccgct       120
     tatcgttcac ataaaccccc ttggcccact tactctatgt tacagggcgc ctgagtcttg       180
     ccaatgtccc agtcctttat aacatttcat gcacttcggg gggtaggctt gttgttaaat       240
     tgagcgtgta acactcttac aaaacaggtt ttctatgaca tcaaggtttc ttctccctaa       300
     ccgaggggga aaaaaagaag aggacgaaga agggggaaaa cacacacact atctcaattt       360
     atgcctaagg tatatgatca gttaaaaagg cttaaaagct cggggaaatt ggatcaggga       420
     gaatcgtcac ccaactttca ttatttccaa gtagtgtgat tgaattaaag ggcagggagc       480
     tggttagaag ggaggatcag gggctcggtg cgtaatggtg tggtattaaa ttctaattag       540
     agatgcagga atcaatgata gggaggttgg acagctcagt tccccagtgc cagcccaata       600
     gacggatgag ttattgtcat gtaaaaagcg ccagcaataa gaccaaccgc tttgctattg       660
     tccaagtgga aagagccaag tttattatga ggactatatg ctctagagac ctcagacaag       720
     gcatctcata ggaggctttt tcataaaact aggctctgct ggtagtaagg aggccagttt       780
     ggaggcaggc gttgagctgt gcacatctcc ccactccagc caccttctcc atatccatct       840
     tttatttcat ttttccactt ggctgagcca tccagaacct tttcaatgta taaaatggaa       900
     tattcttacc tcaattcctc tgcctacgag tcctgtatgg ctgggatgga cacctcgagc       960
     ctggcttcag cctatgctga cttcagttcc tgcagccagg ccagtggctt ccagtataac      1020
     ccgataagga ccacttttgg ggccacgtcc ggctgccctt ccctcacgcc gggatcctgc      1080
     agcctgggca ccctcaggga ccaccagagc agtccgtacg ccgcaggtta ggaccttcag      1140
     ctttctcagc ggaggaagcc gcctttccgc ccgtatatag gaagccttga ttgcatttga      1200
     aaatggaaat gtgtttagta tttaccaaac gaaatttgct tacacaaatg aaagaattta      1260
     tcacgtttga agcgattgca gggaggggta attcacttac agggttacac tatcctagtc      1320
     acacccgaac cgcccacaaa attatcttaa gctgccaaaa tgataggcat aatttattta      1380
     ctttgcgatg agacgtatag cttagaaaat aattgaatta caaagagtaa agctcattac      1440
     tggcagtgtc tcttttttta agaaccgaga gcggctcaca cttcttgggc tggtcatttt      1500
     tatgattatt tctttaattt attattattt ttttgcagct ctttccccca acttttgagc      1560
     cgggtcaact ttctgagaat tgaaaagttc ccaaagtggg actgtttggt aacttctttc      1620
     cctggctccc ctgatattcc gactgatgtt ttgggatttt tttcctctct ggttttttcc      1680
     tgctgaaagc actatctcaa gtccgtcaca tcgcgctgtt tcaatccacc caaaggcgct      1740
     tgtgccagaa aggactccgc caagcccgaa gtttgagccc aggtttccgc agataacaaa      1800
     tttcctcggt ttcttcccgc agcttctctc ggcaactctc tcgcgcgggt gtaggtagcg      1860
     gctgccgtat gacctgacct tggagtcctc acattctagc tccacggccg gcgagctgcc      1920
     ggctgatttg ctcactttct gtctcctctg tcatactcta gttccttaca aactcttcac      1980
     ggaccacggc ggcctcaacg agaagcgcaa gcagcggcgc atccgcacca ctttcaccag      2040
     tgcccagctc aaagagctgg aaagggtctt cgcggagact cactaccccg acatctacac      2100
     tcgggaggag ctggccctga agatcgacct cacagaggcg cgagtccagg tacgcgcgcc      2160
     tggaaaccga ccccgctccg ccgcactggt ccggggaggt gtggggtgag gggcggctgg      2220
     tgaaattcga agtcctggag cctcgagtga gaaggaccta gggccccatg gccgatcaga      2280
     aatactggat ttggtgtggc tgtgcgttcg agagaggctt agagcgcacg ctcttggcat      2340
     tttatttaca gttgcgaagt gtttcccacc cgagcagaga catggggggc cttgggacgt      2400
     ggatgagcga tgcaatttcg gggacaggaa gtgcctgtgg tggaaggtgt gcagactttg      2460
     ctcccgtatt ataagttttt ccttctcccc tcccgccccc caaaaaaatg cctcctaact      2520
     caagtgcttt taacctggcc ccatggcata taggttcatt ttcccggaaa ctgtgacttg      2580
     cattagattt gcaaagggtc tgtgacttca tgaaggtcaa gaaccatgac ttactccaac      2640
     ctgttaaaca caggtgcgct cacgagttgg ccacagcgcc tttttgggtg agcccccgac      2700
     cgagaagcgg tgcgcaccat tgcacgcttt tccaggctca aaggccgggg atgggcagcg      2760
     gagcaaaccc agagaggatc ccttttcctt ttaccaatta gagtttaact ttagaactta      2820
     ggcttagggg tgaatggcga gctcggggct tgctcaagaa gccgactgaa cagaggccca      2880
     ccaaaataag gccttccctt ttcgggtctt tctgggacct gcggcttttt aaactctgcc      2940
     gcaagccttc atgtccctgg cgtgctcact ccccctaaga aagtttctcc gaaaatgcac      3000
     agcaataaga agcggtagac ttggtggatg tgcgcgcggg ggtgatcaca gcgcatgggg      3060
     aggagggtgt taaaacaagc cgaagtagaa cttgggccac cctaaccggt gcttttcttt      3120
     cccattttct tctttctccc cctgcttcac cgtctctcct tccgtcttgg gccaggtgtg      3180
     gttccagaac cgccgcgcca agtttcgcaa gcaggagcgc gcagcggcag ccgcagcggc      3240
     cgcggccaag aacggctcct cgggcaaaaa gtctgactct tccagggacg acgagagcaa      3300
     agaggccaag agcactgacc cggacagcac tgggggccca ggtcccaatc ccaaccccac      3360
     ccccagctgc ggggcgaatg gaggcggcgg cggcgggccc agcccggctg gagctccggg      3420
     ggcggcgggg cccgggggcc cgggaggcga acccggcaag ggcggcgcag cagcagcggc      3480
     ggcggccgcg gcagcggcgg cggcggcagc ggcagcggcg gcagctggag gcctggctgc      3540
     ggctgggggc cctggacaag gctgggctcc cggccccggc cccatcacct ccatcccgga      3600
     ttcgcttggg ggtcccttcg gcagcgtcct atcttcgctc caaagaccca acggtgccaa      3660
     agccgcctta gtgaagagca gtatgttctg atctggaatc ctgcggcggc ggcggcggcg      3720
     gcgacagcgg gcgagccagg gcccgggcgg gcgagtgggc gagcgggtag gcccaaggct      3780
     attgtcgtcg ctgctgccat ggctttttca ttgagggcct aaagtaatcg cgctaagaat      3840
     aaagggaaaa cggcgtcgcc ctcatttcaa ccccactcct acccccttcc tcaaccccca      3900
     aacaaaacaa acaaacttcc ctggcttcgc acctgcctgg ggcctcgcag cggggccagg      3960
     gctccgcctg ctgatcgggg gttgtgagca gcgcggcctg gacgcggggc actctcaggg      4020
     ggctgtgtct gcgtgtcagt ttgtgtctgt ctcggggaat gtgtgtctgt ggcccaagca      4080
     ggtgacagga agagatgggg ggcctcaacc aacttagtga cttgtttaga aaaaaaagac      4140
     aaaaaagtaa aaataaaaac aaaaaagttg gaaggcagaa accattaaaa aacaaaaagc      4200
     caacaaccca gaaaggttta aaaaacataa ggaaaaaaaa gacaaattaa aggaggggct      4260
     aggggagaag ctgcagctgg agctgaaggc tcgatcttgt gaacccctaa atccgctccc      4320
     tcctaacagc acggattctc ttggggctct tcttcaggga agagtaggga cgccgttcca      4380
     gccccccttc ctatcgtgtc cttgggttcg ggtcactgcg gcgacgactt gctcagactg      4440
     tcccggcggc cggagtgact ttctcgcacc cccttgcctg tcccacctcg ctgaacacca      4500
     tcccgccatt agcgcatcgg aaccccacac agttgcaact cccaaccccg aatctttgca      4560
     gccgttcggc cctgaaagat gccctatcca tgagatgcct tttcatctgc aaactctgca      4620
     aaatgtgtct catgtttcgc aactcttttt ttccccctcg ctcccgccta ccccgtcggc      4680
     attttcttct tccaccagct tttactgaac tttttggcac tgctttggat tggggtcaat      4740
     tgcagtccac gtaactggct gcagagaaat ctaccgagca aggaaaaggc acacacacac      4800
     gtttgcaggg gtgtctcggt ttgcatttct gttggaatga tccgaactgg actcacatcc      4860
     tgtatggtgg atggactgta tattgagggt tccattcttc gcgcagttta gacatctctg      4920
     ttttgattct ttgttgttgt ttttatttta aaaggcacaa actctagata ttagttgaat      4980
     gttgaggctt taactttttc ggtgtctttc tacaactgtg ttctgtgact caattgtatc      5040
     gtgttaatat cagtgcagac tgtctcctct acgtgaccgt ataatgtttt tctcgtcttg      5100
     tagtctctat ggcgtgtctt tatggtgtaa taaggttctc acggggtcaa tcttttgtgt      5160
     ttagagaggc cacggttcag acaatggtat atatttttgt tatcaggtgc atgtctgtct      5220
     gatttctttt tttttcctgt tggactatgt ttgtgaacat aattgtcata agttatgttt      5280
     cagatttttg aatttattta tatgtgttat aatgaatgct tctatttaaa agggaaatat      5340
     ttctacatgt gcttatagtt ttccaagagt gtaccattaa cttgattgtt gataataaaa      5400
     accaaaagca agtctagcaa ttgaactctt ctttttcttg attctttttt tttttttttt      5460
     tttgggttgg tcattgtttt ttttttttaa gttttttttt aaaaggat                   5508
//