spacer

EBI Dbfetch

ID   AB015184; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB015184;
XX
DT   10-JUN-1998 (Rel. 56, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens gene for HLA-D class II antigen DR1 beta chain, partial cds.
XX
KW   DRB1*0101V1; HLA-D class II antigen DR1 beta chain.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Kashiwase K., Akaza T., Juji T.;
RT   ;
RL   Submitted (01-JUN-1998) to the INSDC.
RL   Kouichi Kashiwase, Japanese Red Cross Central Blood Center, Reseach; 4-1-31
RL   Hiroo, Shibuya-Ku, Tokyo 192, Japan (E-mail:kasiwase@hla.cbc.jrc.or.jp,
RL   Tel:81-3-5485-9220, Fax:81-3-3406-7892)
XX
RN   [2]
RA   Kashiwase K., Akaza T., Juji T.;
RT   "HLA-DRB1 new alleles";
RL   Unpublished.
XX
DR   MD5; 50ddc2f9ad56cdf6f1853bcbfbe379ab.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="Japanese genotype;
FT                   HLA-A24,A26,B7,DRB1*0101,DRB1*0101V1"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="DRB1*0101V1"
FT                   /product="HLA-D class II antigen DR1 beta chain"
FT                   /note="allele"
FT                   /db_xref="GOA:P04229"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*01:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1DLH"
FT                   /db_xref="PDB:1FYT"
FT                   /db_xref="PDB:1HXY"
FT                   /db_xref="PDB:1JWM"
FT                   /db_xref="PDB:1JWS"
FT                   /db_xref="PDB:1JWU"
FT                   /db_xref="PDB:1KG0"
FT                   /db_xref="PDB:1KLG"
FT                   /db_xref="PDB:1KLU"
FT                   /db_xref="PDB:1LO5"
FT                   /db_xref="PDB:1PYW"
FT                   /db_xref="PDB:1R5I"
FT                   /db_xref="PDB:1SEB"
FT                   /db_xref="PDB:1SJE"
FT                   /db_xref="PDB:1SJH"
FT                   /db_xref="PDB:1T5W"
FT                   /db_xref="PDB:1T5X"
FT                   /db_xref="PDB:2FSE"
FT                   /db_xref="PDB:2G9H"
FT                   /db_xref="PDB:2IAM"
FT                   /db_xref="PDB:2IAN"
FT                   /db_xref="PDB:2ICW"
FT                   /db_xref="PDB:2IPK"
FT                   /db_xref="PDB:2OJE"
FT                   /db_xref="PDB:2XN9"
FT                   /db_xref="PDB:3L6F"
FT                   /db_xref="PDB:3PDO"
FT                   /db_xref="PDB:3PGC"
FT                   /db_xref="PDB:3PGD"
FT                   /db_xref="PDB:3QXA"
FT                   /db_xref="PDB:3QXD"
FT                   /db_xref="PDB:3S4S"
FT                   /db_xref="PDB:3S5L"
FT                   /db_xref="PDB:4AEN"
FT                   /db_xref="PDB:4AH2"
FT                   /db_xref="PDB:4E41"
FT                   /db_xref="PDB:4FQX"
FT                   /db_xref="PDB:4GBX"
FT                   /db_xref="PDB:4I5B"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04229"
FT                   /protein_id="BAA28761.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVREYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 59 A; 62 C; 98 G; 51 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtga       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer