spacer

EBI Dbfetch

ID   AB014510; SV 1; linear; mRNA; STD; MUS; 1761 BP.
XX
AC   AB014510;
XX
DT   11-JAN-1999 (Rel. 58, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for myosin 15, partial cds.
XX
KW   myosin 15.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1761
RA   Wakabayashi Y., Kominami R.;
RT   ;
RL   Submitted (21-MAY-1998) to the INSDC.
RL   Yuichi Wakabayashi, Niigata University School of Medicine, Department of
RL   Biochemistry; 1-757 Asahimachi-douri, Niigata, Niigata 951-8122, Japan
RL   (E-mail:waka@med.niigata-u.ac.jp, Tel:+81-25-227-2082, Fax:+81-25-227-0757)
XX
RN   [2]
RP   1-1761
RA   Wakabayashi Y., Kominami R.;
RT   "Myosin 15";
RL   Unpublished.
XX
DR   MD5; 75ba8281c6ffc75053a07ebadd657531.
DR   Ensembl-Gn; ENSMUSG00000042678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071880; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081823; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094135; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1761
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="32cM"
FT                   /strain="C57Black6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>1761
FT                   /codon_start=1
FT                   /product="myosin 15"
FT                   /function="encoded by deafness mutation, shaker-2"
FT                   /db_xref="GOA:Q9QZZ4"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000857"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1261811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZZ4"
FT                   /protein_id="BAA36582.1"
FT                   /translation="TYIGSILVSVNPYRMFAIYGPEQVQQYSGRALGENPPHLFAIANL
FT                   AFAKMLDAKQNQCVIISGESGSGKTEATKLILRCLAAMNQRRDVMQQIKILEATPLLEA
FT                   FGNAKTVRNDNSSRFGKFVEIFLEGGVICGAITSQYLLEKSRIVFQAKNERNYHIFYEL
FT                   LAGLPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLGFTSEDQDS
FT                   IFRILASILHLGNVYFEKHETDAQEVASVVSAREIQAVAELLQVSPEGLQKAITFKVTE
FT                   TIREKIFTPLTVESAVDARDAIAKVLYALLFGWLITRVNALVSPKQDTLSIAILDIYGF
FT                   EDRSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQMDWREIAFADNQPCINLIS
FT                   LKPYGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPLPEFTIKHYAGKVTY
FT                   QVHKFLDKNHDQVRQDVLDLFVHSRTRVVAHLFSSHAAQTAPPRLGKSSSITRLYKAHT
FT                   VAAKFQQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVMMAQLRYSGVLETVRIR
FT                   KEGFPVRLPFQ"
XX
SQ   Sequence 1761 BP; 426 A; 482 C; 468 G; 385 T; 0 other;
     acctatattg gcagtattct ggtgtcggtg aacccatatc gaatgtttgc aatctacggg        60
     cctgagcagg tgcagcagta cagtgggcgt gccctaggag aaaatccccc gcacctcttt       120
     gcaattgcta atcttgcctt cgccaaaatg cttgatgcca aacagaacca gtgtgtcatc       180
     atcagtgggg agagtggctc tggaaagact gaggctacga aactgattct gcgctgcctg       240
     gctgccatga accagagacg ggacgtcatg cagcagataa agatcctgga ggcaacgcct       300
     ctcctggagg cctttggtaa tgccaaaact gtcaggaatg acaactccag ccgctttggg       360
     aagtttgtgg aaatctttct agaagggggt gtgatctgtg gtgccataac ctctcagtac       420
     ctgctggaga agtcaaggat tgtgttccag gccaaaaatg aaagaaatta tcatattttc       480
     tatgagctgc tggctgggct ccctgctcaa ctaaggcagg ccttcagcct gcaggaggct       540
     gagacctact actacctgaa ccagggcggg aactgtgaga tcgctggaaa gagtgacgca       600
     gatgacttcc gccgtctgct ggctgcgatg gaggtgcttg gcttcaccag tgaggaccag       660
     gacagcatct tccgaatcct agcctccatc ttacacctgg gcaatgtcta ttttgagaaa       720
     catgagaccg atgcccagga ggtggcctcg gtggtgagcg cccgggagat ccaggctgtg       780
     gcagagctgc ttcaggtctc tcctgagggc ctgcagaagg ctatcacctt caaagtgact       840
     gagacaattc gagagaagat cttcacaccc ctaacagtgg agagtgccgt agatgccagg       900
     gacgccatcg ccaaggtctt gtatgcactg ctgtttggct ggctcatcac cagggtcaac       960
     gctctggtgt ccccaaaaca agatacattg tccatcgcca tcttggacat atatggcttt      1020
     gaggaccgta gcttcaacag ctttgaacaa ctgtgcatca actatgccaa cgagaacctt      1080
     cagtacctgt tcaacaagat cgtcttccag gaggagcagg aggagtacat ccgggagcag      1140
     atggactgga gagagattgc ctttgctgac aaccagccct gcatcaacct catctccctg      1200
     aagccctacg gcatcctgcg catcctggat gaccagtgct gctttcccca ggccacagac      1260
     cacacattcc tgcagaagtg ccactaccac catggcgcca acccgctcta ctctaagcct      1320
     aagatgccac tgccagagtt taccatcaag cactatgcag gcaaggtcac ctaccaggtg      1380
     cacaagttcc tggacaagaa ccatgaccaa gtgcgccaag acgtcctgga cttgtttgtg      1440
     cacagccgca caagggtggt agcacacctt ttctccagcc acgctgcgca gactgcccct      1500
     ccacgcctgg gcaagagcag ctccattacc cgtctctaca aggctcacac ggtggcggcc      1560
     aagttccagc agtccctcct ggacctggtg gaaaagatgg agaggtgtaa ccctttgttc      1620
     gtgcgctgcc tgaagcccaa ccataagaag gaacctggtc tctttgagcc agatgtgatg      1680
     atggcacagt tacgctattc aggggttctg gagactgtga ggatccgcaa ggaaggcttt      1740
     ccggtgcggc tacccttcca g                                                1761
//


spacer
spacer