spacer

EBI Dbfetch

ID   AB013729; SV 1; linear; mRNA; STD; MUS; 2843 BP.
XX
AC   AB013729;
XX
DT   23-MAR-1999 (Rel. 59, Created)
DT   18-JUN-2009 (Rel. 101, Last updated, Version 5)
XX
DE   Mus musculus mRNA for semaphorin Y, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2843
RA   Kimura T., Hanafusa H.;
RT   ;
RL   Submitted (08-MAY-1998) to the INSDC.
RL   Contact:Toru Kimura Sumitomo Pharmaceuticals Co. Ltd., Research Center;
RL   3-1-98, Kasugade-naka, Konohana, Osaka 554-0022, Japan
XX
RN   [2]
RX   DOI; 10.1006/mcne.1998.0732.
RX   PUBMED; 10049528.
RA   Kikuchi K., Chedotal A., Hanafusa H., Ujimasa Y., de Castro F.,
RA   Goodman C.S., Kimura T.;
RT   "Cloning and characterization of a novel class VI semaphorin, semaphorin
RT   Y";
RL   Mol. Cell. Neurosci. 13(1):9-23(1999).
XX
DR   MD5; bc166365f02de7a38610dcae91ba849f.
DR   Ensembl-Gn; ENSMUSG00000038777; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168321; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2843
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             20..2815
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="semaphorin Y"
FT                   /db_xref="GOA:Q9WTM3"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR015514"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:1338032"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTM3"
FT                   /protein_id="BAA76294.1"
FT                   /translation="MPRAPHSMPLLLLLLLLSSLPQAQAAFPQDPTPLLTSDLQGASPS
FT                   SWFRGLEDDAVAAELGLDFQRFLTLNRTLLVAARDHVFSFDLQAQEEGEGLVPNKFLTW
FT                   RSQDMENCAVRGKLTDECYNYIRVLVPWNSQTLLACGTNSFSPMCRSYGITSLQQEGEE
FT                   LSGQARCPFDATQSTVAIFAEGSLYSATAADFQASDAVVYRSLGPQPPLRSAKYDSKWL
FT                   REPHFVYALEHGEHVYFFFREVSVEDARLGRVQFSRVARVCKRDMGGSPRALDRHWTSF
FT                   LKLRLNCSVPGDSTFYFDVLQSLTGPVNLHGRSALFGVFTTQTNSIPGSAVCAFYLDDI
FT                   ERGFEGKFKEQRSLDGAWTPVSEDKVPSPRPGSCAGVGAAASFSSSQDLPDDVLLFIKA
FT                   HPLLDPAVPPATHQPLLTLTSRALLTQVAVDGMAGPHRNTTVLFLGSNDGTVLKVLPPG
FT                   GQSLGSEPIVLEEIDAYSHARCSGKRSPRAARRIIGLELDTEGHRLFVAFPGCIVYLSL
FT                   SRCARHGACQRSCLASLDPYCGWHRSRGCMSIRGPGGTDVDLTGNQESTEHGDCQDGAT
FT                   GSQSGPGDSAYGVRRDLSPASASRSIPIPLLLACVAAAFALGASVSGLLVSCACRRANR
FT                   RRSKDIETPGLPRPLSLRSLARLHGGGPEPPPPPKDGDAAQTPQLYTTFLPPPDGGSPP
FT                   ELACLPTPETTPELPVKHLRASGGPWEWNQNGNNASEGPGRPPRGCSGAGGPAPRVLVR
FT                   PPPPGCPGQAVEVTTLEELLRYLHGPQPPRKGSEPLASAPFTSRPPASEPGASLFVDSS
FT                   PMPRDGVPPLRLDVPPEGKRAAPSGRPALSAPAPRLGVGGSRRLPFPTHRAPPGLLTRV
FT                   PSGGPARYSGGPGRHLLYLGRPEGHRGRSLKRVDVKSPLSPKPPLASPPQPAPHGGHFN
FT                   F"
XX
SQ   Sequence 2843 BP; 463 A; 955 C; 844 G; 581 T; 0 other;
     gtgagctgcc ccgcacagga tgccccgtgc cccccactcc atgcccctgc tgctcctgct        60
     gctgttgctg tcatcgctcc cccaagccca ggctgccttt ccccaggacc ccacccctct       120
     gttgacctct gaccttcaag gtgcctctcc atcatcctgg ttccggggcc tggaggacga       180
     tgctgtggct gcggaacttg ggctggactt tcagagattc ctgaccttga accggacctt       240
     gcttgtggct gcccgggatc acgttttctc cttcgatctt caagcccaag aagaagggga       300
     ggggctggtg cccaacaagt ttctgacatg gaggagtcaa gatatggaga actgtgcagt       360
     ccggggaaag ctgacggacg aatgctacaa ctacatccgt gttcttgttc cctggaactc       420
     gcagacactt cttgcctgtg gaacaaattc cttcagccct atgtgccgca gctatgggat       480
     aacatctctg caacaggagg gtgaggagct gagtgggcag gctcgatgcc cctttgatgc       540
     cacccagtcc actgtggcca tctttgcaga gggcagtttg tactcagcca cagcagcaga       600
     tttccaggcc agtgatgctg tagtttacag aagtcttgga cctcagcctc cactccgttc       660
     tgcaaagtat gactccaagt ggcttcgaga gccacacttt gtctatgcgt tggagcatgg       720
     agagcacgtc tacttcttct tccgagaagt ctctgtggag gatgcccgct tagggagggt       780
     gcagttttcc agggtagccc gggtatgtaa acgtgacatg ggtggctcac ctcgggcctt       840
     ggatcgccac tggacatcct tccttaagct gaggctcaac tgctctgtcc ctggggactc       900
     taccttctac tttgacgtct tacagtcctt aactgggcct gtgaacctgc atggccgctc       960
     cgctctcttt ggggtcttca ctactcagac caatagcatt cctgggtctg cagtctgcgc      1020
     cttctaccta gatgatattg aacgtggctt tgagggcaag ttcaaggagc agaggagtct      1080
     ggatggggcc tggactcctg tgtctgagga caaggtcccc tcacccaggc cagggtcctg      1140
     tgcaggtgtg ggtgcagctg cctcgttctc ctcctctcaa gacctacctg atgatgtcct      1200
     gctcttcatc aaggcacacc cgctgctgga tcctgctgtg ccacccgcca cccatcaacc      1260
     gctcctcact ctgactagca gggccctgct gacccaggta gctgtggacg gaatggctgg      1320
     tccccacaga aatactactg tcctgtttct tggctccaac gatgggacag tgctgaaggt      1380
     gctacctcca gggggtcagt ctttgggctc tgagcctatc gtcttggaag agattgatgc      1440
     ctacagccat gcccggtgca gtgggaagcg gtcaccccga gctgcgcggc ggatcatagg      1500
     gctggagctg gacactgagg gtcacaggct ttttgtggcc tttcctggat gtatcgtcta      1560
     cctctctctc agccggtgtg cccggcatgg agcatgtcag aggagctgcc tggcttctct      1620
     ggacccatac tgtggatggc atcgatccag aggctgcatg agtatcaggg gacctggtgg      1680
     gactgatgtc gatctgactg ggaaccagga atccacagag cacggtgact gccaagatgg      1740
     agcgaccggg agtcagtctg gccctggaga ttctgcttat ggcgtgcgca gggacctttc      1800
     cccagcctca gcctcccgat ccattcccat cccactcctc ctggcctgtg tggccgcggc      1860
     cttcgctttg ggcgcctcag tctccggtct cttggtgtcc tgtgcttgtc gtcgcgcgaa      1920
     ccgccgtcgg agcaaggaca tcgagacccc ggggctgccg cgccccctct cccttcgcag      1980
     cctggcccgg ctgcacggtg gcggtcctga gcccccgcct ccgcccaagg atggagatgc      2040
     agcgcaaacg ccccagctct acactacctt cctgcctccg cccgacggcg gatccccacc      2100
     ggagctggcc tgcctaccca cgccggagac gacgcccgag ctgcccgtga agcacctccg      2160
     tgcctccggg ggcccctggg aatggaacca gaatgggaac aacgcctcgg agggcccagg      2220
     ccgcccacca cggggctgca gcggggcggg cgggcccgca ccgcgagtgc tggtgaggcc      2280
     accgccccct ggctgccccg ggcaggcggt agaggtgacc acgctggagg aactgctgcg      2340
     ctacctgcac ggccctcagc cgcccaggaa gggtagcgaa cctctcgcct ccgccccgtt      2400
     cacctcccgg ccgcccgcct cggagcccgg cgcctcgctg ttcgtggact ccagcccgat      2460
     gccgcgggat ggcgttccgc cgctcaggct cgacgtgcca cccgaaggca agcgcgctgc      2520
     cccgagcggg cggcctgctc tctcggcccc agccccgcgc ctgggtgtcg gcggcagccg      2580
     ccgattgccc tttcccacac accgggcgcc cccgggcctg ctcacgcgag tgccctcggg      2640
     aggcccggcc aggtactccg gggggcccgg gaggcacctc ctgtacctgg gccggcccga      2700
     aggccatcgc ggccgctccc tgaagagggt ggacgtgaag tctccgctgt cgcccaagcc      2760
     gcccctcgcc tccccgccgc agcccgcccc gcacggtggt catttcaact tctgacggaa      2820
     gctgctcgcg cccgcccgtc gag                                              2843
//


spacer
spacer