Dbfetch

ID   AB010833; SV 1; linear; mRNA; STD; MUS; 3549 BP.
XX
AC   AB010833; AB000847;
XX
DT   06-FEB-1998 (Rel. 54, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus ptch2 mRNA, complete cds.
XX
KW   ptch2.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3549
RA   Takabatake T.;
RT   ;
RL   Submitted (04-FEB-1998) to the INSDC.
RL   Takashi Takabatake, Nagoya University, Radioisotope Research Center;
RL   Furo-cho, Chikusa, Nagoya, Aichi 464-8602, Japan
RL   (E-mail:j45998a@nucc.cc.nagoya-u.ac.jp, Tel:052-789-2573, Fax:052-789-2567)
XX
RN   [2]
RX   DOI; 10.1016/S0014-5793(97)00645-5.
RX   PUBMED; 9237688.
RA   Takabatake T., Ogawa M., Takahashi T., Mizuno M., Okamoto M., Takeshima K.;
RT   "Hedgehog and patched gene expression in adult ocular tissues";
RL   FEBS Lett. 410(2-3):485-489(1997).
XX
RN   [3]
RX   DOI; 10.1038/ng0298-104.
RX   PUBMED; 9462734.
RA   Motoyama J., Takabatake T., Takeshima K., Hui C.-c.;
RT   "Ptch2, a second mouse Patched gene is co-expressed with Sonic hedgehog";
RL   Nat Genet 18(2):104-106(1998).
XX
DR   MD5; 2321dee3effdb1779f2dece5308ebcb4.
DR   Ensembl-Gn; ENSMUSG00000028681; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028642; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028603; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028553; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028624; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028338; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029065; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027772; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028305; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028453; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028421; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028555; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028448; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029102; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027498; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027851; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000030443; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0067250; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0067312; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0067211; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0067230; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0066898; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0067710; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0067278; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0066845; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0066980; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0066902; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0067077; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0066891; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0067894; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0066818; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0066088; mus_musculus_wsbeij.
XX
CC   AB000847: Submitted (04-Feb-1997)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3549
FT                   /organism="Mus musculus"
FT                   /strain="BALB/cCrSlc"
FT                   /mol_type="mRNA"
FT                   /dev_stage="14dpc"
FT                   /db_xref="taxon:10090"
FT   CDS             1..3549
FT                   /codon_start=1
FT                   /gene="ptch2"
FT                   /note="putative twelve transmembrane domain protein"
FT                   /db_xref="GOA:O35595"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="InterPro:IPR004766"
FT                   /db_xref="MGI:MGI:1095405"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35595"
FT                   /protein_id="BAA24691.1"
FT                   /translation="MVRPLSLGELPPSYTPPARSSAPHILAGSLQAPLWLRAYFQGLLF
FT                   SLGCRIQKHCGKVLFLGLVAFGALALGLRVAVIETDLEQLWVEVGSRVSQELHYTKEKL
FT                   GEEAAYTSQMLIQTAHQEGGNVLTPEALDLHLQAALTASKVQVSLYGKSWDLNKICYKS
FT                   GVPLIENGMIERMIEKLFPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPQQLL
FT                   EELGPFASLEGFRELLDKAQVGQAYVGRPCLDPDDPHCPPSAPNRHSRQAPNVAQELSG
FT                   GCHGFSHKFMHWQEELLLGGTARDLQGQLLRAEALQSTFLLMSPRQLYEHFRGDYQTHD
FT                   IGWSEEQASMVLQAWQRRFVQLAQEALPANASQQIHAFSSTTLDDILRAFSEVSTTRVV
FT                   GGYLLMLAYACVTMLRWDCAQSQGAVGLAGVLLVALAVASGLGLCALLGITFNAATTQV
FT                   LPFLALGIGVDDIFLLAHAFTKAPPDTPLPERMGECLRSTGTSVALTSVNNMVAFFMAA
FT                   LVPIPALRAFSLQAAIVVGCNFAAVMLVFPAILSLDLRRRHRQRLDVLCCFSSPCSAQV
FT                   IQMLPQELGDRAVPVGIAHLTATVQAFTHCEASSQHVVTILPPQAHLLSPASDPLGSEL
FT                   YSPGGSTRDLLSQEEGTGPQAACRPLLCAHWTLAHFARYQFAPLLLQTRAKALVLLFFG
FT                   ALLGLSLYGATLVQDGLALTDVVPRGTKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQ
FT                   RALFDLHQRFSSLKAVLPPPATQAPRTWLHYYRSWLQGIQAAFDQDWASGRITCHSYRN
FT                   GSEDGALAYKLLIQTGNAQEPLDFSQLTTRKLVDKEGLIPPELFYMGLTVWVSSDPLGL
FT                   AASQANFYPPPPEWLHDKYDTTGENLRIPAAQPLEFAQFPFLLHGLQKTADFVEAIEGA
FT                   RAACTEAGQAGVHAYPSGSPFLFWEQYLGLRRCFLLAVCILLVCTFLVCALLLLSPWTA
FT                   GLIVLVLAMMTVELFGIMGFLGIKLSAIPVVILVASIGIGVEFTVHVALGFLTSHGSRN
FT                   LRAASALEQTFAPVTDGAVSTLLGLLMLAGSNFDFIIRYFFVVLTVLTLLGLLHGLLLL
FT                   PVLLSILGPPPQVVQVYKESPQTLNSAAPQRGGLRWDRPPTLPQSFARVTTSMTVALHP
FT                   PPLPGAYVHPASEEPT"
XX
SQ   Sequence 3549 BP; 645 A; 1144 C; 981 G; 779 T; 0 other;
     atggttcggc cactgtccct tggagagcta cctcccagct acacacctcc agctcggtcc        60
     tccgcacctc atatcctagc tgggagcctg caggctcctc tctggcttcg agcttacttc       120
     caaggtctac tcttctccct ggggtgcagg atccagaaac actgcggcaa agtgctcttc       180
     ctgggactgg tggcctttgg ggctctggca ctgggtctcc gagtggctgt aattgagaca       240
     gacctagaac agctctgggt agaagtgggc agcagggtga gccaggagct gcactacacc       300
     aaggagaagc tgggggaaga ggctgcgtac acctcccaga tgttgattca gactgcgcac       360
     caggaagggg gaaacgtcct cacccccgag gcacttgact tgcacctcca ggcggcgctc       420
     actgccagta aagtccaagt atcactctat gggaaatcct gggatttgaa caagatctgc       480
     tacaaatcag gggttcccct tattgaaaat gggatgatcg aacggatgat tgagaagctg       540
     tttccctgtg tgatcctcac cccgcttgac tgcttctggg aaggagccaa actccaaggg       600
     ggctctgcct acttgccggg ccgccctgat atccagtgga ccaacctgga ccctcagcag       660
     ctgctcgagg agctgggccc ctttgcctct ctggagggct tccgggaact gctagataag       720
     gcacaggtgg gccaggccta tgtggggcga ccctgtctgg accctgatga cccccactgt       780
     ccacctagtg ctcccaaccg gcacagcagg caggctccca atgtggctca ggagctgagt       840
     gggggctgcc atggcttctc ccacaagttc atgcactggc aggaggaact gctactaggg       900
     ggcacagcca gagatctcca aggacagctg ctgagggcag aggccttgca gagcaccttc       960
     ctgctcatga gtccccgtca gctgtacgag cacttccggg gcgactacca gacacatgac      1020
     atcggctgga gcgaggagca ggccagcatg gtgctgcagg cctggcagag gcgctttgtg      1080
     cagctagccc aggaggctct gccggccaac gcgtcccagc agatccatgc cttctcctcc      1140
     accaccctgg atgatatcct gcgcgcgttc tctgaagtca gcaccacccg tgtggtagga      1200
     ggctatctgc ttatgctggc ctatgcctgc gtaacaatgc tgcggtggga ctgcgcccag      1260
     tcccagggtg ccgtaggtct tgctggggtg ttgctggtgg ccctggcggt ggcctcaggt      1320
     cttgggcttt gtgccctact tggcatcact ttcaatgctg ccactacaca ggtgctgccc      1380
     ttcttggctc tgggcattgg cgtggatgac atcttcctgc tggcgcatgc cttcacaaaa      1440
     gccccacctg acacccctct cccagagcgt atgggtgagt gtttgaggag cacgggcacc      1500
     agcgtggcac tcacatccgt caacaacatg gtcgcctttt tcatggctgc cctggttccc      1560
     attcctgcgc tgcgggcctt ctccctgcag gcagccatag tggtcggctg caactttgca      1620
     gcggtaatgc tcgtcttccc tgccatcctc agcctcgacc tgcgccggcg ccaccgccaa      1680
     cgcctggacg ttctctgctg cttttctagc ccctgctccg ctcaggtcat tcagatgctg      1740
     ccccaggagc taggggacag agcagtacca gtgggcattg cccacctgac tgccaccgtg      1800
     caagccttca cccactgcga agccagcagc cagcatgtag tcaccatttt gcctcctcaa      1860
     gcccacctgc tgtctccagc ttctgaccca ctgggctccg aactctatag ccctggaggg      1920
     tctacacggg accttctcag tcaggaggag gggacagggc cacaggcggc ctgcaggccc      1980
     ctgctctgtg cccactggac tctcgcccat tttgcccgct atcagtttgc acctttactg      2040
     ctccagacac gagccaaggc cctggtgttg ctgttctttg gggctctttt gggcctgagc      2100
     ctctatggag ccaccttggt acaagatggg ctggccctga cagatgtggt ccctaggggc      2160
     accaaggaac atgctttcct gagcgcccag ctcaggtact tctccctgta cgaggtggct      2220
     ctagtgacac agggtggctt tgactacgcc cactcccaac gcgccctctt tgatctgcac      2280
     cagcgcttca gctccctcaa ggctgtgctg cccccacctg ccacccaggc accccgcacc      2340
     tggcttcact actaccgcag ctggctacag ggtatccagg ctgcatttga ccaagactgg      2400
     gcttctgggc gcatcacctg ccactcttac cgcaacggct cagaagatgg cgccctggcc      2460
     tacaagctgc tcatccaaac cgggaatgcc caggagcctc tggatttcag ccagctgacc      2520
     acaaggaaac tggtggacaa ggagggactc attcccccag agctcttcta catggggcta      2580
     accgtgtggg tgagcagcga ccccctgggc ctcgcagcct ctcaggccaa cttctacccc      2640
     ccacctccag agtggcttca cgacaaatat gataccaccg gggagaacct tcgcatcccg      2700
     gcagcccagc ccttggagtt tgcccagttc cccttcctgc tgcatggact ccagaagact      2760
     gcagactttg tagaagccat cgaaggggcc agggcggcat gcacagaggc aggccaggca      2820
     ggggtgcatg cctaccccag tggctccccc ttcctcttct gggagcagta tctgggtctt      2880
     cggcgctgct tcctgctggc agtctgcatc ttgctggtgt gcaccttcct cgtctgtgcc      2940
     ctgcttctac tcagcccgtg gacagctggc ctcatagtgc tggtcctggc aatgatgact      3000
     gtggagctct ttggtatcat gggattcctg ggcatcaaac tgagtgccat ccccgtggta      3060
     atcctcgtgg cctctatagg cattggtgtt gaattcacag ttcacgtggc tctgggcttc      3120
     ctgaccagcc atggtagccg gaacctgcgg gctgctagcg ctctggaaca gacctttgcc      3180
     cctgtgactg atggagctgt ctccaccttg ctgggtctgc tcatgcttgc tggttctaac      3240
     tttgacttca tcataaggta tttctttgtg gtgctgacgg tgctgacact cttgggcctg      3300
     ctccatggac tcctgctgct gcctgtgctg ctctctatcc taggcccccc gccacaggtg      3360
     gtgcaggtat acaaggagag tccacagacc ctaaactccg ctgctccaca gagaggtggg      3420
     ctcaggtggg acaggccccc caccctgccc cagagttttg ccagagtgac tacctccatg      3480
     actgtggccc tccacccacc acctctgcct ggagcatacg tccacccagc ctccgaggag      3540
     cccacatag                                                              3549
//