spacer

EBI Dbfetch

ID   AB010088; SV 1; linear; mRNA; STD; MUS; 5825 BP.
XX
AC   AB010088;
XX
DT   30-MAR-1998 (Rel. 55, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus mRNA for secreted isoform of Klotho protein, complete cds.
XX
KW   secreted isoform of Klotho protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5825
RA   Shiraki-Iida T.;
RT   ;
RL   Submitted (29-DEC-1997) to the INSDC.
RL   Takako Shiraki-Iida, Tokyo Research Laboratories, Kyowa Hakko Kogyo Co.
RL   Ltd., Anasawa-Iida group; 3-6-6 Asahimachi, Machidashi 194, Japan
RL   (E-mail:takako.iida@kyowa.co.jp, Tel:0427-25-2555, Fax:0427-26-8330)
XX
RN   [2]
RX   DOI; 10.1016/S0014-5793(98)00127-6.
RX   PUBMED; 9537505.
RA   Shiraki-Iida T., Aizawa H., Matsumura Y., Sekine S., Iida A., Anazawa H.,
RA   Nagai R., Kuro-o M., Nabeshima Y.;
RT   "Structure of the mouse klotho gene and its two transcripts encoding
RT   membrane and secreted protein";
RL   FEBS Lett. 424(1-2):6-10(1998).
XX
RN   [3]
RX   DOI; 10.1038/36285.
RX   PUBMED; 9363890.
RA   Kuro-o M., Matsumura Y., Aizawa H., Kawaguchi H., Suga T., Utsugi T.,
RA   Ohyama Y., Kurabayashi M., Kaname T., Kume E., Iwasaki H., Iida A.,
RA   Shiraki-Iida T., Nishikawa S., Nagai R., Nabeshima Y.;
RT   "Mutation of the mouse klotho gene leads to a syndrome resembling ageing";
RL   Nature 390(6655):45-51(1997).
XX
DR   MD5; f9d72c482922713def69dc1e9ada8c8f.
DR   Ensembl-Gn; ENSMUSG00000058488; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078856; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5825
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   misc_feature    1
FT                   /note="transcription start site"
FT   CDS             14..1666
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="secreted isoform of Klotho protein"
FT                   /db_xref="GOA:O35082"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR028546"
FT                   /db_xref="MGI:MGI:1101771"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35082"
FT                   /protein_id="BAA25307.1"
FT                   /translation="MLARAPPRRPPRLVLLRLLLLHLLLLALRARCLSAEPGQGAQTWA
FT                   RFARAPAPEAAGLLHDTFPDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHHSGAAPS
FT                   DSPIVVAPSGAPSPPLSSTGDVASDSYNNVYRDTEGLRELGVTHYRFSISWARVLPNGT
FT                   AGTPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDTYGGWANRALADHFRDYA
FT                   ELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGVRGSSRLGYLVAHNLLLAHAKVW
FT                   HLYNTSFRPTQGGRVSIALSSHWINPRRMTDYNIRECQKSLDFVLGWFAKPIFIDGDYP
FT                   ESMKNNLSSLLPDFTESEKRLIRGTADFFALSFGPTLSFQLLDPNMKFRQLESPNLRQL
FT                   LSWIDLEYNHPPIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIRLDGVDVIGYT
FT                   AWSLMDGFEWHRGYSIRRGLFYVDFLSQDKELLPKSSALFYQKLIEDNGFPPLPENQPL
FT                   EGTFPCDFAWGVVDNYVQVSPLTKPSVGLLLPH"
FT   polyA_signal    5810..5815
FT   polyA_site      5825
FT                   /note="27 A nucleotides"
XX
SQ   Sequence 5825 BP; 1311 A; 1492 C; 1317 G; 1703 T; 2 other;
     cggctcccgc agcatgctag cccgcgcccc tcctcgccgc ccgccgcggc tggtgctgct        60
     ccgtttgctg ttgctgcatc tgctgctgct cgccctgcgc gcccgctgcc tgagcgctga       120
     gccgggtcag ggcgcgcaga cctgggctcg cttcgcgcgc gctcctgccc cagaggccgc       180
     tggcctcctc cacgacacct tccccgacgg tttcctctgg gcggtaggca gcgccgccta       240
     tcagaccgag ggcggctggc gacagcacgg caaaggcgcg tccatctggg acactttcac       300
     ccatcactct ggggcggccc cgtccgactc cccgatcgtc gtggcgccgt cgggtgcccc       360
     gtcgcctccc ctgtcctcca ctggagatgt ggccagcgat agttacaaca acgtctaccg       420
     cgacacagag gggctgcgcg aactgggggt cacccactac cgcttctcca tatcgtgggc       480
     gcgggtgctc cccaatggca ccgcgggcac tcccaaccgc gaggggctgc gctactaccg       540
     gcggctgctg gagcggctgc gggagctggg cgtgcagccg gtggttaccc tgtaccattg       600
     ggacctgcca cagcgcctgc aggacaccta tggcggatgg gccaatcgcg ccctggccga       660
     ccatttcagg gattatgccg agctctgctt ccgccacttc ggtggtcagg tcaagtactg       720
     gatcaccatt gacaacccct acgtggtggc ctggcacggg tatgccaccg ggcgcctggc       780
     cccgggcgtg aggggcagct ccaggctcgg gtacctggtt gcccacaacc tacttttggc       840
     tcatgccaaa gtctggcatc tctacaacac ctctttccgc cccacacagg gaggccgggt       900
     gtctatcgcc ttaagctccc attggatcaa tcctcgaaga atgactgact ataatatcag       960
     agaatgccag aagtctcttg actttgtgct aggctggttt gccaaaccca tatttattga      1020
     tggcgactac ccagagagta tgaagaacaa cctctcgtct cttctgcctg attttactga      1080
     atctgagaag aggctcatca gaggaactgc tgactttttt gctctctcct tcggaccaac      1140
     cttgagcttt cagctattgg accctaacat gaagttccgc caattggagt ctcccaacct      1200
     gaggcagctt ctgtcttgga tagatctgga atataaccac cctccaatat ttattgtgga      1260
     aaatggctgg tttgtctcgg gaaccaccaa aagggatgat gccaaatata tgtattatct      1320
     caagaagttc ataatggaaa ccttaaaagc aatcagactg gatggggtcg acgtcattgg      1380
     gtacaccgcg tggtcgctca tggacggttt cgagtggcat aggggctaca gcatccggcg      1440
     aggactcttc tacgttgact ttctgagtca ggacaaggag ctgttgccaa agtcttcggc      1500
     cttgttctac caaaagctga tagaggacaa tggctttcct cctttacctg aaaaccagcc      1560
     ccttgaaggg acatttccct gtgactttgc ttggggagtt gttgacaact acgttcaagt      1620
     aagtcctttg acaaaaccca gtgtcggcct cttgcttcct cactaagctc tggccaaggc      1680
     acagtgttgg gacgttgagc caaacagggt tccctagtga gcttatgaac tacatagtcc      1740
     tgaacgcttc agtcttcaaa catctttcaa tctacatctt gtgctctcca ttaggtccaa      1800
     agggaaacag attcaaacca tgaatatgta agctctgtta agacaataca aagataaggc      1860
     acttcccttt ggtgttacgg ctggggtccc tgctcaggaa gttaagtttt tcataaataa      1920
     gattcaacac agaagtccgg agcatctcag ggaagttgct gagaatgtct ggagcattta      1980
     gcagatttct cctcactgta aatgccccac tccaggctca tagaaaaaaa atctcaagaa      2040
     agcaaaccat tgattcaatg atctattgat agcaccaagg cattccaaaa atgatcagtt      2100
     agtatttact gagcatcaaa actgtgtagg aagtcctcaa aaccatttta tttttagttt      2160
     ccccagtgtt aaagtgactt gtttcttgtg gtttgaccaa atactttatg taagcacttg      2220
     ctgactgcca gttgtgtatg aaaccccatg tgggttgctg ggttcccttt gtgaggaaga      2280
     ccaaagttca gtatctgtag tcagatctca aggtttagca tgctggagtc tggctcagtg      2340
     gttctcaacc ttcctaatgc caccgccctt taatacgggt cctcatgttg tagtgacacc      2400
     aaaccatatg attatttttg ttgctacctc ataattgtaa gtttgccacg gctatgtatt      2460
     gtaatgtaaa tatctgtgtt ttctgatggt cttaagcaat cctgtgaaag ggttgtttga      2520
     ccctcaaagg gccgtgaccc acaggttgag aactactgtt gtagtccaga aggaggggct      2580
     acaagttgta gcttcaaaag aaatattcgg aaaaatgctt aggtccaagg ggaggcttct      2640
     tattggaatg gaattttggt tcctgtagat atcgaaatgc tttgttttgt tttgaagtac      2700
     atcgcctatc cttgatgtat ttctgcccct gttgatgtaa gatgtccttt tggctcttag      2760
     actatgtagc tcaatctaga ggtgattttg gacttaagtc ctctccttac cttcaaaaga      2820
     cagctgagca atgttgagtg gagctctatt gaggcctggg atggcaccat agggcttcat      2880
     ggtgttgttt tccagcttgg tgctattgac agctagttga acagtggggt gctggggtct      2940
     actggaagag gtctttagat cacaaagggc atgtcctaaa agagagtagt gggacctcaa      3000
     cccctttctc ttcctttttc tctcatttta tcatgaaaca agcagtttgt catactctgt      3060
     gcccccgact ctggtgtgcc aacttaccac agtcccctaa acagtgaggc ccattgattg      3120
     tttgccggag catccaaagt catgagccca aatcagcctt ggctctgatt ttctcaggtt      3180
     tgctagaact gacaggatgt tagccaatca gctaacatca gcaccatcct gctcagtgtg      3240
     aggttatttt cctgctccat ctccccactt ctctctcaga acaaggctat ctggattgtc      3300
     ctatcctaat tcgtcagagt ctacagtgaa gtttaggtag gctctaatgt ggcagaaatg      3360
     gagatgtcaa aggaggagga agaagataaa tgtgtcccac atcccctccc tccttacctt      3420
     ttttggggcc aggagtagat tagatagctc ctggtctttg ttgtatttcc ttacctcttg      3480
     agagtttcct gctggccaca tccctgcact ggaggctcac acacattgtc tggcatagca      3540
     gctggagtct gccaagtgac ttcgtgtaca gtcagtactc agactcgcat ctgtacagcg      3600
     agacagggct gtgtgggaag gccatcttcc tcccaccctg ctccctaagg atgatttgtg      3660
     tcttcacagc gtgaagtgcc agggttttgg tcgatgttct tgaaagagaa gggcaacccc      3720
     aatcagaatc aaaatcatgg cagtgaatag gaaatgtgag ggtgggggga ggagaagtct      3780
     tgttttgttt ttgattttgt tatctcttca ttttgcagga ccttgtacct gctagtcact      3840
     gttactgagt cacaccatcc aactcttaag gctgtgtcag gatctcatcc gacatcagcg      3900
     atgcaatggc cccagtccct ctctctgtct acattgttga gatcatctac tcagggtgtc      3960
     tgacctgcta catgttcaag gccctctgca tcctctgtga tcccaaccca aatcccaaaa      4020
     tcccatatct caaccctgct gtggttgtaa acgctctgga agctcccggg tgggaacagg      4080
     ctatagttag ggtttacttc tgtctgcctg tgctgctggc tttcctctag gtcatcagag      4140
     ctcctctcaa gacaaccccc tggctgacag catcagaacg cctaatttgt tctctcagtg      4200
     tgagctgggt gtctttgtga caagcagggc tcagcacgtc tacaacatta tgttacgtta      4260
     gtgtctcaag aagtgatttt ttttaacgaa tatttgtatt agttcttggg ggattctata      4320
     gtgaatttgg gtcatattta cttccttcta ttatccccct aacttcttcc agatccattc      4380
     acatcttccc aaaccccaaa cttcacattg tcccccacct tcttcatatg gacatttact      4440
     gtgatttgta ttgcccatgc aatcctggtg ggggaccatc ctctggaatt tggtccacct      4500
     acgaagacct acatccttaa ggaaaattca ctctccctgc cctaaaagcc attatcttga      4560
     gcaggtgctc aagaacccta ttttctttct ctccctcttt ctctttcctc cttccctcct      4620
     tccctccttc tttctttctt tctttctttc tttctttctt tctttctttc tttctttctt      4680
     tctttctttc tttctttctt tcttccttcc ttccttcctt ccttccttcc ttccttcctc      4740
     tctctctttc tctctcttct ctcgccctct ctttctctct cttctctcgc cccctctttc      4800
     tctctcctcc ttttatgtta tcatgctgac tggcttgcct ctgtgtagac aaccccagat      4860
     gctgtgagtt catgagtaca gaggttctat ctctggtact ccccaacctc tgctctgaca      4920
     accttcctgt ccttagatgg tccctgagtt gtgagtttct atgaaaccac tgttcactgc      4980
     accaagaaac tttaagaagt gatttaaaaa aaaaaaccta aagtttctct tttccctcct      5040
     gggtagtgct ccatactcaa gagttgggtc atatatttca cccaaataat taaaaatatc      5100
     cccctaaggc aggtgatggt ggtgcacact ttagtcccag cactcaggag gcagaggcgg      5160
     gtggatcttt gtgagtttga ggcagctggt ctgcagagtg agtatcaaga cagcaggggt      5220
     acacagagaa ccctgtcttg aaaaacaaaa accaaaacaa aacaatgtat gtgtgtgtat      5280
     gggtgtatgt atatgtgtgt atgtgtatac atgtgtgtgt atgtgtgtgt gtgtatctcc      5340
     ctagctacac accacctgtt agaagtttgt agctgggcac atccacatgg gggaggagtc      5400
     actttgctca aacccagtgt cccagcncct gagtttgctt gcncatagct actggtgctg      5460
     ttagttgacc aaaatgaagc aggttacata caacatagag catcatggtt gtccactgct      5520
     gtgaggagag acttttatca ataacaaatt gaatatatgt tttgtgctca acctccctca      5580
     gacctatttt tactttttag tgaaacctaa ggcagcgagc tgctataaat aagttagagg      5640
     aacttttgcc tgcacactca tttctacatt tttcctagtt tggagaactg accctaccat      5700
     ctgcaacttt acatggtctt tcatacttgt ttgtagttag actcaataga aactgttatt      5760
     ctgggatggt tctggtagag aagttgtgaa tttagtacat tcagagttga ataaaaataa      5820
     tccga                                                                  5825
//


spacer
spacer