spacer

EBI Dbfetch

ID   AB009384; SV 1; linear; mRNA; STD; MUS; 1858 BP.
XX
AC   AB009384;
XX
DT   28-APR-1998 (Rel. 55, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mRNA for L-CCR, complete cds.
XX
KW   L-CCR.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1858
RA   Akira S., Shimada T.;
RT   ;
RL   Submitted (02-DEC-1997) to the INSDC.
RL   Shizuo Akira, Hyogo College of Medicine, Department of Biochemistry;
RL   Mukogawa-cho 1-1, Nishinomiya, Hyogo 663-8501, Japan
RL   (E-mail:akira@hyo-med.ac.jp, Tel:+81-798-45-6357, Fax:+81-798-46-3164)
XX
RN   [2]
RX   DOI; 10.1016/S0014-5793(98)00299-3.
RX   PUBMED; 9563519.
RA   Shimada T., Matsumoto M., Tatsumi Y., Kanamaru A., Akira S.;
RT   "A novel lipopolysaccharide inducible C-C chemokine receptor related gene
RT   in murine macrophages";
RL   FEBS Lett. 425(3):490-494(1998).
XX
DR   MD5; 23be00a44f60af804e5b756d7e471f2b.
DR   Ensembl-Gn; ENSMUSG00000043953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111888; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1858
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             269..1351
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="L-CCR"
FT                   /product="L-CCR"
FT                   /db_xref="GOA:O35457"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1920904"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35457"
FT                   /protein_id="BAA25879.1"
FT                   /translation="MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQQVLQFCC
FT                   AVFAVGLLDNVLAVFILVKYKGLKNLGNIYFLNLALSNLCFLLPLPFWAHTAAHGESPG
FT                   NGTCKVLVGLHSSGLYSEVFSNILLLVQGYRVFSQGRLASIFTTVSCGIVACILAWAMA
FT                   TALSLPESVFYEPRMERQKHKCAFGKPHFLPIEAPLWKYVLTSKMIILVLAFPLLVFII
FT                   CCRQLRRRQSFRERQYDLHKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSYH
FT                   LDASVQVTQLVATTHCCVNPLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGYQQAPPR
FT                   EGHGRPIELYSNLHQRQDII"
FT   polyA_site      1858
FT                   /note="19 a nucleotides"
XX
SQ   Sequence 1858 BP; 436 A; 476 C; 432 G; 514 T; 0 other;
     ggaattcggc acgaggcaac actctttgct ttctgacgta ggaatgctca caccagactt        60
     gcatttagca gcgctccttt tctgtccagc tctgtcccca acctccttcc cgactgatac       120
     cactcgcttc caggttctct gcttgtcctc gtgcttgacc agcgcagttt cacttttgca       180
     aacatctgtt tatatccctt gagagaaaaa tatcaagcaa cctgcctcaa acgacgctgt       240
     tttggccggt gagcaaggac agcctccgat ggataactac acagtggccc cggacgatga       300
     atatgatgtc ctaatcttag acgactacct ggacaacagt gggccggacc aagttccggc       360
     ccccgagttc ctctcccccc agcaggtgct gcagttctgc tgcgcggtgt ttgcggtggg       420
     tctcttggac aacgtgctgg cggtgtttat cttggtgaaa tacaaaggac tcaagaatct       480
     ggggaacatc tacttcctaa acctggcact ttcaaacctg tgtttcctgc ttcccctgcc       540
     gttctgggcc catactgcag cacacgggga aagccctggc aacgggacct gtaaagttct       600
     tgtcggactc cactcctcgg gcttatacag cgaggtgttt tccaacatcc tcctccttgt       660
     gcaaggatac agggtgtttt cccaagggcg actggcctcc atcttcacga cagtgtcttg       720
     tggtattgtt gcgtgcatcc tggcatgggc catggctact gcgctctctt tgcccgagtc       780
     tgtgttttat gagcctcgga tggaaagaca gaaacacaag tgtgcctttg gcaaacctca       840
     cttcttgcca atcgaagcgc cgctctggaa gtacgttctg acgtcaaaaa tgatcatctt       900
     ggtacttgct tttcctctgc tggtttttat aatctgctgc aggcaactga ggagaaggca       960
     gagcttcagg gagagacagt acgacctcca caagccggct cttgtcataa cgggcgtgtt      1020
     ccttttgatg tgggcgcctt acaacactgt gcttttcctg tctgctttcc aggaacactt      1080
     gtccctgcag gatgagaaga gcagctacca cctggacgca agtgttcagg tcacacagct      1140
     ggtagcgacc acccactgct gcgtcaaccc gctgctctat ttgcttcttg accggaaggc      1200
     ctttatgaga taccttcgca gcctgttccc acggtgcaat gatatcccct atcaaagtag      1260
     tggaggctat cagcaagcgc ctccaaggga aggtcatggc aggcccattg aactgtacag      1320
     caatttgcat caaaggcagg atataatata atataaacac tcaaccttgt ctcttcacat      1380
     tgttttatgc catttttata tgtttgtata aaaatagaat ataagaggaa agggggctgg      1440
     ttaatgaaca tttactacta agcgttgaat ttgtctctgg cacacggtta agttatttat      1500
     aaaggtgaat tccactcttc ctctttagcg tttgtccgca gtgtgggcgt gggcggtgtg      1560
     cattccataa actgaagctc ggtagttgtc caaagttaca taactataaa gtggcaaaac      1620
     tgatgtgtaa actcagagat cactggcccc agagtctgtg agttatccaa gcgtgccagc      1680
     ctttcagtaa ctgtcagcta gcagtggtgg catgtctgtc atcccagcac tttaggaggc      1740
     ggaggcagga ggcatctcac aaatgcaagt ataacctgac ttcccccaac ctcaattctt      1800
     tttttttgtt attgttgttc atcaaaatac atgcaataaa tatatatatt tttaaagc        1858
//


spacer
spacer