spacer

EBI Dbfetch

ID   AB009369; SV 1; linear; mRNA; STD; MUS; 1302 BP.
XX
AC   AB009369;
XX
DT   09-DEC-1997 (Rel. 53, Created)
DT   09-DEC-1997 (Rel. 53, Last updated, Version 1)
XX
DE   Mus musculus mRNA for G protein-coupled receptor KY411, complete cds.
XX
KW   G protein-coupled receptor KY411.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1302
RA   Yanagihara S., Komura E., Yamaguchi Y.;
RT   ;
RL   Submitted (01-DEC-1997) to the INSDC.
RL   Shigehiro Yanagihara, Kirin Brewery Co.,Ltd., Pharmaceutical Research
RL   Laboratory; 3.Miyahara-cho, Takasaki, Gunma 370-12, Japan
RL   (E-mail:syanagihara@kirin.co.jp, Tel:81-273-46-9826)
XX
RN   [2]
RP   1-1302
RA   Yanagihara S., Komura E., Yamaguchi Y.;
RT   "Mouse G protein-coupled receptor KY411";
RL   Unpublished.
XX
DR   MD5; 9bb78e40457a21e9205b8420ea692be5.
DR   Ensembl-Gn; ENSMUSG00000040899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180103; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1302
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             147..1250
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="G protein-coupled receptor KY411"
FT                   /db_xref="GOA:O54689"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR004067"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333797"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54689"
FT                   /protein_id="BAA23776.1"
FT                   /translation="MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAY
FT                   SLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWV
FT                   FSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAV
FT                   WFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFM
FT                   VFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCS
FT                   TEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLC
FT                   ARVYSESYISRQTSETVENDNASSFTM"
XX
SQ   Sequence 1302 BP; 314 A; 331 C; 320 G; 337 T; 0 other;
     ggctgcgaga agacgacaga agggggagca ctgctggttg tgtctgtcaa cagaatagtc        60
     ctcacattct taggactgga gcctggataa ccactgaggc aggagtacct ggccagtcta       120
     ctttggagct cagcattttc tggggaatga attccacaga gtcctacttt ggaacggatg       180
     attatgacaa cacagagtat tattctattc ctccagacca tgggccatgc tccctagaag       240
     aggtcagaaa cttcaccaag gtatttgtgc caattgccta ctccttaata tgtgtctttg       300
     gcctcctggg caacattatg gtggtgatga cctttgcctt ctacaagaaa gccagatcca       360
     tgactgacgt ctacctgttg aacatggcca tcacagacat actctttgtc ctcaccctac       420
     cgttctgggc agttactcat gccaccaaca cttgggtttt cagcgatgca ctgtgtaaac       480
     tgatgaaagg cacatatgcg gtcaacttta actgtgggat gctgctcctg gcctgtatca       540
     gcatggaccg gtacattgcc atcgtccagg caaccaaatc tttccgggta cgctccagaa       600
     cactgacgca cagtaaggtc atctgtgtgg cagtgtggtt catctccatc atcatctcaa       660
     gccctacatt tatcttcaac aagaaatacg agctgcagga tcgtgatgtc tgtgagccac       720
     ggtacaggtc tgtctcagag cccatcacgt ggaagctgct gggtatggga ctggagctgt       780
     tctttgggtt cttcacccct ttgctgttta tggtgttctg ctatctgttc attatcaaga       840
     ccttggtgca ggcccagaac tccaagaggc acagagccat ccgagtcgtg atcgctgtgg       900
     ttctcgtgtt cctggcttgt cagatccctc acaacatggt cctcctcgtg actgcggtca       960
     acacgggcaa agtgggccgg agctgcagca ccgagaaagt cctcgcctac accaggaacg      1020
     tggccgaggt cctggctttc ctgcattgct gcctcaaccc cgtgttgtat gcgtttattg      1080
     gacagaaatt cagaaactac ttcatgaaga tcatgaagga tgtgtggtgt atgagaagga      1140
     agaataagat gcctggcttc ctctgtgccc gggtttactc ggaaagctac atctccaggc      1200
     agaccagtga gaccgtcgaa aatgataatg catcgtcctt taccatgtaa cacgagagca      1260
     caaagcaaca ttgccccaaa agccttggtg aaacttgcta tt                         1302
//


spacer
spacer