spacer

EBI Dbfetch

ID   AB009020; SV 1; linear; mRNA; STD; MUS; 2031 BP.
XX
AC   AB009020;
XX
DT   26-SEP-2007 (Rel. 93, Created)
DT   26-SEP-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Mus musculus mRNA for i11E7 protein, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2031
RA   Mori K.;
RT   ;
RL   Submitted (20-NOV-1997) to the INSDC.
RL   Kiyoshi Mori, Kyoto University Graduate School of Medicine, Department of
RL   Medicine and Clinical Science; 54 Kawaharacho, Shogoin, Sakyo-ku, Kyoto,
RL   Kyoto 606, Japan (E-mail:keyem@kuhp.kyoto-u.ac.jp, Tel:81-75-751-3173,
RL   Fax:81-75-771-9452)
XX
RN   [2]
RA   Mori K., Ogawa Y., Tashiro K., Ozaki S., Mukoyama M., Tanaka I., Nakao K.;
RT   "Molecular cloning of a novel membrane-bound extracellular matrix-like
RT   protein";
RL   Unpublished.
XX
DR   MD5; c2a388fdc8bf66713227d7cf134fca10.
DR   Ensembl-Gn; ENSMUSG00000030284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032422; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2031
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="8-week-old"
FT                   /clone="i11E7"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             340..1602
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="i11E7 protein"
FT                   /note="contains multiple EGF-like domains"
FT                   /db_xref="GOA:A8C1T7"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR021852"
FT                   /db_xref="MGI:MGI:2152539"
FT                   /db_xref="UniProtKB/TrEMBL:A8C1T7"
FT                   /protein_id="BAF80621.1"
FT                   /translation="MAPLPPRGLVPSLLWCLSLFLSLPGPVWLQPSPPPHPSPRAEPHP
FT                   CHTCRALVDNFNKGLERTIRDNFGGGNTAWEEEKLSKYKDSETRLVEVLEGVCSRSDFE
FT                   CHRLLELSEELVENWWFHRQQEAPDLFQWLCSDSLKLCCPSGTFGPSCLPCPGGTERPC
FT                   GGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNSSHLVCSACFGPCARCT
FT                   GPEESHCLQCKKGWALHHLKCVDIDECGTEQATCGADQFCVNTEGSYECRDCAKACLGC
FT                   MGAGPGRCKKCSRGYQQVGSKCLDVDECETVVCPGENEKCENTEGGYRCVCAEGYRQED
FT                   GICVKEQVPESAGFFAEMTEDEMVVLQQMFFGVIICALATLAAKGDLVFTAIFIGAVAA
FT                   MTGYWLSERSDRVLEGFIKGR"
XX
SQ   Sequence 2031 BP; 394 A; 580 C; 603 G; 454 T; 0 other;
     ctctcggaat atttggggat ccaaccctct ctctaatttt ggcccctaat aactcactga        60
     gaccctaaaa caatgggctg acgcttattc ttttgcccgc gatcccggcc acctccccct       120
     acggtaacgg agaaataatt tctctgctgg aatcgtagat taggctcttt caccccttcc       180
     agcgcctctg cttccactac cccagtttat cctcgttttg taattacgta ggtctggggc       240
     tctgagcccc aaggcgcctc gctttcctcc cttacagcct ggcttctcca gtgaaccctc       300
     cccctgccct ctatctgcac gtccccagcc tgggaaaaga tggctccact gcccccaagg       360
     ggcctggtcc catctctgct ctggtgcttg agcctgtttc tgagcctccc aggacctgtc       420
     tggctccaac cctctcctcc tccccatcct tctccccgag ctgagcccca tccgtgtcat       480
     acctgccggg cactggtgga caacttcaac aagggcctgg agagaaccat ccgggacaac       540
     ttcgggggtg gaaacacggc ctgggaggaa gagaagttgt ccaaatacaa agacagtgag       600
     acccgcctgg tggaggtgct ggagggcgtg tgcagcaggt cagacttcga gtgccaccgc       660
     ctgctcgagc tgagcgagga gctggtggaa aactggtggt ttcacaggca gcaggaagcc       720
     cccgacctct tccagtggct ctgttccgat tccctgaagc tctgctgccc ctctggcacc       780
     tttgggccct cctgcctgcc atgtcctggg ggcacagaga ggccctgcgg tggctacggg       840
     cagtgtgaag gggaagggac tcgagggggc agcgggcact gtgactgcca agccggctat       900
     gggggcgagg cctgtggcca gtgtggcctt ggctactttg aggcggagcg caacagcagc       960
     catctggtat gttcggcgtg ttttggtcct tgtgcccgct gcacgggacc tgaggaatcc      1020
     cattgtctgc agtgcaagaa aggctgggcc ctgcatcacc tcaagtgtgt agacatcgat      1080
     gagtgtggta cagagcaagc cacctgtgga gctgaccagt tctgtgtgaa cacagaagga      1140
     tcctacgagt gccgagactg tgcaaaggcc tgcctgggct gtatgggagc agggccaggg      1200
     cgctgcaaaa agtgcagccg tggctaccag caggtgggct ccaagtgcct agatgtggat      1260
     gagtgtgaga ctgtggtgtg tccaggagag aatgagaagt gtgaaaacac ggagggaggc      1320
     taccgctgtg tctgtgctga gggctacaga caggaggacg gcatctgcgt gaaggagcag      1380
     gtcccggagt cggcgggctt ctttgcggag atgacggagg atgaaatggt ggttctgcag      1440
     cagatgttct ttggtgtaat catctgtgcg ctggccacgc ttgctgccaa gggtgacttg      1500
     gtgttcactg ccatcttcat tggagctgtg gcagccatga ctgggtactg gttgtcagag      1560
     cggagtgacc gtgtgctgga gggcttcatc aagggtagat aatccctgcc gccactcaca      1620
     ggatttcctc ccacccaggc tgctcctaga ggttatttct ctctccctat ggatacctgg      1680
     gacagcatag tttctctttg agactggggt aaacaccctt ttacctgcct tactgagcag      1740
     cccaggaccc cagtggcccc agggggttga aaaagaggtc ctgaagcaga tgccgcgaga      1800
     tcctagccta ggacactggc aggcctcacc gtgtatgaat cccaagacag tttctcccca      1860
     gggaggttgc aggtgggctt tggcccctga cccggatgag aggtgtcccc tcaggggtgg      1920
     gcccccatag gccccttgcc aggtgcatgc tgccagctcc agctgtgtat tcaccgccca      1980
     cgccctagcc atcgacttat ttattcatct caggaaataa aggacggtct t               2031
//


spacer
spacer