spacer

EBI Dbfetch

ID   AB008938; SV 1; linear; mRNA; STD; MUS; 1283 BP.
XX
AC   AB008938;
XX
DT   24-JUN-1998 (Rel. 56, Created)
DT   18-AUG-2007 (Rel. 92, Last updated, Version 3)
XX
DE   Mus musculus mRNA for chondroitin 6-sulfotransferase, partial cds.
XX
KW   chondroitin 6-sulfotransferase.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1283
RA   Uchimura K., Muramatsu T.;
RT   ;
RL   Submitted (19-NOV-1997) to the INSDC.
RL   Kenji Uchimura, Nagoya University, School of Medicine; 65 Tsurumai-Cho,
RL   Showa-Ku, Nagoya, Aichi 466-8550, Japan
RL   (E-mail:g960103d@eds.ecip.nagoya-u.ac.jp, Tel:+81-52-744-2064,
RL   Fax:+81-52-744-2065)
XX
RN   [2]
RX   DOI; 10.1093/glycob/8.5.489.
RX   PUBMED; 9597547.
RA   Uchimura K., Kadomatsu K., Fan Q.-W., Muramatsu H., Kurosawa N., Kaname T.,
RA   Yamamura K., Fukuta M., Habuchi O., Muramatsu T.;
RT   "Mouse chondroitin 6-sulfotransferase: molecular cloning, characterization
RT   and chromosomal mapping";
RL   Glycobiology 8(5):489-496(1998).
XX
DR   MD5; f610cbec7162134b73e614eaa25f91f8.
DR   Ensembl-Gn; ENSMUSG00000057337; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068690; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000135158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167915; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1283
FT                   /organism="Mus musculus"
FT                   /strain="129"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="embryo"
FT                   /clone_lib="lambda gt11"
FT                   /clone="mL1"
FT                   /cell_line="ATDC5"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..775
FT                   /codon_start=2
FT                   /product="chondroitin 6-sulfotransferase"
FT                   /db_xref="GOA:O88199"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR016469"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1858224"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88199"
FT                   /protein_id="BAA29055.1"
FT                   /translation="RGSSRSLCEDPVCTPFVKKVFEKYHCRNRRCGPLNVTLAGEACRR
FT                   KDHVALKAVRIRQLEFLQPLVEDPRLDLRVIQLVRDPRAVLASRIVAFAGKYENWKKWL
FT                   SEGQDQLSEDEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARRPLQKAREM
FT                   YSFAGIPLTPQVEDWIQKNTQATRDSSDVYSTQKNSSEQFEKWRFSMPFKLAQVVQAAC
FT                   GPTMHLFGYKLARDAASLTNRSISLLEERGTFWVT"
XX
SQ   Sequence 1283 BP; 258 A; 366 C; 399 G; 260 T; 0 other;
     ccggggatcc agccgttcac tctgcgagga tccggtgtgc acacccttcg tcaagaaggt        60
     ctttgagaag taccactgca ggaaccgtcg ctgcgggcca ctcaacgtga ccttggcggg       120
     cgaggcctgc cgccgcaagg accacgtggc cctcaaggct gtgcgcatcc gtcagctgga       180
     gttcctgcag ccgctagttg aggacccgag gttggatcta cgagtcattc agctggtgcg       240
     cgacccccgg gccgtgctgg cttcacgcat agtggccttt gcgggcaagt atgagaactg       300
     gaagaagtgg ctgtccgagg ggcaggacca gctgagcgag gatgaggtgc agcgattgcg       360
     gggcaactgt gagagcatcc gcctgtctgc agagctgggc ttgcggcagc cagcctggct       420
     gcgcggtcgt tacatgctgg tgcgctatga ggatgtggca cgcaggccac tgcagaaggc       480
     ccgagagatg tacagctttg cgggcatccc cttgaccccg caggtggagg actggatcca       540
     gaagaacacg caggcgacac gcgacagcag cgatgtctac tccactcaga aaaactcttc       600
     tgagcagttt gagaagtggc gcttcagcat gcctttcaag ctggcacagg tggtacaggc       660
     tgcctgtggc ccgaccatgc acctctttgg ctacaagttg gccagggatg ccgcctcact       720
     caccaaccgc tccatcagcc tgctggagga gcggggcacc ttctgggtca cgtagtgggg       780
     gatgtctggg acccttggaa ctccttcttg tgaaaggctg gccctgcttc cctcacaccc       840
     agcctggcag tgagacatag ccctggcaga aagtcaaaat ggggagcgat gatgggaaca       900
     tagcccctgg ctgtagcggt agggccccct gccagctaga ctccccagag cagctacagc       960
     tagggccttg ggctcctctg aggacaccct gtctccttag tggtactggt cataaggtgt      1020
     cctcacccta tgacctgcag tgtcccgagc aggtcaaggt aggttcctgt gtgtggacac      1080
     acctccctag ctctttctca cacagtctac acgaagcctg taaaggcctg taggttgtgt      1140
     gggctggagt ccaagtattt aacaaccaga aggggtgtag accctctgca gcctctcaga      1200
     cctcctactg tattaagtgt taacctcttc cgctctgagt cagagaagct gggatctggc      1260
     tgagtcctgg gaaggaggag gac                                              1283
//


spacer
spacer