Dbfetch

ID   AB008937; SV 1; linear; mRNA; STD; MUS; 1654 BP.
XX
AC   AB008937;
XX
DT   24-JUN-1998 (Rel. 56, Created)
DT   18-AUG-2007 (Rel. 92, Last updated, Version 5)
XX
DE   Mus musculus C6st mRNA for chondroitin 6-sulfotransferase, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1654
RA   Uchimura K., Muramatsu T.;
RT   ;
RL   Submitted (19-NOV-1997) to the INSDC.
RL   Kenji Uchimura, Nagoya University, School of Medicine; 65 Tsurumai-Cho,
RL   Showa-Ku, Nagoya, Aichi 466-8550, Japan
RL   (E-mail:g960103d@eds.ecip.nagoya-u.ac.jp, Tel:+81-52-744-2064,
RL   Fax:+81-52-744-2065)
XX
RN   [2]
RX   DOI; 10.1093/glycob/8.5.489.
RX   PUBMED; 9597547.
RA   Uchimura K., Kadomatsu K., Fan Q.-W., Muramatsu H., Kurosawa N., Kaname T.,
RA   Yamamura K., Fukuta M., Habuchi O., Muramatsu T.;
RT   "Mouse chondroitin 6-sulfotransferase: molecular cloning, characterization
RT   and chromosomal mapping";
RL   Glycobiology 8(5):489-496(1998).
XX
DR   MD5; 2575f1bc4d07b7ccdfafeed6987c3be5.
DR   Ensembl-Gn; ENSMUSG00000057337; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017266; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017244; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017204; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017204; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017027; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017662; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016598; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016999; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017104; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017098; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017179; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017126; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017700; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016381; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016662; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000068690; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167915; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025317; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0025293; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0025250; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025256; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025066; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025756; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024616; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0025001; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0025117; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0025110; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0025233; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025111; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025800; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024329; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024605; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1654
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /strain="C57BL6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone="mRACE1-mRT1"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             236..1654
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="C6st"
FT                   /product="chondroitin 6-sulfotransferase"
FT                   /function="This enzyme catalyzes the transfer of sulfate
FT                   from 3'-phosphoadenosine 5'-phosphosulfate to position 6 of
FT                   GalNAc residues of chondroitin."
FT                   /db_xref="GOA:O88199"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR016469"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1858224"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88199"
FT                   /protein_id="BAA29054.1"
FT                   /translation="MEKGLALPQDFRDLVHSLKIRGRYVLFLAFVVIVFIFIEKENKII
FT                   SRVSDKLKQIPHFVADANSTDPALLLSENASLLSLSELDSTFSHLRSRLHNLSLQLGVE
FT                   PAMESQEAGAEKPSQQAGAGTRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIE
FT                   RTVFFQQRGASAAGSALVYRDVLKQLLLCDLYVLEPFISPPPEDHLTQFLFRRGSSRSL
FT                   CEDPVCTPFVKKVFEKYHCRNRRCGPLNVTLAGEACRRKDHVALKAVRIRQLEFLQPLV
FT                   EDPRLDLRVIQLVRDPRAVLASRIVAFAGKYENWKKWLSEGQDQLSEDEVQRLRGNCES
FT                   IRLSAELGLRQPAWLRGRYMLVRYEDVARRPLQKAREMYSFAGIPLTPQVEDWIQKNTQ
FT                   ATRDSSDVYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPTMHLFGYKLARDAASLTNR
FT                   SISLLEERGTFWVT"
XX
SQ   Sequence 1654 BP; 328 A; 493 C; 485 G; 348 T; 0 other;
     aggaaccccg gctccctgct tcctactggg tgacacagag ggatcagccc tctggcctca        60
     caactttccc acagcagcca gatcttccct ctgcctgtgg agccccgtgg agccgcgttt       120
     tttctacttg gaaagctgta tatacaggat cagactgtcc cccacctgaa gagggctgat       180
     tgggtcccaa gctatgctcc tgagctgagt gcctgcagcc agtctgagga actccatgga       240
     gaaaggactc gctttgcctc aggatttccg ggaccttgta cacagcctaa agattcgagg       300
     cagatacgtc ttgttcctgg catttgtggt catagttttt atcttcattg aaaaggaaaa       360
     taaaatcata tccagggtct ccgacaagct gaagcagatc cctcattttg tggcagatgc       420
     caacagcact gacccagccc tgctcttatc ggagaatgca tctctcttgt ccctgagcga       480
     gttggattcc accttttccc atctgcggag ccgcctgcac aacctgagcc tgcagctggg       540
     cgtggagcca gcaatggaga gccaggaggc tggggcagag aagccatccc agcaggctgg       600
     agcagggacc cggcgccacg tgcttctcat ggccaccacc cgcacgggtt cctcgttcgt       660
     gggcgagttc ttcaaccagc agggcaatat cttctacctc ttcgagccac tgtggcacat       720
     cgagcgcacc gtgttcttcc agcagcgagg cgccagcgcg gctggttcag ccttggtcta       780
     ccgtgatgtc ctcaagcagt tgttgctatg cgacctgtat gtgctggagc ccttcatcag       840
     ccctccgccc gaggaccact tgactcagtt cctgttccgc cggggatcca gccgttcact       900
     ctgcgaggat ccggtgtgca cacccttcgt caagaaggtc tttgagaagt accactgcag       960
     gaaccgtcgc tgcgggccac tcaacgtgac cttggcgggc gaggcctgcc gccgcaagga      1020
     ccacgtggcc ctcaaggctg tgcgcatccg tcagctggag ttcctgcagc cgctagttga      1080
     ggacccgagg ttggatctac gagtcattca gctggtgcgc gacccccggg ccgtgctggc      1140
     ttcacgcata gtggcctttg cgggcaagta tgagaactgg aagaagtggc tgtccgaggg      1200
     gcaggaccag ctgagcgagg atgaggtgca gcgattgcgg ggcaactgtg agagcatccg      1260
     cctgtctgca gagctgggct tgcggcagcc agcctggctg cgcggtcgtt acatgctggt      1320
     gcgctatgag gatgtggcac gcaggccact gcagaaggcc cgagagatgt acagctttgc      1380
     gggcatcccc ttgaccccgc aggtggagga ctggatccag aagaacacgc aggcgacacg      1440
     cgacagcagc gatgtctact ccactcagaa aaactcttct gagcagtttg agaagtggcg      1500
     cttcagcatg cctttcaagc tggcacaggt ggtacaggct gcctgtggcc cgaccatgca      1560
     cctctttggc tacaagttgg ccagggatgc cgcctcactc accaaccgct ccatcagcct      1620
     gctggaggag cggggcacct tctgggtcac gtag                                  1654
//