spacer

EBI Dbfetch

ID   AB007848; SV 1; linear; mRNA; STD; MUS; 1756 BP.
XX
AC   AB007848;
XX
DT   14-OCT-1997 (Rel. 52, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for osteomodulin, complete cds.
XX
KW   osteomodulin.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1756
RA   Ohno I., Matsubara K., Okubo K.;
RT   ;
RL   Submitted (04-OCT-1997) to the INSDC.
RL   Ikko Ohno, Institute for Molecular and Cellular Biology, Osaka University,
RL   Molecular Genetics; 1-3 Yamada-oka, Suita, Osaka 565, Japan
RL   (E-mail:kousaku@imcb.osaka-u.ac.jp, Tel:81-6-879-7992, Fax:81-6-877-1922)
XX
RN   [2]
RP   1-1756
RA   Ohno I., Matsubara K., Okubo K.;
RT   "The cloning and characterization of a cDNA for the novel bone matrix
RT   protein; osteomodulin";
RL   Unpublished.
XX
DR   MD5; be03d11537a55cd2cf6222bdf1a4264a.
DR   Ensembl-Gn; ENSMUSG00000048368; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000065494; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1756
FT                   /organism="Mus musculus"
FT                   /strain="C57BL"
FT                   /mol_type="mRNA"
FT                   /clone="GS3603"
FT                   /cell_line="MC3T3-E1"
FT                   /cell_type="osteoblastic"
FT                   /db_xref="taxon:10090"
FT   CDS             263..1534
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="osteomodulin"
FT                   /db_xref="GOA:O35103"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="MGI:MGI:1350918"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35103"
FT                   /protein_id="BAA22790.1"
FT                   /translation="MGFLSPIYVLFFCFGVRVYCQYEAYRWDDDYDQEPNEDYDPEFQF
FT                   HQNIEYGVPFYNNILGCAKECFCPTNFPTSMYCDNRKLKTIPIIPMHIQQLNLQFNDIE
FT                   AVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLSNLQQLHLEHNNLEEFPFPLPKS
FT                   LERLLLGYNEISILPTNAMDGLVNVTMLDLCYNHLSDSMLKEKTLSKMEKLMQLNLCNN
FT                   RLESMPLGLPSSLMYLSLENNSISSIPDNYFDKLPKLHALRISHNKLEDIPYDIFNLSN
FT                   LIELNVGHNKLKQAFYIPRNLEHLYLQNNEIESINVTMICPSPDPVHHHHLTYLRVDQN
FT                   KLKEPISSYIFFCFPRIHSIYYGEQRSTNGETIQLKTQVFRSYQEEEEEDDHDSQDNTL
FT                   EGQEVSDEHYNSHYYEMQEWQDTI"
FT   polyA_site      1756
FT                   /note="20 A nucleotides"
XX
SQ   Sequence 1756 BP; 609 A; 349 C; 290 G; 508 T; 0 other;
     gcacgaggca tttctgattc agttaaagga ttgccaattc atcagtccct gaaactagag        60
     caatctcaac aggtttattt atttattata tgtaatacac tgtagctgtc ttcagacact       120
     ccagaagagg gagtcagatc tcgttacgga tggttgtgag ccaccatgtg gttgctggga       180
     tttgaactcc tgaccttcgg aagagcagtc gggtgctctt acacactgag ccatctcacc       240
     agcccgagga caagaaaaga aaatgggctt tttaagtcca atatatgtcc ttttcttctg       300
     ttttggagtt agagtatact gccaatatga agcttaccga tgggatgacg attatgacca       360
     agagccaaat gaggattatg atccagaatt ccaatttcat caaaatattg aatatggagt       420
     tcccttttat aataatattt taggttgtgc taaggaatgc ttctgtccaa ctaactttcc       480
     aacatcaatg tactgtgaca atcgtaaact caagactatc ccaattattc caatgcacat       540
     tcagcaactc aaccttcagt tcaatgacat tgaggctgtg actgcaaatt cattcatcaa       600
     tgcaactcat cttaaagaaa ttaaccttag ccacaacaaa attaaatctc aaaagattga       660
     ttatggtgta ttcgctaaac tttcaaatct acaacaactt catctagagc acaataacct       720
     agaagaattt ccatttccac ttccaaaatc tttggaaaga ctccttcttg gttataatga       780
     aatctccata cttccaacaa atgccatgga cgggctggtg aatgtgacta tgcttgacct       840
     ctgctataat catctttctg attcgatgtt aaaagaaaag accctttcca aaatggaaaa       900
     attaatgcag ctcaacctat gtaataacag attagaatca atgccccttg gattgccttc       960
     atcacttatg tatctatctt tagaaaataa ttcaatttca tctataccag acaattattt      1020
     tgacaaactt ccaaaacttc atgctctaag aatatcacac aacaaactgg aagacattcc      1080
     atatgacatc tttaatcttt ccaatcttat agaactcaac gttggacaca ataaattgaa      1140
     gcaagcattc tacattccaa ggaatttgga acatctatac ctacaaaata atgaaataga      1200
     aagcatcaat gtgacaatga tatgtccttc tcctgatcca gtacaccatc accatttaac      1260
     ataccttcgt gtggaccaaa ataagctgaa agaaccaata agttcataca tcttcttctg      1320
     cttccctcgt atacacagta tttattatgg tgagcagagg agtactaacg gtgaaacaat      1380
     tcaactgaag acccaagttt tcaggagcta ccaagaggag gaagaggaag acgaccatga      1440
     cagtcaggac aacactcttg agggtcaaga agtatcagat gagcactata attctcatta      1500
     ctatgagatg caagagtggc aagatactat ataggtacac atttatgcct ccataaagcc      1560
     ttactaatta caaatgtaaa catgtaactg ctcataataa tatatctaca agtatgtgtt      1620
     agtataaaga tcagaactgc gtttaagatg ttggtgaaaa tggctttact tcataagctt      1680
     agagcttact aaaaatgatg caaatcttaa gaaatataaa atagaatggt aagtgggaat      1740
     aaaaaaaact aagctc                                                      1756
//


spacer
spacer