Dbfetch

ID   AB005451; SV 1; linear; mRNA; STD; MUS; 1779 BP.
XX
AC   AB005451;
XX
DT   11-DEC-1997 (Rel. 53, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for RST, complete cds.
XX
KW   renal-specific transporter; RST.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1779
RA   Mori K.;
RT   ;
RL   Submitted (29-JUN-1997) to the INSDC.
RL   Kiyoshi Mori, Kyoto University Graduate School of Medicine, Department of
RL   Medicine and Clinical Science; 54 Shogoin Kawahara-cho, Sakyo-ku, Kyoto,
RL   Kyoto 606, Japan (Tel:075-751-3173, Fax:075-771-9452)
XX
RN   [2]
RX   DOI; 10.1016/S0014-5793(97)01325-2.
RX   PUBMED; 9409754.
RA   Mori K., Ogawa Y., Ebihara K., Aoki T., Tamura N., Sugawara A.,
RA   Kuwahara T., Ozaki S., Mukoyama M., Tashiro K., Tanaka I., Nakao K.;
RT   "Kidney-specific expression of a novel mouse organic cation
RT   transporter-like protein";
RL   FEBS Lett. 417(3):371-374(1997).
XX
DR   MD5; 10bcc476ae9071bb884d717be47d626a.
DR   EuropePMC; PMC24812; 10611377.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1779
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="8-week-old"
FT                   /clone="K14D2"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             100..1761
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="RST"
FT                   /db_xref="GOA:Q8CFZ5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1195269"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CFZ5"
FT                   /protein_id="BAA23875.1"
FT                   /translation="MAFPELLDRVGGLGRFQLFQTVALVTPILWVTTQNMLENFSAAVP
FT                   HHRCWVPLLDNSTSQASIPGDLGPDVLLAVSIPPGPDQQPHQCLRFRQPQWQLTESNAT
FT                   ATNWSDAATEPCEDGWVYDHSTFRSTIVTTWDLVCNSQALRPMAQSIFLAGILVGAAVC
FT                   GHASDRFGRRRVLTWSYLLVSVSGTAAAFMPTFPLYCLFRFLLASAVAGVMMNTASLLM
FT                   EWTSAQGSPLVMTLNALGFSFGQVLTGSVAYGVRSWRMLQLAVSAPFFLFFVYSWWLPE
FT                   SARWLITVGKLDQGLQELQRVAAVNRRKAEGDTLTMEVLRSAMEEEPSRDKAGASLGTL
FT                   LHTPGLRHRTIISMLCWFAFGFTFYGLALDLQALGSNIFLLQALIGIVDFPVKTGSLLL
FT                   ISRLGRRLCQVSFLVLPGLCILSNILVPHGMGVLRSALAVLGLGCLGGAFTCITIFSSE
FT                   LFPTVIRMTAVGLCQVAARGGAMLGPLVRLLGVYGSWMPLLVYGVVPVLSGLAALLLPE
FT                   TKNLPLPDTIQDIQKQSVKKVTHDTPDGSILMSTRL"
XX
SQ   Sequence 1779 BP; 328 A; 541 C; 517 G; 393 T; 0 other;
     gtcagagcca aggggaaagc aggctcatca caaagacccc atggtcctgg gccagcctct        60
     gtgaagtgga agctgcgtgg tggtacccag gagaaaccca tggcctttcc tgaactcctg       120
     gaccgagtgg gggggctggg caggttccag ctcttccaga cggtggctct ggtgaccccc       180
     attttgtggg tcaccaccca gaacatgctg gagaacttct cagccgcagt tccccaccac       240
     cgctgttggg tgcctctcct ggacaatagc acctcccagg cgagtatccc tggggacctt       300
     ggacccgatg ttcttctggc cgtctccatc ccacctggtc ctgaccagca accccaccag       360
     tgcctccgct tccgacaacc tcaatggcag cttacagagt ccaacgccac ggccaccaac       420
     tggagtgacg ctgccactga gccatgcgag gatggctggg tttacgacca cagcaccttc       480
     aggtccacaa tcgtgaccac gtgggacctg gtatgtaact cccaggctct gagacccatg       540
     gcccagtcca tcttcctggc tggaatcctg gtaggagccg cagtgtgtgg ccatgcctca       600
     gataggtttg ggcgcagaag ggtgctgacc tggagctatc ttctggtgtc cgtgtccggc       660
     acagcagctg ccttcatgcc caccttcccc ctctactgcc tgtttcgttt cctgctggcc       720
     tctgcagtgg caggtgtcat gatgaacaca gccagtctct tgatggagtg gacatcagcc       780
     cagggtagcc ctttggtgat gaccttgaac gccttgggct tcagctttgg gcaggtcctg       840
     acaggttctg tggcctatgg tgtgcgcagc tggaggatgc tacagctggc tgtctctgcc       900
     cccttcttcc tcttctttgt ttattcatgg tggctaccag aatcggcacg ctggctcatc       960
     acggtaggca agctggacca gggcctgcag gaactacaga gggtagctgc tgtcaacagg      1020
     aggaaggcag agggagacac gttgaccatg gaggtgctgc ggtcagctat ggaggaggaa      1080
     ccaagcaggg acaaagctgg tgccagtctg ggcactctac tccacacacc tgggctgcgc      1140
     caccgaacca tcatctccat gctgtgctgg tttgcctttg gcttcacctt ctacggcctg      1200
     gcccttgacc tgcaagccct aggaagcaat atcttcctgc tccaggcact catcgggatt      1260
     gtggacttcc cggtgaagac aggcagcctg ctgctgatca gccgcttggg ccggcgcctc      1320
     tgccaggtca gcttcctggt gctccccgga ctctgcatcc tgtccaacat actggtgccc      1380
     catgggatgg gggtccttcg ctcggccctg gctgtgctgg ggctgggctg cctggggggc      1440
     gccttcacct gcatcaccat cttctccagt gagctcttcc ccactgtgat caggatgact      1500
     gcagtgggcc tctgccaggt ggcagcccga gggggagcca tgctagggcc tttggtacgg      1560
     ctgctgggtg tctatggctc ctggatgccc ctgctggtgt atggagtggt gccagtgtta      1620
     agtggcctag ctgcactgct gctgcctgag accaagaact taccactgcc tgacaccatc      1680
     caagacatcc agaaacagtc agtgaagaag gtaacacatg acacaccaga tggctccatc      1740
     ctgatgtcta cccggctgta gttgcctgga gaaggaaca                             1779
//