spacer

EBI Dbfetch

ID   AB005141; SV 1; linear; mRNA; STD; MUS; 5032 BP.
XX
AC   AB005141;
XX
DT   14-NOV-1997 (Rel. 53, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus klotho mRNA, complete cds.
XX
KW   Klotho.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5032
RA   Kuro-o M.;
RT   ;
RL   Submitted (24-JUN-1997) to the INSDC.
RL   Makoto Kuro-o, National Institute of Neuroscience, NCNP, Division of
RL   Molecular Genetics; 4-1-1 Ogawahigashi, Kodaira, Tokyo 187, Japan
RL   (E-mail:kuroo@ncnaxp.ncnp.go.jp, Tel:+81-423-46-3864, Fax:+81-423-46-3864)
XX
RN   [2]
RX   DOI; 10.1038/36285.
RX   PUBMED; 9363890.
RA   Kuro-o M., Matsumura Y., Aizawa H., Kawaguchi H., Suga T., Utsugi T.,
RA   Ohyama Y., Kurabayashi M., Kaname T., Kume E., Iwasaki H., Iida A.,
RA   Shiraki-Iida T., Nishikawa S., Nagai R., Nabeshima Y.;
RT   "Mutation of the mouse klotho gene leads to a syndrome resembling ageing";
RL   Nature 390(6655):45-51(1997).
XX
DR   MD5; cf01518dd02dd99234fe61b4168736b0.
DR   Ensembl-Gn; ENSMUSG00000058488; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078856; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5032
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="kidney"
FT                   /db_xref="taxon:10090"
FT   CDS             19..3063
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="klotho"
FT                   /function="involved in regulation of ageing"
FT                   /db_xref="GOA:O35082"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR028546"
FT                   /db_xref="MGI:MGI:1101771"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35082"
FT                   /protein_id="BAA23381.1"
FT                   /translation="MLARAPPRRPPRLVLLRLLLLHLLLLALRARCLSAEPGQGAQTWA
FT                   RFARAPAPEAAGLLHDTFPDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHHSGAAPS
FT                   DSPIVVAPSGAPSPPLSSTGDVASDSYNNVYRDTEGLRELGVTHYRFSISWARVLPNGT
FT                   AGTPNREGLRYYRRLLERLRELGVQPVVTLYHWDLPQRLQDTYGGWANRALADHFRDYA
FT                   ELCFRHFGGQVKYWITIDNPYVVAWHGYATGRLAPGVRGSSRLGYLVAHNLLLAHAKVW
FT                   HLYNTSFRPTQGGRVSIALSSHWINPRRMTDYNIRECQKSLDFVLGWFAKPIFIDGDYP
FT                   ESMKNNLSSLLPDFTESEKRLIRGTADFFALSFGPTLSFQLLDPNMKFRQLESPNLRQL
FT                   LSWIDLEYNHPPIFIVENGWFVSGTTKRDDAKYMYYLKKFIMETLKAIRLDGVDVIGYT
FT                   AWSLMDGFEWHRGYSIRRGLFYVDFLSQDKELLPKSSALFYQKLIEDNGFPPLPENQPL
FT                   EGTFPCDFAWGVVDNYVQVDTTLSQFTDPNVYLWDVHHSKRLIKVDGVVAKKRKPYCVD
FT                   FSAIRPQITLLREMRVTHFRFSLDWALILPLGNQTQVNHTVLHFYRCMISELVHANITP
FT                   VVALWQPAAPHQGLPHALAKHGAWENPHTALAFADYANLCFKELGHWVNLWITMNEPNT
FT                   RNMTYRAGHHLLRAHALAWHLYDDKFRAAQKGKISIALQADWIEPACPFSQNDKEVAER
FT                   VLEFDIGWLAEPIFGSGDYPRVMRDWLNQKNNFLLPYFTEDEKKLVRGSFDFLAVSHYT
FT                   TILVDWEKEDPMKYNDYLEVQEMTDITWLNSPSQVAVVPWGLRKVLNWLRFKYGDLPMY
FT                   VTANGIDDDPHAEQDSLRIYYIKNYVNEALKAYVLDDINLCGYFAYSLSDRSAPKSGFY
FT                   RYAANQFEPKPSMKHYRRIIDSNGFLGSGTLGRFCPEEYTVCTECGFFQTRKSLLVFIS
FT                   FLVFTFIISLALIFHYSKKGQRSYK"
XX
SQ   Sequence 5032 BP; 1197 A; 1274 C; 1185 G; 1376 T; 0 other;
     cctcccggct cccgcagcat gctagcccgc gcccctcctc gccgcccgcc gcggctggtg        60
     ctgctccgtt tgctgttgct gcatctgctg ctgctcgccc tgcgcgcccg ctgcctgagc       120
     gctgagccgg gtcagggcgc gcagacctgg gctcgcttcg cgcgcgctcc tgccccagag       180
     gccgctggcc tcctccacga caccttcccc gacggtttcc tctgggcggt aggcagcgcc       240
     gcctatcaga ccgagggcgg ctggcgacag cacggcaaag gcgcgtccat ctgggacact       300
     ttcacccatc actctggggc ggccccgtcc gactccccga tcgtcgtggc gccgtcgggt       360
     gccccgtcgc ctcccctgtc ctccactgga gatgtggcca gcgatagtta caacaacgtc       420
     taccgcgaca cagaggggct gcgcgaactg ggggtcaccc actaccgctt ctccatatcg       480
     tgggcgcggg tgctccccaa tggcaccgcg ggcactccca accgcgaggg gctgcgctac       540
     taccggcggc tgctggagcg gctgcgggag ctgggcgtgc agccggtggt taccctgtac       600
     cattgggacc tgccacagcg cctgcaggac acctatggcg gatgggccaa tcgcgccctg       660
     gccgaccatt tcagggatta tgccgagctc tgcttccgcc acttcggtgg tcaggtcaag       720
     tactggatca ccattgacaa cccctacgtg gtggcctggc acgggtatgc caccgggcgc       780
     ctggccccgg gcgtgagggg cagctccagg ctcgggtacc tggttgccca caacctactt       840
     ttggctcatg ccaaagtctg gcatctctac aacacctctt tccgccccac acagggaggc       900
     cgggtgtcta tcgccttaag ctcccattgg atcaatcctc gaagaatgac tgactataat       960
     atcagagaat gccagaagtc tcttgacttt gtgctaggct ggtttgccaa acccatattt      1020
     attgatggcg actacccaga gagtatgaag aacaacctct cgtctcttct gcctgatttt      1080
     actgaatctg agaagaggct catcagagga actgctgact tttttgctct ctccttcgga      1140
     ccaaccttga gctttcagct attggaccct aacatgaagt tccgccaatt ggagtctccc      1200
     aacctgaggc agcttctgtc ttggatagat ctggaatata accaccctcc aatatttatt      1260
     gtggaaaatg gctggtttgt ctcgggaacc accaaaaggg atgatgccaa atatatgtat      1320
     tatctcaaga agttcataat ggaaacctta aaagcaatca gactggatgg ggtcgacgtc      1380
     attgggtaca ccgcgtggtc gctcatggac ggtttcgagt ggcatagggg ctacagcatc      1440
     cggcgaggac tcttctacgt tgactttctg agtcaggaca aggagctgtt gccaaagtct      1500
     tcggccttgt tctaccaaaa gctgatagag gacaatggct ttcctccttt acctgaaaac      1560
     cagccccttg aagggacatt tccctgtgac tttgcttggg gagttgttga caactacgtt      1620
     caagtggaca ctactctctc tcagtttact gacccgaatg tctatctgtg ggatgtgcat      1680
     cacagtaaga ggcttattaa agtagacggg gttgtagcca agaagagaaa accttactgt      1740
     gttgatttct ctgccatccg gcctcagata accttacttc gagaaatgcg ggtcacccac      1800
     tttcgcttct ccctggactg ggccctgatc ttgcctctgg gtaaccagac ccaagtgaac      1860
     cacacggttc tgcacttcta ccgctgcatg atcagcgagc tggtgcacgc caacatcact      1920
     ccagtggtgg ccctgtggca gccagcagcc ccgcaccaag gcctgccaca tgcccttgca      1980
     aaacatgggg cctgggagaa cccgcacact gctctggcgt ttgcagacta cgcaaacctg      2040
     tgttttaaag agttgggtca ctgggtcaat ctctggatca ccatgaacga gccaaacaca      2100
     cggaacatga cctatcgtgc cgggcaccac ctcctgagag cccatgcctt ggcttggcat      2160
     ctgtacgatg acaagtttag ggcggctcag aaaggcaaaa tatccatcgc cttgcaggct      2220
     gactggatag aaccggcctg ccctttctct caaaatgaca aagaagtggc cgagagagtt      2280
     ttggaatttg atataggctg gctggcagag cctatttttg gttccggaga ttatccacgt      2340
     gtgatgaggg actggctgaa ccaaaaaaac aattttcttt tgccctattt caccgaagat      2400
     gaaaaaaagc tagtccgggg ttcctttgac ttcctggcgg tgagtcatta caccaccatt      2460
     ctggtagact gggaaaagga ggatccgatg aaatacaacg attacttgga ggtacaggag      2520
     atgactgaca tcacatggct caactctccc agtcaggtgg cagtggtgcc ttgggggctg      2580
     cgcaaagtgc tcaactggct aaggttcaag tacggagacc tcccgatgta tgtgacagcc      2640
     aatggaatcg atgatgaccc ccacgccgag caagactcac tgaggatcta ttatattaag      2700
     aattatgtga atgaggctct gaaagcctac gtgttggacg acatcaacct ttgtggctac      2760
     tttgcgtatt cacttagtga tcgctcagct cccaagtctg gcttttatcg atatgctgcg      2820
     aatcagtttg agcccaaacc atctatgaaa cattacagga gaattattga cagcaatggc      2880
     ttcctgggtt ctggaacact gggaaggttt tgtccagaag aatacactgt gtgcaccgaa      2940
     tgtggatttt ttcaaacccg gaagtctttg ctggtcttca tctcgtttct tgtttttact      3000
     tttattattt ctcttgctct catttttcac tactccaaga aaggccagag aagttataag      3060
     taatgtgaac gtctgcctgg ccattcgctt tgggatcaag atgtacacgc cgtcagccgt      3120
     ttgcacctct ctgtgttgtg agccgcattc cacacatttc gattctagaa aacccttttt      3180
     gtcatgggtg gtagaggttt taaacaggaa ttggtgagaa taaaatattg cagggtgaat      3240
     ggtatctgaa tctgctctct ttggtggcaa ttacggaatt atactcacca cagtttctac      3300
     agtgccccgg aatggaaggc atagaatacg gtagggataa cagtgccaag cagacagaag      3360
     tttaaagaac aactttaggg acttgtttat ccatggccat ttttaaattc actcctgttg      3420
     gggagtaaca ctctctcaat taccatctta acacctggac tttacctgat ccagttttac      3480
     aaggtgaagt agaaaaatat ccagtaaagg tggccaagag ccctgagtcc agagcagccc      3540
     attaagaagc actattccta ccaaatgctg ctaatgtcaa tttacaaata tacttagaaa      3600
     gcacattatg gacatttgta ttcttgtgaa tgtttttgag gtgtgcccta aaccccagat      3660
     ccttgagggc tttctcttac caactttcct ttcagagcct gcttgttgga gattcttccc      3720
     cagccccctt cccctttccc tcttgctctg ccccacctcg ctccacccag cttgctccag      3780
     cccaaagatt ctttatttgt ttctcattac cgaaggttgt gagccaccat gtggtttctg      3840
     ggatttgaac tcatgacctc cggaggagct gtcatgctct taaccagccc atgttgaaga      3900
     ttcttttgat aaatattcac aaaaaataaa gatgagccat gagctgttgg cctcttcgga      3960
     agcggaaact gagtgatttg attgaacatc cttttatctt tgaccagacc ttggaatgaa      4020
     tgcaatgacc tttcccacag gaagaaggag gagctctcag tcaaactgta aagaatgcct      4080
     cttcagaata tgctgtcagt gcttggatgc catgatgttc aactttctta gtcgatccgg      4140
     cagcaatcac agtgtgagca cactgggaac ctgtccttgc ggccgccgag atctaccgtg      4200
     tgcttctgtg aagaggcttt gacgtagccc ctctttgagc tcttacacca tgctactgac      4260
     ttctagaaag gctaattagg tcttcttcta cacctaatac cctaagtctt actgactctc      4320
     acgggagaag tctctgtgct acacctgagt ggtcttattg ataaccctga taccagatca      4380
     ggcaagataa atccgtcata gcaggcatgg ctacccttgc tgccacaggg tcacagcaca      4440
     tagctcatca ccctgttatt cttcatcttg caatgtggta tggttttcct ggtgaatgat      4500
     cagcttttgc tgtggtattc tttatacatc tggacttatt attgaaatca aatgctatag      4560
     aatcaatagt ttattttatg tctatttttc ttgatcgcag agtaatatat attaattgta      4620
     aaaaatttaa gaaacaaaaa ctatatgtaa agaaaaaatt ataatataat acagagatgc      4680
     tgctgacagt tcctatgtgt tgtgttttgt atactgagat catgtgatac gtaggcatac      4740
     atcttcttgg gtttttttgt ttttgttttt tgttttgttt tgttttgttt tggttttttg      4800
     agatagggtt tctctgtata gccctggctg tcctggaact cactttgcag accaggctag      4860
     cctcaaactc ttattcattt ttactgaagt aatttttctg tcattagtct tcaagagcaa      4920
     aactttaata gttatggaga atattgccag aacagctcaa aactgtttta tttgttggtc      4980
     caatttccca ttaattagtt caataataaa tatcatttag aaataaaaaa aa              5032
//


spacer
spacer