spacer

EBI Dbfetch

ID   AB004786; SV 1; linear; mRNA; STD; MUS; 1589 BP.
XX
AC   AB004786;
XX
DT   21-APR-2000 (Rel. 63, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mbgt-5 mRNA for beta-1,4-galactosyltransferase V, complete
DE   cds.
XX
KW   beta-1,4-galactosyltransferase V; mbgt-5.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1589
RA   Yamakawa N., Nakamura N.;
RT   ;
RL   Submitted (10-JUN-1997) to the INSDC.
RL   Naomi Yamakawa, Tokyo Metropolitan Institute of Gerontology, Department of
RL   Biosignal Research; 35-2 Sakae-cho, Itabashi-ku, Tokyo 173-0015, Japan
RL   (E-mail:nao@tmig.or.jp, URL:http://www.tmig.or.jp/,
RL   Tel:81-3-3964-3241(ex.3070), Fax:81-3-3579-4776)
XX
RN   [2]
RP   1-1589
RA   Yamakawa N., Nakamura N.;
RT   "Molecular cloning of mouse beta-1,4-galactosyltransferase V";
RL   Unpublished.
XX
DR   MD5; 7718899619ce19723dfb23cc935bb0ad.
DR   Ensembl-Gn; ENSMUSG00000017929; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109221; mus_musculus.
XX
CC   Sequence updated (07-Jul-1999)
CC   Sequence updated (21-Jan-2000)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1589
FT                   /organism="Mus musculus"
FT                   /strain="Balb/c"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="14-day old"
FT                   /tissue_type="whole brain"
FT                   /db_xref="taxon:10090"
FT   CDS             148..1314
FT                   /codon_start=1
FT                   /gene="mbgt-5"
FT                   /product="beta-1,4-galactosyltransferase V"
FT                   /db_xref="GOA:Q9JMK0"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR027995"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1927169"
FT                   /protein_id="BAA94791.1"
FT                   /translation="MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFM
FT                   VQAQGILLRDNVRTIGAQVYEQVVRSAYAKRNSSLNDSDYPLDLNHSEAFPPTTTFLPE
FT                   DFTYFANHPCPERLPSMKGPIDINMSEIAMDDIHELFSRDPAIKLGGHWKPADCVPRWK
FT                   VAILIPFRNRHEHLPVLLRHLLPMLQRQALQFAFYVIEQVGTQPFNRAMLFNVGFQEAM
FT                   KDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVE
FT                   QFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGR
FT                   YALLRKSKERQGLDGLNNLNYSANVTYDALYKNITVNLTPELAQVTEY"
XX
SQ   Sequence 1589 BP; 343 A; 483 C; 449 G; 314 T; 0 other;
     gcctcatgtg gcccggcccg cggcggccgc ggctgaaacc gcgaggcggc ggcgcgcgaa        60
     cccggaaggc ggcggccgag gcccaggcgg cggaccggag cggcgggacg gggcccgggt       120
     tggccctcga gcggccgccg gctcagcatg cgcgcccgcc gggggctgct gcggctgccg       180
     cgccgctcgc tgctcgccgc gctcttcttc ttctcgctgt cgtcctcgct gctctacttc       240
     gtctatgtgg cgcccggcat agtgaacacc tacctcttca tggtgcaggc tcagggcatc       300
     ctactgcggg acaatgtgag gaccatcggt gcccaggtgt acgagcaggt ggtccgcagc       360
     gcctatgcca agaggaacag cagcctgaat gactcagatt atcctctgga cttgaaccac       420
     agtgaagcct ttcccccaac cacgaccttt cttcctgaag atttcaccta ctttgccaac       480
     cacccttgcc cagagaggct cccttccatg aagggcccga tagatataaa catgagtgag       540
     atcgcaatgg acgatattca tgagctgttc tccagagacc cggccattaa gctcggaggg       600
     cactggaagc ctgcagactg tgtgcctcgg tggaaggtgg ctatcctcat ccccttccgg       660
     aaccgccatg agcacctccc ggtcctcctg agacacctgc tccccatgct tcagcgccag       720
     gccctgcagt tcgccttcta tgtgatcgag caagttggca cccagccctt taaccgagcc       780
     atgcttttca atgttggttt tcaagaagcc atgaaggact tggattggga ttgtctgatc       840
     ttccatgacg tcgatcacat acctgagagt gaccgaaact actatggctg cgggcagatg       900
     cccaggcact ttgcaaccaa gctggacaag tacatgtacc tgctgcccta cactgagttt       960
     tttggtggcg tgagcggcct gactgtagaa cagtttcgga aaatcaatgg ctttcctaat      1020
     gccttctggg gctggggcgg agaagatgac gacttgtgga acagggtaca aaatgcaggc      1080
     tattctgtga gccggccaga aggggacaca ggaaaataca agtccattcc tcaccaccat      1140
     cgaggagagg tccagtttct tggcaggtac gctctgctga ggaagtcaaa ggagcggcaa      1200
     ggactggatg gcctcaacaa cctgaactac tctgcgaatg tcacgtacga cgccttgtat      1260
     aaaaacataa ctgtcaactt gacacccgag ctggctcagg tgactgagta ctgagatgcg      1320
     aagagaagcc gcactcacct acccaccgct cccttggacg ggctgcgacc cgccatcctg      1380
     ggggtcaaca caggaggaca gaagagagtg gagcacagga ccataggggt tccagaaaac      1440
     tgtcacagag cacacgcaca aaggccttcg ctgtagggcc caacagggac aggagacttg      1500
     aggacacctg tcatcagcac tggtgtctat tccacaagac agatgtctgc cctgccactc      1560
     ccttccgtcc gtccctgtcc gtccccccc                                        1589
//


spacer
spacer