Dbfetch

>sp|P29306|1433X_MAIZE 14-3-3-like protein (Fragment) OS=Zea mays PE=2 SV=1
ILNSPDRACNLAKQAFDEAISELDSLGEESYKDSTLIMQLLXDNLTLWTSDTNEDGGDEI
K