Dbfetch

>ZP_00047513.1 hypothetical protein Magn03000026 [Magnetospirillum magnetotacticum MS-1]
MERCHCRNRRKFVDPTGLAAAKNTSPLLIQNYRRNMGDGTVQLMVDASAPIFVKGRHWGGLRLGFRT