Dbfetch

>YP_052664.1 MarR-like protein (plasmid) [Sulfolobus tengchongensis]
MKSEKTFILYTLYLITDKSMSTDVEELYTILNPGGVILVMLYVNGKMHESELIKKSEMSSSTIMRWREIL
AKRGYITIERKKDSLNVKLFLDLTEKGKIVANNLLRLSTRFNEIIEEP