Dbfetch

>YP_001876438.1 small membrane protein [Beluga Whale coronavirus SW1]
MSAISDWFYANGMFFSCLYILLGLIAIYIVGKVLTVFVQAIDVCLLFCKGWAVDPSVRLVSYAYGVLPKQ
PKLNFEDIERVPLSFPRNSKDGEYV