spacer

EBI Dbfetch

>gi|187251957|ref|YP_001876438.1| small membrane protein [Beluga Whale coronavirus SW1]
MSAISDWFYANGMFFSCLYILLGLIAIYIVGKVLTVFVQAIDVCLLFCKGWAVDPSVRLVSYAYGVLPKQ
PKLNFEDIERVPLSFPRNSKDGEYV



spacer
spacer