Dbfetch

>XP_001001333.1 PREDICTED: 60S ribosomal protein L23a-like [Mus musculus]
MAPKAKKEAMALLKDEAKATALKAKKAVLKGIHSHKKKIRTSPIFWQPKSLWLQRKPKYLQNSEPRRNKL
DHYAVIKLPLTTESAMKKIKDNNMLVFIVDVKTNKHQIKKAVRKLYDIDVAKVHTLTRPDRENKACVYLA
PDCEAPDVVNKIRVI