Dbfetch

>NP_862703.1 hypothetical protein lp6-9_p01 (plasmid) [Borreliella burgdorferi]
MNKLLIFIILLVFSCNLSNSDQNNPLNMSNKEKISEYQINESSNKYSIFKRNSSVKRYTFNHYY