spacer

EBI Dbfetch

>gi|32455307|ref|NP_862703.1| hypothetical protein lp6-9_p01 [Borrelia burgdorferi]
MNKLLIFIILLVFSCNLSNSDQNNPLNMSNKEKISEYQINESSNKYSIFKRNSSVKRYTFNHYY



spacer
spacer