spacer

EBI Dbfetch

>gi|126723201|ref|NP_001075859.1| whey acidic protein precursor [Oryctolagus cuniculus]
MRCLISLALGLLALEAALALAPKFIAPVQVMCPEPSSSEETLCLSDNDCLGSTVCCPSAAGGSCRTPIIV
PTPKAGRCPWVQAPMLSQLCEELSDCANDIECRGDKKCCFSRCAMRYLEPILESTPQ



spacer
spacer