Dbfetch

LOCUS       XM_001000025             549 bp    mRNA    linear   ROD 19-OCT-2010
DEFINITION  PREDICTED: Mus musculus predicted gene 13288 (Gm13288), mRNA.
ACCESSION   XM_001000025
VERSION     XM_001000025.2
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
            Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NT_039260) annotated using gene prediction method: GNOMON.
            Also see:
                Documentation of NCBI's Annotation Process
            
            [WARNING] On Jul 30, 2011 this sequence was replaced by
            gi:341926165.
            On Oct 19, 2010 this sequence version replaced gi:94371963.
FEATURES             Location/Qualifiers
     source          1..549
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6J"
                     /db_xref="taxon:10090"
                     /chromosome="4"
     gene            1..549
                     /gene="Gm13288"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GNOMON. Supporting evidence
                     includes similarity to: 7 Proteins"
                     /db_xref="GeneID:668208"
                     /db_xref="MGI:MGI:3701985"
     CDS             1..549
                     /gene="Gm13288"
                     /codon_start=1
                     /product="interferon tau-8"
                     /protein_id="XP_001000025.3"
                     /db_xref="GeneID:668208"
                     /db_xref="MGI:MGI:3701985"
                     /translation="MLPVHLFLVGGVMLSCSPASSLDSGKSGSLHLERSETARFLAEL
                     RSVPGHQCLRDRTDFPCPWKEGTNITPMTLGETTSCYSQTLKQVLHLFDTEASRAAWH
                     ERALDQLLSSLWRELQVLKRPREQGQSCPLPFALAIRTYFRGFFRYLKAKAHSACSWE
                     IVRVQLQVDLPAFPLSARRGPR"
ORIGIN      
        1 atgctgcctg tgcatctatt cctggtggga ggggtgatgc tgagctgcag cccagccagc
       61 tcacttgatt ctggtaaatc tgggagcctg cacctggagc gcagcgaaac cgcgcgcttc
      121 ctagcagagc tccgaagcgt gccgggtcac cagtgcctgc gggacaggac cgatttccca
      181 tgtccctgga aggaaggaac taacatcaca ccgatgactc tgggagaaac caccagttgc
      241 tactcccaga ccctcaagca ggtcctccac ctctttgaca cagaggccag cagagctgcc
      301 tggcacgaga gggcgctgga ccagctacta tctagcctgt ggcgtgagct gcaagtgctg
      361 aagaggccaa gagagcaggg ccagtcctgt ccactgcctt ttgccctggc catccgcacc
      421 tacttccgag ggttcttccg ctatctgaag gcaaaggcac acagcgcttg ctcctgggag
      481 atcgtcagag tccaattgca agtggacctt ccagcgttcc cactgtctgc gagaagaggc
      541 ccaagatga
//