Dbfetch

LOCUS       NM_001243167            2850 bp    mRNA    linear   ROD 31-JAN-2017
DEFINITION  Mus musculus predicted gene 13288 (Gm13288), mRNA.
ACCESSION   NM_001243167 XM_001000025
VERSION     NM_001243167.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
            Sciurognathi; Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 2850)
  AUTHORS   Carninci P, Shibata Y, Hayatsu N, Sugahara Y, Shibata K, Itoh M,
            Konno H, Okazaki Y, Muramatsu M and Hayashizaki Y.
  TITLE     Normalization and subtraction of cap-trapper-selected cDNAs to
            prepare full-length cDNA libraries for rapid discovery of new genes
  JOURNAL   Genome Res. 10 (10), 1617-1630 (2000)
   PUBMED   11042159
REFERENCE   2  (bases 1 to 2850)
  AUTHORS   Carninci P and Hayashizaki Y.
  TITLE     High-efficiency full-length cDNA cloning
  JOURNAL   Meth. Enzymol. 303, 19-44 (1999)
   PUBMED   10349636
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL928605.22.
            On Jul 30, 2011 this sequence version replaced XM_001000025.2.

            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.

            ##Evidence-Data-START##
            Transcript is intronless :: AK031317.1 [ECO:0000345]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-2850              AL928605.22        167098-169947
FEATURES             Location/Qualifiers
     source          1..2850
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="4"
                     /map="4"
     gene            1..2850
                     /gene="Gm13288"
                     /note="predicted gene 13288"
                     /db_xref="GeneID:668208"
                     /db_xref="MGI:MGI:3701985"
     exon            1..2850
                     /gene="Gm13288"
                     /inference="alignment:Splign:1.39.8"
     STS             223..1307
                     /gene="Gm13288"
                     /db_xref="UniSTS:491938"
     variation       229
                     /gene="Gm13288"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:255309855"
     variation       237
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:222890414"
     misc_feature    560..562
                     /gene="Gm13288"
                     /note="upstream in-frame stop codon"
     CDS             656..1204
                     /gene="Gm13288"
                     /note="interferon zeta family Ifnz member"
                     /codon_start=1
                     /product="interferon zeta-like precursor"
                     /protein_id="NP_001230096.1"
                     /db_xref="CCDS:CCDS57286.1"
                     /db_xref="GeneID:668208"
                     /db_xref="MGI:MGI:3701985"
                     /translation="MLPVHLFLVGGVMLSCSPASSLDSGKSGSLHLERSETARFLAEL
                     RSVPGHQCLRDRTDFPCPWKEGTNITPMTLGETTSCYSQTLKQVLHLFDTEASRAAWH
                     ERALDQLLSSLWRELQVLKRPREQGQSCPLPFALAIRTYFRGFFRYLKAKAHSACSWE
                     IVRVQLQVDLPAFPLSARRGPR"
     sig_peptide     656..718
                     /gene="Gm13288"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    761..1150
                     /gene="Gm13288"
                     /note="Interferon alpha/beta domain; Region: Interferon;
                     pfam00143"
                     /db_xref="CDD:278568"
     misc_feature    order(812..835,839..844,848..850,866..871,1061..1066,
                     1070..1075,1082..1087,1091..1096,1103..1120)
                     /gene="Gm13288"
                     /note="putative IFNAR-2 binding site; other site"
                     /db_xref="CDD:238047"
     misc_feature    959..961
                     /gene="Gm13288"
                     /note="N-glycosylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:238047"
     variation       1165
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:222986114"
     variation       1311
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:242927325"
     variation       1332
                     /gene="Gm13288"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:32325246"
     variation       1518
                     /gene="Gm13288"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:32826868"
     variation       1528
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:31813250"
     variation       1547
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:257978967"
     variation       1558
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:232647580"
     variation       1562
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:253515642"
     variation       1568
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:218478547"
     variation       1587
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:240621205"
     variation       1612
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:253104105"
     variation       1615
                     /gene="Gm13288"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:213077453"
     variation       1627
                     /gene="Gm13288"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:31784810"
     variation       1641
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:250600586"
     variation       1642
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:215251764"
     variation       1643
                     /gene="Gm13288"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:239976744"
     variation       1651
                     /gene="Gm13288"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:50094728"
     variation       1656
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:32542536"
     variation       1672
                     /gene="Gm13288"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:226134512"
     variation       1676
                     /gene="Gm13288"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:248222285"
     variation       1680
                     /gene="Gm13288"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:249441433"
     variation       1682..1683
                     /gene="Gm13288"
                     /replace=""
                     /replace="ttt"
                     /db_xref="dbSNP:217063570"
     variation       1686
                     /gene="Gm13288"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:218664899"
     variation       1699
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:238622919"
     variation       1700
                     /gene="Gm13288"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:32301296"
     variation       1710
                     /gene="Gm13288"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:231345624"
     variation       1723
                     /gene="Gm13288"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:248486171"
     variation       1742
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:264217322"
     variation       1745
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:235679656"
     variation       1753
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:242579260"
     variation       1772
                     /gene="Gm13288"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:578475516"
     variation       1773..1774
                     /gene="Gm13288"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:220877426"
     variation       1775..1776
                     /gene="Gm13288"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:222493359"
     variation       1777..1778
                     /gene="Gm13288"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:232223514"
     variation       1788
                     /gene="Gm13288"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:213166944"
     variation       1801
                     /gene="Gm13288"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:225534008"
     variation       1827
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:244699430"
     variation       1828
                     /gene="Gm13288"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:216292739"
     variation       1871
                     /gene="Gm13288"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:238773051"
     variation       1898
                     /gene="Gm13288"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:263771890"
     variation       1905
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:217992297"
     variation       1909
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:242965270"
     variation       1941
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:249536048"
     variation       1946
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:32565537"
     variation       1953
                     /gene="Gm13288"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:50246352"
     variation       1961
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:32839117"
     variation       1969
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:223857012"
     variation       1996
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:32320034"
     variation       2008
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:32748881"
     variation       2062
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:234271521"
     variation       2082
                     /gene="Gm13288"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:236246529"
     variation       2106
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:254901739"
     variation       2149
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:225576093"
     variation       2158
                     /gene="Gm13288"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:244776835"
     variation       2162
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:51914203"
     variation       2171
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:233267922"
     variation       2225
                     /gene="Gm13288"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:48771809"
     variation       2226
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:219178902"
     variation       2230
                     /gene="Gm13288"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:51185686"
     variation       2297
                     /gene="Gm13288"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:32311200"
     variation       2318
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:32247963"
     variation       2394
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:231584303"
     variation       2420
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:49251053"
     variation       2442
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:46495650"
     variation       2445
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:240709426"
     variation       2529
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:259979536"
     variation       2536
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:226753101"
     variation       2610
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:236284913"
     variation       2627
                     /gene="Gm13288"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:254989681"
     variation       2631
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:219663581"
     variation       2632
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:238667912"
     variation       2637
                     /gene="Gm13288"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:31883198"
     variation       2704
                     /gene="Gm13288"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:49785788"
     variation       2729
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:259358906"
     variation       2732
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:264481131"
     variation       2743
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:49610973"
     variation       2808
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:244328056"
     variation       2820
                     /gene="Gm13288"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:51094501"
ORIGIN
       1  TCCCTGCTCA GCAGAGCTCC TGAGAGGAGA GGGGCAAGAC CATACTGTCT GTCCTCTCTC
      61  TGGAACTGTC TGCCTGTTGG GGCCCAGCTC TCCTCTCTGC CAACTCCACT TCCTTCTTCT
     121  CCACTCGCGT TAGAGAGCTG GAAGGGTCTG GCGGGCCACC CAAACGCACC AAGATGCGAA
     181  CCAAACAAAC GAAAGGAAAC CGAACCAAAG GAGACCAAAC CAAACCCAGC CCAGCCAAAC
     241  CAAAACGCTG CTCTCTGGGC TTTGGAGCCT TCCCGGTTCC CCGAAAACAT GTCCCCTGGC
     301  CCACCAATTC CGTCTGGGTT CAATTCTCAA GGCGCGATGG ATGGCGTACA GTCCTGTACG
     361  CGAAGGGGCC CGGGAGAGAG GCAGGAGACA CTCCCTGCCT GCCCGGAGTC GCGCGCTGAG
     421  CGGGGCGAAC GGCCTCCGCA GGCGCCCGCT GCTGCCCTCC GGTGGCCCGC GCCCTCTGCT
     481  GCTGCTCCTG GCCTCAGAAG TCGCGTCCAG CGTCCAGCGC AGCGCAGGCA GTCAGCGAGC
     541  AAGAGCCCGA AGCTCCGAGT GAACTATTAA AGCAGCAAAC TCCAGGCTCA ATGGGAAGGC
     601  GGCCTTGCCC TCGCGCTCCC CCTGCAGGCC AGCCCCGCAA TCGTCAGGCT TCAGCATGCT
     661  GCCTGTGCAT CTATTCCTGG TGGGAGGGGT GATGCTGAGC TGCAGCCCAG CCAGCTCACT
     721  TGATTCTGGT AAATCTGGGA GCCTGCACCT GGAGCGCAGC GAAACCGCGC GCTTCCTAGC
     781  AGAGCTCCGA AGCGTGCCGG GTCACCAGTG CCTGCGGGAC AGGACCGATT TCCCATGTCC
     841  CTGGAAGGAA GGAACTAACA TCACACCGAT GACTCTGGGA GAAACCACCA GTTGCTACTC
     901  CCAGACCCTC AAGCAGGTCC TCCACCTCTT TGACACAGAG GCCAGCAGAG CTGCCTGGCA
     961  CGAGAGGGCG CTGGACCAGC TACTATCTAG CCTGTGGCGT GAGCTGCAAG TGCTGAAGAG
    1021  GCCAAGAGAG CAGGGCCAGT CCTGTCCACT GCCTTTTGCC CTGGCCATCC GCACCTACTT
    1081  CCGAGGGTTC TTCCGCTATC TGAAGGCAAA GGCACACAGC GCTTGCTCCT GGGAGATCGT
    1141  CAGAGTCCAA TTGCAAGTGG ACCTTCCAGC GTTCCCACTG TCTGCGAGAA GAGGCCCAAG
    1201  ATGAGGAGAA GCCCCGTGCA GGAATCTCTC TGCTCTCGTG ACACCACGCT CCCTCTCTCC
    1261  ATTCAAAGCA GACACACGGA TTCGGATTCA GCACCAACAG GCGAAATGGG CGTGCATCGA
    1321  CCAAGAACAT CGAGTTCTTT ATGTCTTCCC TGCCAGAGGC CCCGAAGCAT CCTACTGTAC
    1381  ATCATACACT GCGAAAGATG TTTGAAAGAA AACCTGTGCT CTTGCATTTG AGGTGGCTTC
    1441  TGAATAAATT GATGATCTCG GTTTTCCTTG GGAGGTTTCG ATCACAGATG GGGGATGCCC
    1501  ATGGGCCACG GGGGTTGGAA AACGTGCCTT GTTGCAGCAA GGCTCTCTTG GGCTGTTCGG
    1561  TGTTAGAACC ATTCTCTCTC CTGTCATGGG CTTCTGGTTA GCTTCTTGTA ACCTGGGAAC
    1621  TCCTTAATCT CAGACTTTGC CCGGTCTCAG GTTTTCTGTT TGTTTGTTTG TGTGTGTGTG
    1681  TGTTTTTTGA AAATCTCCCT TGGAAGGAAG TTACTCCAGA GGTTGATGAA CCTCTTTGCT
    1741  TGATCTTTGC ATCTTGAAAA GAGAAAATTC TCCTTAAAAA AAAAGCTATA TTCTCCTTTC
    1801  GTTGAAGACA GCTTTATGTG CACAAAATTC TCAAAAGTCT CCTTTGATGC CAGTCTTTTT
    1861  AGAGGGTAGG AGGTGGACCT GAAATATTAA ACCCTCTGGC TCTATAGGCC TCAGGTTGGG
    1921  AGAGAGGAAT TTCCCATCTC ATGTTTCATC AAGATGGAAG CCTTTTGTCC TAGGTTCCAT
    1981  ACAAGCTGCT AACTATAGTG TTTGTTTCAA AAGTTCCTTC TCTCTAAAAG TCCCTTCTTT
    2041  TTTACGTATT ATCAGCAGAG CGTCCTACCC CTTTGGAGAA GTGATTAGCA TGCATCAATA
    2101  TCAATCTCAC TGGGCCCTTA GAGAGAACAC AGACGTAGGT AAAGCATCAT GAGAGATTAT
    2161  TAGGATAGCC CACTGACACC TGGAGACTGT GTAGCACCCA CAAGCACCAA GGAGATCTGC
    2221  AGCACGTTGG AACTGAGGAG TTAGTGTGGC TTCTGAGGAG GATGGGAGTT TTCACTTCAG
    2281  TTGGGACCAG CCTGGTCTCT GCCTGTGGTC AGAGAACAAC TTGTTCTAGC CCTGTTACTT
    2341  GATCAGGACT AGGGTTTACA TAGGGAAGGA CTTTGTCTCT AGACTTCTCT CCTCTCCACC
    2401  CTTGTAAATG GTCTAGTGAA GGCTCAGGGT GACATAGATG CATTCTAAAT TGAACTTCAT
    2461  TTTGGCTGAT GCCTTAAATT ATGAAAATTG TCCATCTTTA TGTAGTACTG TGTGATAATT
    2521  CATACATGCG CACACACTGT CAAGTTTTAT ACACTTTAAA CATGGATCTC CTCAAACACT
    2581  ATTTTCTTTT TGTAGATAAA ACACTGAAAA CCCTTTCTCA CAATTTTAAA GCTGACTATG
    2641  GCATCGTGAA CGTCTTTTTG TAATCAACAT GCAGCAACAC CCATGATCCT CCTTCCTGAG
    2701  AGGATCTCAG CCCCTAGAAA CCATTTTGGA GGACTTGGTA GTGGTGTAAG CTTGGCTGAC
    2761  CGTGTGATTA CATAAAATCT TCCCATTTGA CCACTTCTAT TTTTGTCGTT GCTTGTATCA
    2821  TCAACATTTT TCAATATAAA TAATTATACC
//