Dbfetch

LOCUS       NZ_JH621247           229115 bp    DNA     linear   CON 18-MAY-2017
DEFINITION  Aquimarina agarilytica ZC1 Scaffold2, whole genome shotgun
            sequence.
ACCESSION   NZ_JH621247 NZ_AHHE02000000
VERSION     NZ_JH621247.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02470972
            Assembly: GCF_000255455.1
KEYWORDS    WGS; RefSeq.
SOURCE      Aquimarina agarilytica ZC1
  ORGANISM  Aquimarina agarilytica ZC1
            Bacteria; Bacteroidetes; Flavobacteriia; Flavobacteriales;
            Flavobacteriaceae; Aquimarina.
REFERENCE   1  (bases 1 to 229115)
  AUTHORS   Lin,B., Lu,G., Li,S., Hu,Z. and Chen,H.
  TITLE     Draft Genome Sequence of the Novel Agarolytic Bacterium Aquimarina
            agarilytica ZC1
  JOURNAL   J. Bacteriol. 194 (10), 2769 (2012)
   PUBMED   22535944
REFERENCE   2  (bases 1 to 229115)
  AUTHORS   Lin,B., Lu,G. and Hu,Z.
  TITLE     Draft Genome Sequence of the Novel Agarolytic Bacterium Aquimarina
            agarilytica ZC1
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 229115)
  AUTHORS   Lin,B., Lu,G. and Hu,Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-FEB-2012) Department of Biology, Shantou University,
            Da Xue Road No. 243, Shantou, Guangdong 515063, China
REFERENCE   4  (bases 1 to 229115)
  AUTHORS   Lin,B., Lu,G. and Hu,Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-DEC-2011) Department of Biology, Shantou University,
            Da Xue Road No. 243, Shantou, Guangdong 515063, China
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            JH621247.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            Bacteria are available from China Center for Type Culture
            Collection (CCTCC) or Biological Resource Center (NBRC, Japan) with
            the following accession numbers, CCTCC AB 2010229 and NBRC 107695.
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: SOAPdenovo v. 1.04
            Genome Coverage       :: 50x
            Sequencing Technology :: Illumina HiSeq 2000
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 05/16/2017 08:25:01
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.2
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 3,540
            CDS (total)                       :: 3,498
            Genes (coding)                    :: 3,388
            CDS (coding)                      :: 3,388
            Genes (RNA)                       :: 42
            rRNAs                             :: 1, 1, 1 (5S, 16S, 23S)
            complete rRNAs                    :: 1, 1, 1 (5S, 16S, 23S)
            tRNAs                             :: 35
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 110
            Pseudo Genes (ambiguous residues) :: 12 of 110
            Pseudo Genes (frameshifted)       :: 24 of 110
            Pseudo Genes (incomplete)         :: 73 of 110
            Pseudo Genes (internal stop)      :: 12 of 110
            Pseudo Genes (multiple problems)  :: 11 of 110
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..229115
                     /organism="Aquimarina agarilytica ZC1"
                     /mol_type="genomic DNA"
                     /strain="ZC1"
                     /db_xref="taxon:620914"
     gene            <1..2258
                     /locus_tag="KQA_RS0201050"
                     /pseudo
     CDS             <1..2258
                     /locus_tag="KQA_RS0201050"
                     /inference="COORDINATES: protein motif:HMM:PF13585.4"
                     /note="incomplete; too short partial abutting assembly
                     gap; missing start; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=3
                     /transl_table=11
                     /product="hypothetical protein"
     gene            2321..3271
                     /locus_tag="KQA_RS0201055"
     CDS             2321..3271
                     /locus_tag="KQA_RS0201055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IX secretion system membrane protein
                     PorP/SprF"
                     /protein_id="WP_010177309.1"
                     /translation="MEKKFFRSAMVILGIIISTVAQAQQDPQYTQYMYNPSVVNPAYA
                     GSRDVLSIVGLHRSQWVGVEGAPRTQTLGIHSPIGIGRVGLGGNIVHDEIGPSQETYL
                     TADFSYTIPTSEKGNLSFGIKAGAHILDVDFTKLNISDAGDIFDRNIDNKVSPNIGLG
                     LFYYTDKFYLGLSAPNLLQTRHFDNVNINTSTGSSFLSKERVHYYITTGRTFDLSSNV
                     KFKPAILSKIVFGAPLQLDLTANFLIWEKLTLGAAYRWSAAWSALAGFQISDSLMIGF
                     GYDRETTPLGDTSFNDGSYEVMMRFELFRKQNKIITPRFF"
     gene            3284..5269
                     /locus_tag="KQA_RS0201060"
     CDS             3284..5269
                     /locus_tag="KQA_RS0201060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010520421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope biogenesis protein OmpA"
                     /protein_id="WP_029209397.1"
                     /translation="MNTKNIKNVILYSFLGFSALVAQEQKIKKANKAFENYAYIDAQK
                     TYLSVVEQGYTSADVYEKLGDSYYFNADLESAAIWYGKLFYEYASNVKPEYLFRYSHA
                     LKNIGNYELSDKVMEQFGKVTGVKEQRVKFFNKDRNYLALIEKQSGKFKVYNVEGVNT
                     SGSDFGPSYYNDNTIYFASDRSNIAKKNIHTWTNAPFLNLFKADKDSNQLTNLNNSSK
                     VNGNINSKYHESSTVFTKDGKTMYFTRNNYTDKKKKSDTNGTTKLKLYRAVLKDGRWS
                     NELELPFNSDEYSVAHPALSKDEKRLYFASDMKGTKGLSDLFFVEILGVNKYSEPQNL
                     GSNINTEGRETFPFISNNGDLFFASDGHIGLGGLDIFIAKATPSKKNFEEAYNVGKPI
                     NSKYDDFSFILNSSKKEGYFTSNREGGLGNDDIYAFEQVEELITTCDQYLKGIITDAE
                     TRALLPGSKVTLLTEDLKPITSTVADGNAFYELPIECDNKYVIRAEEPNYKPTEVDFA
                     SSSVFEFNHNQPIQLRKGAPIINNVAAKVGDDLAKLLQLNPIYFDFDKDFIRPDAALE
                     LQKVIAVMKEYPNLEIDVRSHTDSRAPFAYNIDLSTRRNKNTIKYIVEKGGMSTSRLT
                     GRGYGEIELTNECADGVNCSEEKHQLNRRSEFIIVKQ"
     gene            5445..5855
                     /locus_tag="KQA_RS18225"
                     /pseudo
     CDS             5445..5855
                     /locus_tag="KQA_RS18225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006261444.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605 family transposase"
     gene            6225..6998
                     /locus_tag="KQA_RS0201070"
     CDS             6225..6998
                     /locus_tag="KQA_RS0201070"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177312.1"
                     /translation="MKTKLLYLFTFITTLSFSQTNLVPNGNVESWTNSTTLDNWITEN
                     NVSQNTTDSTEGNSSASLLIIGNSSVNPKIVTKVPLTSGITYTVSYKFKYTTSSFTGS
                     RSVCLKLVKDGSATTTTRCSTLNDNLWNFKEITFTPDQTGDYDLSISTSNFSGINTFE
                     VLIDDIKVFDPLNLSVDYFKNDDQNQNIYPTITNGKIYFDKIENVDELNISVFNCIGQ
                     KENFVVNNNTIDLSRLATGIYFISLKTDKLNTVKRILKK"
     gene            complement(7366..8525)
                     /locus_tag="KQA_RS19360"
                     /pseudo
     CDS             complement(7366..8525)
                     /locus_tag="KQA_RS19360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011708903.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS256 family transposase"
     gene            complement(8717..10228)
                     /locus_tag="KQA_RS19365"
     CDS             complement(8717..10228)
                     /locus_tag="KQA_RS19365"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177313.1"
                     /translation="MFNVKSFFSGGHLRSVFWCLATTLSLHGQTKPTNPTFNLGQDPS
                     PDSKSWKLIDDLSDEFDSPKLDLTKWENTRADLWVGRPPGLFQEKSATVAAEHLRLEN
                     YLLDSPRVIDGETYTHGCGNIWSKRKASVGYYIEAKMKANKTFMSSTFWLINRPDDFT
                     GCDRRTTELDIVEVVGLVTSTDPNKKDYNKNMNSNSHSRNTSCPETPTGSRGTESPIN
                     EEAWANYHVYGCWWKSPKELIFFLDGQEVHSITPKADFNLDMYLRLVTETYKWNSVPN
                     DGQQGMGGTQEERTTYYDWVRTWELTPKNLVTNDIVTIDDVPDDVIKGQSFDVEVHYE
                     ATSSADIVVALYDPSGSTFFRNAKKKVDAGIGTVTITIQTEDTWPIANDYEVRAIIRE
                     VDGNFMTDRDIKKTTIDLTEDSLSISEFRNETEKRFSIFPNPVKDEIFNLMVNENIKG
                     AKLYIYDLKGDLVLQKKVENTSNKITIGKLTSGIYLIKINKNQHTLVTKLVVQ"
     gene            10715..11866
                     /locus_tag="KQA_RS19370"
     CDS             10715..11866
                     /locus_tag="KQA_RS19370"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177314.1"
                     /translation="MRNFLVLSICAIFSNVYSQWDTGWFPNPDNYVPKYNGKSWQRLG
                     WMSDGFNDGWLNETKWKRGYLNEWNDKGRTRWNSWPDYVKVSNTWGQGCAQIGHYWND
                     ASAGGWANTISCGIISSRNTVKYPVYLESRIRVANTELSSNFWLLDTGENRREIDVLE
                     CYGGNSWNGNRATSNFHFFTDSDRKDHFKRSDHWRGFPWRNNFHRFGVLWLNPWDVRF
                     FIDGKREGYNFYSINLKTKDGLQLNKDWWNYSTEMKIILDVEEHKGTAQDPIWKYKQG
                     LWNTDRKMLVDWIGVWKPNTGGKKLNTSSINTAELPKVYPNPVKQGQELVLSNIEKGQ
                     NFIFSSVDGKIISSFNIPHEDKLFLNTKDISPGLYILQVDTNVIKLIVK"
     gene            12366..15167
                     /locus_tag="KQA_RS0201100"
     CDS             12366..15167
                     /locus_tag="KQA_RS0201100"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-agarase"
                     /protein_id="WP_010177315.1"
                     /translation="MKNYLLFMLFSVQLLFAQSVKLPEGFTKDSSLSDDFNYGSDKKG
                     MSDKWDDFNSSGWKGPGPTEFRSENITFKDGKLIIKASHFEGGEKHFENGRTWTRQVH
                     TGYLVSKEDNPISPPVYFEASLKANAIGLASNFWAKRGNIDNSSEIDVVETYSDTDNG
                     SNNYHFFRDKKDYNDQRRPPVGNDVESNFNVYSCFWKSKTEVIFYVNGKQTRHIYPCA
                     PDPRDRLVDPAGRFFDENLRIILDCEVHTWRIKQKIANALPTKAALDKLTDDQQMQVD
                     YMHVYKPGSGYKVSDPCGSDSSDSTDSAADDKSFSSLSFNQSTEGANNNPLILSAPNT
                     VERNIKGYPLKASFSQDGYAIFHLKDRNNGWKSYGHVGKQVTSGKQYNFWLKTNEYIS
                     GNNLDLVWEIKVNNGAKGFAVKSTNVNNGGNNQDTFSNNSSPTIQNAPSSIVRNIKGY
                     NLQAYFPQGGYAIFHLKDKNNGWKSYGQVGKRVTSGSTHNFWLKTNQYISGNNLDLIW
                     EVKVDNGAKGFAVKSTSLNSGGGNQNTVSNNSNATIQNAPSSIVRNIKGYNLQAYFPQ
                     GGYAIFHLKDKNNSWKSYGQVGKRVTSGSTHNFWLKTNQYISGNNLDLIWEVKVDNGA
                     KGFAVKSTSVNSGGGNQNTVSNNNNPTIQNAPSSIVRNIKGYNLQAYFPQGGYAIFHL
                     KDKNNGWKSYGQVGKRVTSGSTHNFWLKTNEYISGNNLDLIWELKVDNGVKGFAVKST
                     GANSGGGNQNTVSNNSNPTIQNAPSSIDRNIKGYNLQAYFPQGGYAIFHLKDKNNGWK
                     SYGQVGKRVTSGSTHNFWLKTNEYISGNNLDLVWELKVDKGAKGFSVKSAYVNNGNKS
                     LIQKQSDDYIVKSNSIKFINYTNNSSFRVYNLLGELKDVDMIHSSDSVILDFSNMNHG
                     VYLVKTSKEKVIKFLNKRR"
     gene            15600..18077
                     /locus_tag="KQA_RS0201110"
     CDS             15600..18077
                     /locus_tag="KQA_RS0201110"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_029209400.1"
                     /translation="MREMKKNYGLLIMLFFRVFTYGQVILNIPDVNFKNALLNNDPVI
                     DTNGDGEIQNGEAFVFGGPLFLDNKGIVDMTGIEAFNNVRIIRASSNQIETIDLSKHT
                     SLQELYLSNNKLRQLDLSKNSRLLRLEVASNNLVSLDLSSNANMRNVNVSSNTIKILD
                     FSNSPFMERFIANGNDLRFINAQNGSNTGLTDFVVSNNPNLSCIMIDNVVSFIVPLTW
                     EKDATASYSENCVAPIVNIPDAAFKGILLNHSPAIDTNSDGEIQISEAEAVSNINTSR
                     NGDIEDLTGIEYFVNLRTLDCRASALKTLDVSKNVNLTTLYCSSGEITSLNISKNTEL
                     EDLRCGDNFIKSLNISKNPKLEILLADKNDMETFFVSDIENTVLHTLHVQENKLRILN
                     EAKFPALVSFRCEQNLITSLDISNNPNIRTFYAFSNALTSLNLKNGANTLFSPLLTNN
                     PDLYCIKVDDVDYSNTNWNGLSNKDDQAVYNETCSTRGILIPDDNFKEALLNYIPVID
                     INQDGQIQSFEATAFTGTMNVVNKDIADLTGIEHFTNITNLFCNNNSLTALDVSQNTK
                     LTTLHCGFNDLSALDISKNTELIDLFFSFNKIKTINIASNTKLQTLIGFNAELETLVS
                     ARDNYPSLTRLFLANNKLSTLITSPFSNLQILTCQDNEISALDFSLNTKITEILVQNN
                     QLTSVDLKNGNNGIFKSLDSDFSGNSDLECIQVDDLDFSNNRWIGLKRDSGVQFSEDC
                     GANLSVNEFELTANTNIFPVPVIDRLTINSIYDIVAVEVLNLAGNTVLLSNENTESID
                     MQDLPSGLYLLKITYNEGVVYKKIIKN"
     gene            complement(19150..20850)
                     /locus_tag="KQA_RS19375"
     CDS             complement(19150..20850)
                     /locus_tag="KQA_RS19375"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177317.1"
                     /translation="MKYFHVLLGLFFSFLTAASAQTTDILTGLTKPRGIAINGDELYF
                     TELTANRILKIDLTQTNPSPVEVVTGLDTPKELVFNGNTLYVSEANRISRVDVTSSLP
                     ATRQDFFVGIEQPQGMLIHNNYLYTKGANNNVFKFNLDNPTIDVSLVFGANLIYDFVK
                     IGNDAYVTQENAIRKFDLTANTPSLGNVINSSQEPLLAGINVGMTAINNTIYFLQNPT
                     GRLLSFNINDPVGTFGQLLNISAVGDVTSYKGDLYISDFDNGKIIKYELPDTTPTTDI
                     AHYYSLDSQTVVDEIGNEDPTVVLSTVVSSGAINRSHAFDNADNITLFNFAPTSFTIN
                     FWFKTNDINKTQRIFHRGGYGGSAYDRYSYSLVYIPNQGFRLGLGSDAGSNAALIYAN
                     TSADLTDWHMITCTYDLSTQTARIYIDGNLEASDTSLQGIYANPNYQLFLEFSRYPLP
                     GSPQAIDGNLDEIGLWTRAISDTEVTTLYNETATLSIDDFDLTGARVELFPNPAKNFI
                     KVSNLNTSGQFKIYNLLGQPVKQGSIDNNQTIDISNLIKGLYLLKFKNDAKTLRFAKE
                     "
     gene            21262..21693
                     /locus_tag="KQA_RS0201120"
     CDS             21262..21693
                     /locus_tag="KQA_RS0201120"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177318.1"
                     /translation="MGDFTSHPNIDTDGDGEIQIAEAKAVEVLNLRNKGILDLRGIEY
                     FVNLKELYIEHNRLTSLDISKNKQLKELYAQGTLLTTLNIASNEKLEVADIRGGELEM
                     LEVDNCGNPHLRELILTDCFFTNLDKSKFPNLKIQFCNYID"
     gene            21847..23646
                     /locus_tag="KQA_RS19380"
     CDS             21847..23646
                     /locus_tag="KQA_RS19380"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of chromosome condensation RCC1"
                     /protein_id="WP_010177319.1"
                     /translation="MKNNYFLLITLFLSVTLFGQSVVNIPDVNFKNALINHSPTIDTN
                     SDGEIQLTEAEAFSGSLAVSNKNISDLTGIGAFINITRLGCSGNNLSTINISNNKKMQ
                     FLACLENHLKSLDITNNLDLKALWINSNEMETLDLSKNLALQELSCFKNNLSRLDVSK
                     NLDLQIFYCYENNLTTIDISKNVNLKVLWCSNNDIKSLDVSKNMYLRELSCSNINLTS
                     LDISKNLELDRLSCSNNKLTALDLSKHTKLERLNASNNQLTRLNLKNGVNTDFEHSFL
                     NFRNNPDLTCIQVDDANFSNTNWSSIKDDTADFSEACDYVIVFPDANFKTALLNHDPV
                     IDTNDDGEIQISEAESAITLNIARANINSLEGIAYFVNLEELFCAINNLDAIDISQNV
                     KLKKLYCASNNLRELDIAKNTVLEELSFGFNGVKSIALTSTKLKLITATNGILEELLV
                     LRGTTYPDLKEIYLTQNNLTQLFLPAFPNLEFLSCADNKLTSLDLSSNTKIKEVYAFN
                     NLLTEVNLKNGNNENIDVTRGLTSFALNIDLDCIEVDDVAYSNANWQGIKDSATQFSE
                     DCGAGLSITDFELASNTSVFPIPVIDDLTINSN"
     gene            23636..23812
                     /locus_tag="KQA_RS19770"
     CDS             23636..23812
                     /locus_tag="KQA_RS19770"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_081483222.1"
                     /translation="MVTNYDIVSCEVLNLVGKTVLVANENPDSIDMEHLPSGLYLLKV
                     TYNEGVVYKKIMKK"
     gene            24140..25162
                     /locus_tag="KQA_RS0201135"
     CDS             24140..25162
                     /locus_tag="KQA_RS0201135"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177321.1"
                     /translation="MKKNYLIFFAHLLVLAIHGQGIVNIPDANFKDALLNHNPVIDTN
                     GDSEIQVSEAEAFLGRINIFAKNVSDLTGVEAFVNISGLNCGFNNLTEIDVSKNTEIT
                     FLSFGLNPIKQINISSNLKLEELLGNFSDLETLLMPNVINENLTDIFLNDTEISQLDT
                     TPFPNLNIISCINAKLNSLDVSNNTKLRQLLVQNNRLVSLNLKNGNNPFLLGFDRTAS
                     NFTNNPDLDCIQVDDADFSNTNWGTIKDSGAQFSEDCQGSLGIEELELASHTSVFPIP
                     VIDDLTINSKYNIVSCEVLNLIGKTVLVVNENTDSIDMGHFPTGVYLVKITYDEGVVF
                     KKVCKK"
     gene            complement(25229..25906)
                     /locus_tag="KQA_RS19385"
     CDS             complement(25229..25906)
                     /locus_tag="KQA_RS19385"
                     /inference="COORDINATES: protein motif:HMM:PF00196.17"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_010177322.1"
                     /translation="MTKFKNAASTIAVLKEKISNQGTDSLEDFLGFYHENDINTIELL
                     YLEEKGCEIYGKTLEEIRALGPAFLAEIMHPEDIERCVNLLTEFAKKGSEEETLIYNQ
                     RLKMVGDEDYKTYFTCVKADFTKSVFQAVTTAMTQIDDFYLEVNTVLESSKYIEENVS
                     FYTSFSKREKEIIKWVCNGKNVNEIADILFLSHHTVIKHKKNIYKKAGFDSKIQLIEF
                     ALNFNLI"
     gene            complement(25903..26574)
                     /locus_tag="KQA_RS0201145"
     CDS             complement(25903..26574)
                     /locus_tag="KQA_RS0201145"
                     /inference="COORDINATES: protein motif:HMM:PF00196.17"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_010177323.1"
                     /translation="MQNFSITEISRQILSGEKTIQEISDYLPCHIHTNSLDDFRILEA
                     DSTVLNHIDRTADELLQHGPELMIEMVNPDDLRNAIDANFKYLENLETQNHVAFFQRV
                     KFPKEKEEHCFYTRGRVLDDNRIINLSVPTHELKLFNHTVLDLFQNSSFIKRNLAVFD
                     SLTKKEVMLCQYFCQENSLKDIADSLHLSIHTIKNHKINIYKKLNVNNFYDFYYFCTK
                     FKIDK"
     gene            complement(27361..28458)
                     /locus_tag="KQA_RS0201150"
     CDS             complement(27361..28458)
                     /locus_tag="KQA_RS0201150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkene reductase"
                     /protein_id="WP_010177324.1"
                     /translation="MKLLEKVQLGGVNLKNRMAMAAMTRGRVDRNGLVGDITVEYYTQ
                     RASAGLMLTESIRISKEATGSPLTPGIFTDKQIEAWKKVTTAVHEKGGVIIAQLWHTG
                     RMGHSVDRNGKLPLAPSPIPIWGMQHFTSQGKKEYEIPQEITIPEIKQTIKDFGQAAK
                     NAIAAGFDGVQLHAANGYLPSQFLAESANQRTDEYGGSIPNKCRFVLEVMQELISSVG
                     SEKVGIKISPFHPYGDIILDDPSATYSYLIKELNKLDFAYVEIQKRSTFFPSPKHYAT
                     DNEIELFGRMIRHTVIANAGYDKDSAEAELEKGIAKLISFGTLYIANPDLPERFEKNF
                     RLNKPDRATIFGGGKHGYIDYPFCNNTPPNK"
     gene            complement(28742..29734)
                     /locus_tag="KQA_RS0201155"
     CDS             complement(28742..29734)
                     /locus_tag="KQA_RS0201155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bile acid:sodium symporter"
                     /protein_id="WP_010177325.1"
                     /translation="MKKLLEVLNKVGLDGFILMIGSMILLAYFLPQPGMIKEPVSLGQ
                     IANIGVSFIFLFYGLKLSIEKLKVGLSNWKMHIIVQLTTFLFFPLLVLAFRPFFVKTD
                     LELLWLGIFFLAALPSTVSSSVVMISIAKGNVPAAIFNASISSLIGVVATPLWIGLFI
                     ASATGSFDVSDIVLKLVLQVLLPVIIGISLNSRFGNIAKKYKKQLKYFDQAIILTIIY
                     TSFCKSFSEHLFASFSALELAGLAVGMMALFFTVFFCVGLLSKWFGFSNEDRITVLFC
                     GSKKSLVHGTVMSKVLFQHSTITGIVLLPLMLYHALQLIAASVIAQRMARRKEV"
     gene            complement(29794..30822)
                     /locus_tag="KQA_RS0201160"
     CDS             complement(29794..30822)
                     /locus_tag="KQA_RS0201160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018944366.1"
                     /note="catalyzes the formation of
                     tetrahydropteroyl-L-glutamate and methionine from
                     L-homocysteine and
                     5-methyltetrahydropteroyltri-L-glutamate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine synthase"
                     /protein_id="WP_010177326.1"
                     /translation="MKKILPTSIVGSLPKPAWLAPPKKLWSPWNLEEDQLLEGKQDAL
                     RIALQEQQLAGVDIISDGEQTRQHFVTTFIEHLSGVDFKNRKTVKIRDRYNASVPVVV
                     DEVTRQKAVFVDDAKFLRKQTDKPIKWALPGPMTMVDTLYDGHYKSREKLAWEFAKAL
                     NEEARELQDAGVDIIQFDEPAFNVFFEEVNDWGIATLERAIEGLHCETAVHICYGYGI
                     KANNDWKKTLGSEWRQYEEIFPKIQSSNIDIVSLECHGSRVPFNLIELVRGKKVMVGA
                     IDVATNTIETPEEVADTLRKALDFVNIENLYPCTNCGMAPLSRNVARGKLSALSAGAE
                     IIRKELGI"
     gene            complement(30852..31856)
                     /locus_tag="KQA_RS0201165"
     CDS             complement(30852..31856)
                     /locus_tag="KQA_RS0201165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1852 domain-containing protein"
                     /protein_id="WP_010177327.1"
                     /translation="MKNTQNTIKTDFSFTLMSRRLDENYHPESNTRLTTNFANLARGV
                     DRQQNLRNALNMINNRFNALAHLDNPKGDRYHVELEIMTVTLNIDHKKSIDNLPMMEV
                     LKTNILDRKTNQYVEGVAGNNFSSYVRDYDFSILLIEYNKDKPKFTVPEKFGDLHGKL
                     YQSFVRSETYKEHFKQSPIICLSVSGNKIYTRTEFQHPVLGFEYLQNEYSLTDQYFSK
                     MGMKVRFFMPANSVAPMAFYHTGDLLKEYTDLGLISSISTMETFQKIYRPEIYNANSV
                     AGKIFQPSLKHEDYSLTRVEYDRVERSQLAIEQGKYCEEYFIKPYQYILEQWAADFDL
                     "
     gene            32083..32520
                     /locus_tag="KQA_RS18260"
                     /pseudo
     CDS             32083..32520
                     /locus_tag="KQA_RS18260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010521484.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
     gene            complement(32981..34891)
                     /locus_tag="KQA_RS19390"
     CDS             complement(32981..34891)
                     /locus_tag="KQA_RS19390"
                     /inference="COORDINATES: protein motif:HMM:PF12708.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010181713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177328.1"
                     /translation="MKTYLKIPHLKSVLLLVLINLMITPFFGQIDNENRFYRETFNNG
                     VSKNVITDYGATVNDNTDDSPAVRRAINDVSKQPNGGKIYFPAGEYRIKFVHLESNVH
                     LVFSPNAVIKLPENDNPWGAIFWVGSRNAVENVSIRGDGGKFTVNMDGANTDEICIFV
                     KVENVKNFKFENARVIENLTEQSAFVLGRGFNNQAPEGGIIKNIDVLNASYGYGCVQA
                     GKADRVLFKNLSSEGGIALRLEPANFETVGATDIVGRNIIGTNGNAAVMLSPHSAVGG
                     TVNINGVTSNSCSFGVRVERGFGDRGIGSFANNSRITGIQVNYGTTAQIRPNHRVFVP
                     CPLKSLTSSRPGPDGYSYIGPAIAPVIYDSNSFGVFFGTIGYNGFSNQPKLPIVGIND
                     KFPDANCNNNGGGGNNGNNGNTFVLTKRNASGFSIDGGNGGANQQNVYLWNRSTSNVN
                     QQWEEINRGNGFFSYRKKNTNFCLDGGTGGANGQTVKLFTCGTNNQNQHWRKVNINGR
                     FRLEKRNAPGFSIDGGNGGARQQNVYLWASSNTNQNQQWSFDAVSGAKSLDDKSPETI
                     LYPNPAQHTVSVSNIEEFHTVTIFNIEGAKVLSTPLNNNNLDVSLLANGVYLLELTGD
                     TFKRVERIVINK"
     gene            complement(35176..35925)
                     /locus_tag="KQA_RS0201180"
     CDS             complement(35176..35925)
                     /locus_tag="KQA_RS0201180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177329.1"
                     /translation="MNKVHLEKKPPNKSKTGIMLAGHFTTALIAKQKFPKGSLLYFLI
                     IVQLQDFLWFIFHYLGLEPTTPSDAFDATLTNMAVDMLYSHDLLPQLVWFIIVFAIGK
                     FLFKSTQIGLVSILLVAVHFILDFFSGHMHHLFGADTMEAGLGLYASSPYLAIFIEAI
                     FSTGALWYFFTEETKKGIIRTRKNKLAIIAVFGYGIIFMLLIATRSFREILGIPEFDL
                     GFNTNMPTLIFTYGVMLYCLNYFVPKFKTIE"
     gene            36378..37034
                     /locus_tag="KQA_RS18270"
     CDS             36378..37034
                     /locus_tag="KQA_RS18270"
                     /inference="COORDINATES: protein motif:HMM:PF07685.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081483223.1"
                     /translation="MYPLSSLRFLHLFYSKDAFEIEKADIIIIPGTKNTLNDLHFLRK
                     QNIVQVILSHYEKGKKVIGICGGYQMLGQLIKDPHHVESDMNELSGLGLLPITTTLTK
                     EKKTVQQEFLFKNKKAICTGYEIHMGVTKGVKSSPLLKTKDGRTEGYVLDNNCWGSYM
                     HGILDNAVVIDDLLGSVSKNSPISYQEFKEKNYDLLADLLRDSLDMEYMYSQSKKQDD
                     "
     assembly_gap    37366..37433
                     /estimated_length=68
                     /gap_type="within scaffold"
                     /linkage_evidence="unspecified"
     gene            37791..38522
                     /locus_tag="KQA_RS0201195"
     CDS             37791..38522
                     /locus_tag="KQA_RS0201195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-nitrogen hydrolase family protein"
                     /protein_id="WP_010177333.1"
                     /translation="MKICIAQTEPIKGDILKNIENHKKLIMLSVKKGADLIVFSELSL
                     TGYEPELAQKLATTKDDQRFNEFQEISDVHKITIVIGLPTKNDQGTCISLILFQPNKP
                     RMTYSKAYLHPGEEKYFITGENLAPIPIGNHKVAFAICYETSITEHIEKAFNNKADVY
                     VASVLNTVSGVDKDIHRISEIAKKYTMLALMSNLVGESGGYDCAGKSSVWNKEGKLIG
                     QLDDTNQGIIVFDTATHQVMKVKDE"
     gene            complement(38595..40367)
                     /locus_tag="KQA_RS0201200"
     CDS             complement(38595..40367)
                     /locus_tag="KQA_RS0201200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177334.1"
                     /translation="MKLKSLLLFAFAMYLSSAIYAQRNDRGLNFGNTPLPNNLQSFAS
                     WDLITGLSDDFNHNNKNSAKFQDVWAQSYLPDPGFRGPGSTVWQGGNLVEVRNGRMEV
                     RARPGSGGLVNCGIVSSKRTIRYPVYMEARIKVSNIRNSSNFWMLNKCDNEEIDVLEC
                     YGGDPDEFYSKQMSTNFHLWHRRGGQSHAGAQTATNCGGQDLTDFTYQTFFTTSNNDF
                     WRNAFHTFGVYWASPTELEFYIDGQPRFDGQHFVPGRAARNLTGKFSDARLQCPNAAV
                     LNCTTEALLRNVQGQSGGGVPYPNRQFNDPTHIIIDTEAHAGRPVESVANLNNNNRNV
                     MLVDWVRVYRPNINGGGGGSTPPPPPPTANNDGAPIGSIISLRKSGGDRRFVSAVTEL
                     NNDLYANKTSVESNRQRFRVDRHRSGVVALYSLSARKYIQTNNSNQNVIVRARGNSDL
                     SWERFEWRNVGNNKVALRSLQVNKWVQAAWNQNNAALFPRGNAPLGWETFDWRRESGG
                     KILSSTEATETVAYPNPVLGGNDVFLEGINQGDTIIVRNSTGSALVNMVATDTTEVIP
                     TSNLASGIYFIQVNTGTSLKLIID"
     gene            complement(40752..44111)
                     /gene="secA"
                     /locus_tag="KQA_RS0201205"
     CDS             complement(40752..44111)
                     /gene="secA"
                     /locus_tag="KQA_RS0201205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="WP_010177335.1"
                     /translation="MGILDSVLKVFVGDKSKKDVKAIQPILDKIKKAEATLVNITNDE
                     LRAKTTAFKQIIIDAKADIVAQIDDLKVKANNTADIDAREDIYTEIDSLETKALEITD
                     KKLSEILPDAFAVVKETARRFTNNETVEVTASEYDRELSATKEYVTINDTNANWATSW
                     NAAGTLVTWNMIHYDVQLIGGVALHNGNIAEMHTGEGKTLVATLPVYLNALTGNGVHL
                     VTVNDYLARRDSEWMAPLFQFHGLTIDCIDNHRPNSEARRNAYNSDIVYGTNNEFGFD
                     YLRDNMSHAPEDLVQRKHNYAIVDEVDSVLIDDARTPLIISGPVPKGDIHEYDMLKPG
                     IASIVSLQQKFLTGVLAEAKKLIKEGNTKDGGFKLLQAYRGIPKNKALIKYLSEEGVK
                     QLLQKTENQYMQDNNRDMHLIDVDLYYVIEEKNNQIDLTDKGIAHISKEEDSDFFILP
                     EIAVEISKIEKLGLNAEEEAAKKEELFREYSVKSERIHTITQLLKAYSLFEKDVEYVV
                     MDNKVKIVDEQTGRIMDGRRFSDGLHQALEAKENVKIEDATQTLATVTLQNYFRMYHK
                     LSGMTGTAVTEAGEFWEIYKLDVIEIPTNKPIARDDRQDLIYKTKREKYNAVIEDVVK
                     IAQAGRPVLIGTTSVEISELLSRMLNMRKVKHNVLNAKLHQKEADIVAEAGNPGVVTI
                     ATNMAGRGTDIKLSKEVLDAGGLAIIGTERHDSRRVDRQLRGRAGRQGDVGSSQFYVS
                     LEDNLMRLFGSERIAKLMDKMNIEEGEVLQAKMLSNSIERAQKKVEENNFGTRKHLLE
                     YDDVMNAQREVVYKRRRHALYGERLKVDIANMLYELSESIAQGNNISQDYKNFEFELI
                     RYFAMPSPVTEQEFNSLNAEKLTGKVYHAALKHYQSKMEHTSAEVYRVIKQIYEDPNN
                     QFERIGVPFSDGIKSLNVGTNLEKAYNSEGKQIISDFEKNITLALIDDAWKTHLRKMD
                     ELKQSVRLAVHEQKDPLLIYKFEAFELFKSMLQGLNKEVISFLFKAELPSANPDDVQA
                     AEQHQQQEMQTQKEEIQNLEERTNQNRAIADAQHQQQQAPVETIVREEPKIGRNDKIV
                     IKNLMNGETKTLKFKQAIPLLEKGWVVVQKA"
     gene            complement(44280..44501)
                     /locus_tag="KQA_RS0201210"
     CDS             complement(44280..44501)
                     /locus_tag="KQA_RS0201210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003441576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2795 domain-containing protein"
                     /protein_id="WP_010177336.1"
                     /translation="MYWTLELASYLSDAPWPATKDELIDYAIRTGAPLEVVENLQAIE
                     DEGDSYDSIEEIWSDYPTDEDYLWNEDEY"
     gene            complement(44602..45171)
                     /locus_tag="KQA_RS0201215"
     CDS             complement(44602..45171)
                     /locus_tag="KQA_RS0201215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cob(I)yrinic acid a,c-diamide
                     adenosyltransferase"
                     /protein_id="WP_010177337.1"
                     /translation="MKIYTKTGDEGFTSLYGGKRVPKSNDRIDAYGTIDELNSFIGLL
                     RDQEISITHKNFLTQIQIELFSIGSILATPHNNQKKKLNIQKISIEEIEALENEIDHL
                     DTSLNPMTHFILPGGHVTVSYCHVARSICRRAERLAYALHHHEPLEKEVLIYLNRLSD
                     YLFVLARKLSKELTVEEIKWIPKKTNKEV"
     gene            complement(45295..45825)
                     /locus_tag="KQA_RS19395"
     CDS             complement(45295..45825)
                     /locus_tag="KQA_RS19395"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177338.1"
                     /translation="MSVLLKKSYWLFLLKSTNEHGVHSPFVYNLVTRCFYKPIKTSPL
                     PKNTIKNTPKQLKSKHILLLDRIICYFKINKIAGDFKNNHPITHLIKHQKKIDTTSSS
                     NADLIFISKNTHIARQIDELQPNALAIIELPHENKKKWNAIKTHKNAHVVIDTYFFGF
                     IFNRNQQAKEEFFIRL"
     gene            complement(45954..47834)
                     /locus_tag="KQA_RS0201225"
     CDS             complement(45954..47834)
                     /locus_tag="KQA_RS0201225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010177339.1"
                     /translation="MINFVSVENVSKAFGERVLFENISFGINEGQKIGFVAKNGTGKS
                     SLLNIITKSAPSDTGQVVYRKGLKVAFLPQEPNLDPQLSIEETIFTGDNESLQAIEAY
                     EKAVLNPEDADAFQAAFDRMDQAQAWDFETEYKQILSKLKLDNLSLKVASLSGGQKKR
                     LALTNVLLSKPELVFLDEPTNHLDLEMIEWLEEYFAKEKITLFMITHDRYFLENVCNE
                     IVELDHGKLYNYRGNYAYYLEKKEQRLTAEATELSKAKHLFKKELDWMRRQPKARTTK
                     SKSRIDDFFEIKKKAHQRRADHQVTLEINMERMGSKIIEFHKVSKSYGDLVITNKFDY
                     VFQRGERIGIIGKNGTGKSSFLNLLTGIELPDSGKVITGETIKIGYYTQKGIKVKEGQ
                     KVIDVIREFGDYIPLKKGRQISAGQLLEQFLFDRKKQHDFVEKLSGGERKRLYLCTVL
                     IQNPNFLILDEPTNDLDIVTLNVLESFLLDFPGCLAVVSHDRYFMDKIVDHLFVFEGK
                     GVIEDFPGNYSDYRAYENSPKTKKEPEATITPEVKQHKNSWKKEQKNTSLSFNEQKEY
                     NKIERELKKLELQKKEIEQQFATENFEGDALIEKSKELGKITNAIEEKEMRWMELAEK
                     MG"
     gene            complement(48109..49227)
                     /locus_tag="KQA_RS0201230"
     CDS             complement(48109..49227)
                     /locus_tag="KQA_RS0201230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177340.1"
                     /translation="MQKKQPLRNIFFFMLLTGTIISVKSQTRKYSNEFLNIGVDAAAF
                     GKSNAVVASTNDVNSGYWNPAGLINIKDKQLALMHASYFANIANYDYAAFATPIDDKS
                     AIGVSVIRFGVDDILDTRALITSGGDITPIEELPRFSTADYAFTLSYSRKPFNKNFSY
                     GVNAKVIRRVIGDFATAWGFGLDAGLLLTSKNKAWKFGIMVRDLTTTYNSWQIEDGIF
                     DNDLGDDPRGNGSINALNNQEAPETTEITLPSVRMGLNKTFTINRDIFIDFEADGNFR
                     FAQTNDVISNASFSISPAFGFEANFRKLIFLRGGVGNFQKVKQFDNTNELGFQPNFGV
                     GFHYKGVSVDYALTDIGDQSVSLYSNVFSLRIDWSLFR"
     gene            49319..50065
                     /locus_tag="KQA_RS0201235"
     CDS             49319..50065
                     /locus_tag="KQA_RS0201235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine synthase"
                     /protein_id="WP_010177341.1"
                     /translation="MSLKKQIPNIITLLNLFSGCIAVYFACMNQLFLAAVFTALGIFF
                     DFFDGFFARLFNANSELGLQLDSLADMVTSGVVPGVFMFQLLLESSAINDSFPIENIG
                     GNVIEWVPFLGFFVTLASCYRLANFNIDTRQTSSFIGLPTPANTLLIISIGLVSMYQS
                     SGIIEVLMDNVWVLLSIVALSCYLLNAEVRLFALKFKNWNIKDNWVRYLLIISSLVLI
                     LLFKYLGITLTILLYVLLSLIFSGEETNGV"
     gene            50150..50222
                     /locus_tag="KQA_RS0201240"
     tRNA            50150..50222
                     /locus_tag="KQA_RS0201240"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:50183..50185,aa:Gln,seq:ttg)
     gene            50318..50833
                     /locus_tag="KQA_RS0201245"
     CDS             50318..50833
                     /locus_tag="KQA_RS0201245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177342.1"
                     /translation="MSNTIVYEDRSKRFDENMIKGRIAETIVEQMFIRMGYDIYRYGM
                     ENTVPGIIQDLYNCKPKEVSDEIRKMPDFIIKNPNDNSVYYVEVKFRADGKFLLKELG
                     KNYPYKNAYILVVSKKHIRCVLYSELEESGELLMKKEYLLGYREDFKTNREIILYFCE
                     LAKKYFSCLES"
     gene            complement(51083..52114)
                     /locus_tag="KQA_RS19400"
     CDS             complement(51083..52114)
                     /locus_tag="KQA_RS19400"
                     /inference="COORDINATES: protein motif:HMM:PF01381.20"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_010177343.1"
                     /translation="MDTNKEYNSLLISKIRIKRLELGLTQSHLANKIGISPITFSHIE
                     SGRREIKVFEVVKLCKYLNIKIDEVLEICYNKIKISHNSEITSNKKLKNKVISFTSFK
                     GGMGVSTLSIILANEISKDYKLLFIDSHYQNSCYDKRALDLEVFPNIKPLYSIASIET
                     KELAKYIDQKKKDYDYIIIDLPRFFYIPDYIEEITNQSDFVISPFKGRGMLKKPFKNN
                     KDYLKHIAEGRLDLFIEYRNLFKNNDTVFSLIPFLVKIEDDEFDDYCSDQEIVLIPET
                     FKEFPEHDLFCDTLNPISNLENAYYNPFIVETLKVIFHLKSLVGADLIMEDLKHKSNA
                     KWQKILDKS"
     gene            complement(52362..53474)
                     /locus_tag="KQA_RS0201255"
     CDS             complement(52362..53474)
                     /locus_tag="KQA_RS0201255"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3872 domain-containing protein"
                     /protein_id="WP_010177344.1"
                     /translation="MNLLFKQFNILIKYHFNTLLIATLSIFLLACEDESTIIDSFPFQ
                     ISVTGTNEALLSETIQNELIILPENLVDSTVFSFSYNADDKGHYKIDGTKIQENTIYD
                     LSIKSLDYTLEFVPTEEGEIEIEIFVDDNKKHSATAKVIYSVTKELTDFKFSFTPLKE
                     EVLFGERTSLNLNIEQTSDELLTYTMNISSNSNGEINWIGYSNLPETISNLSKGNYVF
                     DYIPTEVIEKNNFTVTIVASNGVTKTKTFDGLTAEPVEFDFSLSKTVITINSGSINDF
                     INVTLNRPSFATGYFYDLDYYLRISTTTENILFNNGKIVFGENILLDNFSGIQNETFS
                     YSLNYSGNVVPGEVIFTVFNNTGFEVSKTVTVKTDF"
     gene            complement(53493..54197)
                     /locus_tag="KQA_RS0201260"
     CDS             complement(53493..54197)
                     /locus_tag="KQA_RS0201260"
                     /inference="COORDINATES: protein motif:HMM:PF10626.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177346.1"
                     /translation="MKKLFFSIAVIAMAQGAFAQNETELQKQSEETLHFQLNRLQMQN
                     KQIENELKLLQKSYSTRSFRLMKKEKSRKTTYASFETIIGITDNEGLGYQANFSIEID
                     TDKNKGLEMGLYYDNNDLLAKELEIPSEVFILNLGYTKQLSFLSNKTSTITTRFTIGG
                     AVGAELLNDGKDKLSNGAILETEDGLIYGGYTGIFSLFKINNNLSAVFRNSNFFTTSD
                     VSLHKFIIGAGIRYHF"
     gene            complement(54214..55617)
                     /locus_tag="KQA_RS0201265"
     CDS             complement(54214..55617)
                     /locus_tag="KQA_RS0201265"
                     /inference="COORDINATES: protein motif:HMM:PF02534.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraG"
                     /protein_id="WP_010177348.1"
                     /translation="MKLDFLKPKTPPFYLKSGRFSKHYRINNLNRGAIAVGGAGSGKT
                     YSYINPLLSYCVKHKGCITFDPKGELTPLINGIAKQNEKPIINFSLDNNFNTINVLSL
                     CEDKSDIIEFSSYFLSGIVGIPKNDAAKYFFNSAKSILTGTILFLRKKHPKFCSIPHI
                     IALFLTANPEQIIKLIFSDEEAKRSAQVLSSVSGDKKLLGSMMSTFTAFFASLDVPRI
                     FRNLLSDTDLPLPNDPNNPSIINLIFNLQKRDIYSPIYSSIIGLILKKMNIPDQHESA
                     VIIDEFTVLSIPNFSNIPETARSNKIATCIAIQDFSQLVLKYGKEEASSIIANMGSQF
                     LFRTTSPETLDHFQKTLGKREVEKTSISEKQGGLSLDGPTHSYSSIERDILRREKVIN
                     YKAGMCTAIIAEGNERLIEGKRLNGNHYLKKIKPIPIQPQKNIDEQRAYEKVYSDINF
                     LLKKSTTTPTLTKKFNL"
     gene            complement(55614..56273)
                     /locus_tag="KQA_RS0201270"
     CDS             complement(55614..56273)
                     /locus_tag="KQA_RS0201270"
                     /inference="COORDINATES: protein motif:HMM:PF01076.17"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177350.1"
                     /translation="MSYAILRLNKIKSLSGSLGNHIDRCTSDGELCYPSNIQDRAILN
                     NIHWDKNGQSYTQKEWANYCKKTPFQDRIQNEIKSRYKIQKNIRKDAVKAIDYIMTSD
                     NAKMAEIFSDENLVQSWMKDNKTFLSETYGEENVLSMHLHLDETTPHLHAVIVPITND
                     GRLSAKEFINGRKSLAEQQTRYAELMEKYGMQRGEAGSKTKHEQLWKKDKPQHTQIYE
                     R"
     gene            complement(56378..56950)
                     /locus_tag="KQA_RS0201275"
     CDS             complement(56378..56950)
                     /locus_tag="KQA_RS0201275"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177352.1"
                     /translation="MIVDFKKSETQLKKQNMIPSRMKLQLLQLLVRNVMILFFPIAII
                     SGLFFLFAESLTTESLQCLKETNLRGKKAFYFLLRNLDFNLKNLSISLCNIVLFSFLK
                     FQKKYNWKDAFYKTSLLGVLQLIIYSCYSIAMSNKKQGIVLGEHDLLRIYFETDKIFY
                     AWYIPLGWIAIYYFILYTKKGGQIIHNRYF"
     gene            complement(56934..57707)
                     /locus_tag="KQA_RS19405"
     CDS             complement(56934..57707)
                     /locus_tag="KQA_RS19405"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177354.1"
                     /translation="MKNSLGQQAKIQMGLETEEERKKRIELKKEETKKSNQYFDSLKE
                     KNKPRPLTPIPTQWIKKQIWVEGKKYFASKGRYFNVDSENKLFLDIISRYFSDDIEFE
                     KITNGELRKGLLIYGECGTGKSSIFDIIQSISLKYDLKQIYFKNTSVHTVITEFNKES
                     KAYGNGGESVIEKYSRGTIHFDDLGTENQVQAWGIKEELFDRILQIRYNNFKNLGKKT
                     FVTTNLSIEKLEKRYSPQVKSRLYEMFNIIPLTGNDRRF"
     gene            complement(57704..58135)
                     /locus_tag="KQA_RS18290"
     CDS             complement(57704..58135)
                     /locus_tag="KQA_RS18290"
                     /inference="COORDINATES: protein motif:HMM:PF13730.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_010177356.1"
                     /translation="MEKSKPNYYAILPAEIRYDKRLSPAAKILFAEITALTNNHRICW
                     STNKYFEELYQVSKQTINNWLLQLEECGYIERFIYRADGSKEILHRYITIFSHPSKIN
                     LNRPIQEILNDNNTSINNTSNNYLKKKNSKRKFINANPRKK"
     gene            complement(58236..58538)
                     /locus_tag="KQA_RS0201290"
     CDS             complement(58236..58538)
                     /locus_tag="KQA_RS0201290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_010177358.1"
                     /translation="MSNPILYGFSKKDLEHTIELVVNRLRKTELIDESSANPEEDRLT
                     QTEAADLLGVSVQCLIKWKKKELIPYYKIGRTVFYSKKELLTQARKNSKLVKASRK"
     gene            complement(58677..59789)
                     /locus_tag="KQA_RS0201295"
     CDS             complement(58677..59789)
                     /locus_tag="KQA_RS0201295"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177359.1"
                     /translation="MYNIEYIKKMVTSLEWLDTNSEKETPEFYLVKGMIANLPFLDRI
                     KLLGSILGMPEDNDLLSLPFTPGHFNLFFDLEYCRIHPHTNELLIYDKLMLDEANYNY
                     SQGDDSALEAFNWLHQPENIDHLEINNYHVRIQQKIVSKIYLTGNNFNNGETDPDSIL
                     EILYGITTGLQYRKFLLKKYKEPIVNHSSKYMHPTIANDFLTLENKKITNKSLLDLTE
                     STIWELLTQLQSNEDLKSNQDYLTQIINIDTSTISKQNLSKFIKRFFEEYCTLLPINS
                     NDFFDFLFVKQSFNHERLDLNRDQLEKIMEMFLFLSEKNALKKSKKIQIIRNLHSYFN
                     TKLSIPMLKKIYNKSTTHPKKNTLLNYSMSWKELSI"
     gene            complement(59792..61027)
                     /locus_tag="KQA_RS0201300"
     CDS             complement(59792..61027)
                     /locus_tag="KQA_RS0201300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
                     /protein_id="WP_010177360.1"
                     /translation="MQVSFTLRKDKINKDGFIPVRMIITLNGERIRRNVKSVRTKQKD
                     WKNQRVKANLKNEDYNFHIEFNKELDELENKLKLIHRHALLNNIPLTKEYVIDKLEND
                     SINSNSIAPSFFESFQEFIDTNKSTKANGTIKKYISCKNFIKDFDVAKKYNLRFDNVD
                     VNFYEDFRDYAFEERNTLNNYYGRIISVLKTFMNWSYERKYHENLEFKKFKTVSNTIE
                     VIYLTMDELMKLYNYEFESKRLEHVKDFYCLGCFSGLRFSDIKQLKPSNIYEDYLKLN
                     VQKTKTIDHKIPLNAFSKAILNKYKDTLYEPIPKISGQKFNQYIKECCKIVGIDTPVN
                     TTRYIGQKRVDKVFPKHQLITSHTARKTFVTNSLILGMKEMVVRNITGHKDESSFKRY
                     VEIADDFKKNEMDNTWNKI"
     gene            complement(61082..61381)
                     /gene="higA"
                     /locus_tag="KQA_RS0201305"
     CDS             complement(61082..61381)
                     /gene="higA"
                     /locus_tag="KQA_RS0201305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module antidote protein, HigA family"
                     /protein_id="WP_010177361.1"
                     /translation="MEKQMNVHPGEMLREDFLKPMGITAYKLAKSIGVSDSRVGKIVR
                     EEMGISGEMALRLSKFFGNSPEFWSNLQSFYEIRKAQIEKEDDINKIQPYTKQAV"
     gene            complement(61394..61675)
                     /locus_tag="KQA_RS0201310"
     CDS             complement(61394..61675)
                     /locus_tag="KQA_RS0201310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007656040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid maintenance system killer protein"
                     /protein_id="WP_010177362.1"
                     /translation="MIKSFGDKETEKLFAGHSSKKIDASIQKKAFRKLVQIHSSKDLN
                     DLTIPPGNRLHQLQGNLKEYHSISINMQWRIIFKWNNHNAYDVEIIDYH"
     gene            complement(62063..62890)
                     /locus_tag="KQA_RS0201315"
     CDS             complement(62063..62890)
                     /locus_tag="KQA_RS0201315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_010177363.1"
                     /translation="MKNILVPTDFSSDAYNALSVAAQLARKNDSTIHLLHLLELPSHI
                     NDPILGSNGNFPEAILFMKNIHSKFKELIDSPLLEGLKTHEDVNTQPIPQGIIKSCND
                     NEIDFIVVGSHGKEAFSDLFVGSNTEKIVRTANTPVLVVKEPTNIKNVKNIVFACNFK
                     DEEVRSLNALHEFSEEVNAKIHLLYINTPRNFKTTHAIEEEMKAFLSKTPFKKDNLHI
                     YNDTTIERGVLNFSNDINANLICVDVHERKGLSHFINGSISEDLINHTQIPILTYKL"
     gene            63049..63513
                     /locus_tag="KQA_RS0201320"
     CDS             63049..63513
                     /locus_tag="KQA_RS0201320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177364.1"
                     /note="in Streptococcus pneumoniae this gene was found to
                     be essential; structure determination of the Streptococcus
                     protein shows that it is similar to a number of other
                     proteins; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome assembly cofactor RimP"
                     /protein_id="WP_010177364.1"
                     /translation="MFKQKVESLLEEALVERSNLFLISFQITGANIIQVILDGDEGVS
                     VDDCIEISRAIEHNLDREEEDFSLQVMSAGITEGLVHIRQYPKNIGRTLNVVTEKEEI
                     EGELIATTADDFTLQWKAREPKPVGKGKVTVQKTKVIPYGEVKKAHVVVKFN"
     gene            63522..64754
                     /locus_tag="KQA_RS0201325"
     CDS             63522..64754
                     /locus_tag="KQA_RS0201325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008638810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination
                     protein NusA"
                     /protein_id="WP_010177365.1"
                     /translation="MENIALIDSFSEFKDDKSIDRVTLMSILEETFRSALKKKYGSDD
                     NFDIIVNPDKGDLEIWRNRIVVDDGEVEDENQEISISEARKIEPDFEVGEDVSEEVKL
                     IDLGRRSILALRQNLIAKIHEHDNTNLYKQFKELEGEMYTAEVHHIRHRAVILLDDDG
                     NEVILPKEKQIPSDFFRKGENVRGVIEKVELKGNKPSIIMSRTAPSFLEKLFESEIPE
                     VFDGLITIKNVVRAPGEKAKVAVDTYDDRIDPVGACVGVKGSRIHGIVRELGNENIDV
                     INYTNNVQLYITRALSPAKVTSVKINEETKRAEVMLKPEEVSRAIGRGGHNIRLAGML
                     TGYEIDVFREGVEEDVELTEFSDEIDAWIIEEFSKIGLDTAKSVLEQDVADLVKRTDL
                     EEETVNEVMRILKSEFDD"
     gene            64811..67666
                     /locus_tag="KQA_RS0201330"
     CDS             64811..67666
                     /locus_tag="KQA_RS0201330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="WP_010177366.1"
                     /translation="MAGVNNMRLNKVLREFNISLDRAVDFLSAKGHEIDARPTTKISA
                     EIYQLLTDEFQGDKSKKVASKEKGEEKRKEKEAIRIQIETEQEEKRKKAQSNEVVKAK
                     AKLDGPKQVGKIELNKPNQEAAPKTSSKPEPVTETEKEAPVKKEVPVKKEVATPKKEV
                     EKAPEEPQVVSNRPKKQGIKITGQAPIAKPVKPKVAKVDEEKAKAAPAAKQAAASPAA
                     TSGPKHAEVGDAPSEKVKTQYKKLDGPNFTGQKIDLSQFKKPEKKKDDKSSSNDANKR
                     KRKRISKGPNQGQGGGRGGNNRGGGKFQPRGKRAPIVKAEPTEEEVQKQVRETLEKLQ
                     GKSGKGKGAKYRRDKRDQHRQKTEEDQAAQAAESKVIKVTEFVTASEVATMMDVSVTQ
                     IISACMSLGMMVTMNQRLDAETLTIVADEFGYTVDFVTADIEQAIEEVVDAPEDLLER
                     APIVTVMGHVDHGKTSLLDYIRKENVIAGESGGITQHIGAYGVQLDSGQKIAFLDTPG
                     HEAFTAMRARGAQVTDIAIIVIAADDDIMPQTKEAISHAQAAGVPIIFAINKVDKETA
                     NPDNIKTKLAAMNLLVEEWGGKIQSHDISAKTGLGVKELLEKVLLEAELLELKANPNR
                     IATGTVVEAFLDKGRGYVSTVLVQSGTLKVGDYLLAGKNSGKVKAMQDERGNRVLEAG
                     PSTPVSVLGLDGAPQAGDKFNVMDDEREAKDIASKRAQLHREQSVRTQRHITLDEIGR
                     RIALGDFKELNIILKGDVDGSVEALTDSFQKLSTDEIHVNIIHKAVGAITESDVLLAS
                     ASDAIIIGFNVRPAGNARMVADKEEIDIRMYSIIYDAINDLKDAMEGMLSPEMKEEIT
                     GTAEIRQTFKISKVGTIAGCMVLTGKIFRNNQIRLIRESVVIYTGELAALKRFKDDVK
                     EVAKGYDCGMQVKNYNDIKEGDIIEAFQEVAVKKKLK"
     gene            68080..68574
                     /locus_tag="KQA_RS0201335"
     CDS             68080..68574
                     /locus_tag="KQA_RS0201335"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177367.1"
                     /translation="MKKINLLPLVLLALLLSNCSNDDDNSNSKEMDFSGDWIGTKFLV
                     NEAYDFNNDGIPSRDYKIELPCLIQNITLNPDGTGLFKANIHGQAEGQTTPFPLTCVE
                     YEENPMTWSLNEEETKILLRFSETVVEEFPIVSEVVIERFSESLLDDTIGIPGKVVYE
                     KQTK"
     gene            complement(68682..69083)
                     /locus_tag="KQA_RS0201340"
     CDS             complement(68682..69083)
                     /locus_tag="KQA_RS0201340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SPOR domain-containing protein"
                     /protein_id="WP_010177368.1"
                     /translation="MKDRFNFFSFLFLLLSIASQAQNSSDNANSETNSPATININVDP
                     NIEKLVKTKFSENNKDNYKIQLYYGNLNKAHAVLSNFNTKFTDWPGKIEYETPNYKVW
                     VGNFQTRLEADRALMKISKNFPHAFIFKPEK"
     gene            69304..70596
                     /locus_tag="KQA_RS0201345"
     CDS             69304..70596
                     /locus_tag="KQA_RS0201345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c"
                     /protein_id="WP_010177369.1"
                     /translation="MRQVKHRNSVSKLLLLGLAFLLTFSTTTTAFAQADAGKGKELFN
                     SLCAACHKRYKKATGPALFGVTERHSTEWLYKWIKNSTALIASGDAEAIEIYEQYNKT
                     PMNSFPQLSNADIDNILAYVMEPKAAPAPGAVPVGGAQKATDDSGSGSVNSWVLGLLA
                     VVLLVLVGVLFMVNKTLRQFAKANNIDLPVKEERKPIWKAFIENQFLLLVSAVFLLLL
                     SGYFVYGYLMQVGVDQGYEPVQPIHYSHRIHAGDNKIDCKYCHSSARVSKHSGIPSLN
                     VCMNCHKSIGEVAEATQAEGLAEYGVDYNKQIQKLYKAVGWDADKQAYTGKTEPVKWV
                     RIHNLPDFAYFNHSQHVMVAGVACQKCHGPVEEMEIMYQHAPLTMGWCINCHRETNVK
                     VEGNAYYEKIHEELSKKYGVDKLTAAQMGGLECGKCHY"
     gene            70695..73790
                     /locus_tag="KQA_RS0201350"
     CDS             70695..73790
                     /locus_tag="KQA_RS0201350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S dicluster domain-containing protein"
                     /protein_id="WP_010177371.1"
                     /translation="MSSNKKYWKSVEELSDSSMVEALKQNEFSEDIPVEEFLGDKEML
                     DESSTSRRDFLKYVGFSTAAATLAACEGPVVKAIPYVVQPEQIVPGVANYYATTIADG
                     FDFANVLVKTREGRPIKIESNRLAGANGAANARVHASVLSMYDNTRLKTPQIGGKSTD
                     WAKFDKQLASKLSGVSGKIVLLTQTFASPSTDKLIGEFASKYPNVSHVIYDSVSNSEA
                     LAAYEQVYGVRGLADYDFEKASTIVSVGADFVGDWQGGGYDAGYAKGRVPQHGKMSRH
                     VQFEANMTLSGANADKRIPTTPSQQKQVLAALYGYVMGYAVNASLPAPINEAAKKAAQ
                     QLKAAGSKAVVVTGIQDKDAQVIALAINNKLGSKVFNAERPKLTSQGDAAKVNALVAD
                     MNAGKIGALLIAGVNPVYSLPNSKEFVSGLKKVGVTVSFASSNDETAALCEFVATTPH
                     YLESWGDVEINKGVYSLVQPTIRPLFKTRQFQDTLLQLIGSGLTYDAYMKNVWKSSIL
                     GGASFNKALHDGVFKTAVVSSVAAEGDVEEGAEAAAFTSSFATSVRSLTSAKAKGLEL
                     TLYTKTAMGSGNQAVNPWLQELPDPLTRASWDNYLTVSKADAASLGLENKNVANGALN
                     GSYATVTVGGATLENVPVIIQPGQAKGSVGLALGYGRKQGLKEEMQVGVNAFSLYQNF
                     NNVQSVKVDKAGGEHEFACVQLQKTLMGRGDIIKETTLEIFNTKDKPVYNPTPMVSLD
                     HEETPVTSPDVDLWDEFDRTIGHHFNLSIDLNACTGCGACVVACHAENNVPVVGKSEV
                     RRSRDMHWLRIDRYYSSEETFEGDNETKDGFDGLGDSLSGFGELEVASENPQVAFQPV
                     MCQHCNHAPCETVCPVAATSHGKQGQNHMAYNRCVGTRYCANNCPYKVRRFNWFLYNQ
                     NDEFDFHMNNDLGRMVVNPDVTVRSRGVMEKCSMCMQMTQKTILDAKRDGRVIKDGEF
                     QTACSNACVSGAITFGDINDKSSKVAKSLEGDRMYHLLEHVGTKPNVQYQVKVRNTKE
                     A"
     gene            73824..75272
                     /locus_tag="KQA_RS0201355"
     CDS             73824..75272
                     /locus_tag="KQA_RS0201355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_010177372.1"
                     /translation="MSHYEAPIRRPLVTGDKSYHDVTLDVVAPVEGKANKQWWIVFSI
                     AFVAFAWGLGCMTYTISTGIGTWGLNKTVGWAWDITNFVWWVGIGHAGTLISAVLLLF
                     RQKWRMAINRSAEAMTIFSVMQAGLFPIIHMGRPWLAYWVLPIPNQFGSLWVNFNSPL
                     LWDVFAISTYLSVSLVFWWTGLLPDFAMIRDRAVTPFTKQIYSVLSFGWSGRAKDWQR
                     FEEVSLVLAGLATPLVLSVHTIVSFDFATSVIPGWHTTIFPPYFVAGAIFSGFAMVNT
                     LLIIMRKVCNLENYITLQHIELMNIVIMLTGSIVGVAYITELFVAWYSGVEYEQYAFL
                     NRATGPYWWAYWSMMTCNVFSPQFMWFPKLRRSIMFSFFISIVVNIGMWFERFVIIVT
                     SLHRDYLPSSWTMFSPTFVDIGIFIGTIGFFFVLFLLYSRTFPVIAQAEVKSILKSSG
                     EKYKKLREAGKPTYERAEGIVELLADSQDDHH"
     gene            75292..75819
                     /locus_tag="KQA_RS0201360"
     CDS             75292..75819
                     /locus_tag="KQA_RS0201360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3341 domain-containing protein"
                     /protein_id="WP_010177373.1"
                     /translation="MASKVVHAYYLDDEVLMDAVKALKIKHYHIEEVFTPFPVHGLDK
                     LMGLPHTRLAICSFLYGLVGLTVAVTMMNYIMIEDWPQDIGGKPSFSYIENLPSFIPI
                     MFELTVFFAAHLMVITFYMRSKLWPFKKAENPDERTTDDHFLVEVDASHTNVDELTAF
                     LKDTGAVEINLKDKE"
     gene            75824..76612
                     /locus_tag="KQA_RS18295"
     CDS             75824..76612
                     /locus_tag="KQA_RS18295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c"
                     /protein_id="WP_010177374.1"
                     /translation="MRTLINSLFAFAAVALVTSCNSKKKPNYQYFPNMYESVGYEAYS
                     SHEVFADNNTSEALLPVEGTVKRGWLPYDYTNSPAGYASAKAGLKNPLPYTKENAAKG
                     KALYDIYCAICHGGKGNGKGTLVKREKILGVPSYDDPGRNITAGSIYHVMYYGINSMG
                     SYAAQTSIEERWQIAQYVESLKASLEGKKPRIDKVSGSKSDVSIVDALLANTEGYYSS
                     DVEFEGEFDEHSEIKEDVKDKVSYSKKDLLGGKSHHSHKEAGKK"
     gene            76642..78027
                     /locus_tag="KQA_RS0201370"
     CDS             76642..78027
                     /locus_tag="KQA_RS0201370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinol:cytochrome C oxidoreductase"
                     /protein_id="WP_010177375.1"
                     /translation="MYTLSKNLKLIPIILMVVGAIGLAIGFTTTPSTIEEVKEQLASH
                     HDAHGAAHAPAAAHGAHDKAEHGHGHDTHKAADTHGAHAAKSHDAHDSDKHYEHVLHQ
                     LQNKPWAALYVAAFFFFMIALGVLAFYAIQFAAQAGWSPLLLRVMEGITAYLLPGGII
                     LFVILALSGFHMNHLFVWMDPEVVAHDELIQGKSGWLNVPFFLIRAAIYIGVWSLYRH
                     FAVKYSRNQDESPEGNVWYKKSFKLAAVFLVFFIYSESMMSWDWIMSFDPHWFSTLFG
                     WYVFASLFVSGITVIALVTIYLKSKGYLEQVNDSHIHDLAKFMFGISVFWTYLWFSQF
                     MLIWYSNIPEEVTYFITRINDFKLPFFGMLIMNFLFPILLLINSDYKRINWLVVMGGI
                     VILLGHYIDVFNMVMPATVGKSWFIGISEISAVLLFLGIFIYVVFNALTKAPLVPKGN
                     PLLEESKHFHY"
     gene            78061..79119
                     /locus_tag="KQA_RS0201375"
     CDS             78061..79119
                     /locus_tag="KQA_RS0201375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="WP_010177376.1"
                     /translation="MTIFLILLVVALLGITFWQLSKILELSQGSADNSQVANDKDNSM
                     QGKLMLAFVGFLYFLTVWCFVKYDSYFLPEAASEHGTDYDRLMMISVVLIMFVQIITQ
                     GLLHFFAYKYRGKKENKATFFADSNLLEIIWTAIPIVTLAALIIYGLYTWVDIMSIDD
                     DEDALVVELYAYQFDWRARYAGADNELGKANVRFIEGVNILGVDASDNYAQDDIIVNE
                     LHLPVGKKVIFKMRSQDVLHSAYMPFFRAQMNVVPGMITEFSYTPTKTTEEMRTSEFM
                     VEKVETINTIRKAKSKDLLAKGEEALEPYEFDYYLLCNKICGASHFNMQMKIIVESEE
                     DYNNWIAEQKTFRQVVSK"
     gene            79229..81016
                     /locus_tag="KQA_RS0201380"
     CDS             79229..81016
                     /locus_tag="KQA_RS0201380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome-c oxidase"
                     /protein_id="WP_010177377.1"
                     /translation="MSADGHGHHKETFITKYIFSEDHKMISKQYLITGLLMGIIGIAM
                     SILFRMQIAWPEQSFAIFEVLLGKWAPDGVMDPNVYLALVTIHGTIMVFFVLTAGLSG
                     TFSNLLIPLQIGARDMASGFLNMVSYWLFFLSSIIMVFSLFVEAGPAAAGWTIYPPLS
                     ALPQAMPGSGMGMTLWLVSMAIFIASSLLGSLNYVVTVINLRTKGMSMTRMPLTIWAF
                     FVTAIIGIVSFPVLLSAALLLIMDRGFGTSFYLSDIFIKGEVLHNQGGSPVLFEHLFW
                     FLGHPEVYIVLLPALGITSEIIATNSRKPIFGYRAMVGSIIAIAFLSTIVWGHHMFVS
                     GMNPFLGSVFTFTTLLIAIPSAVKSFNYITTLWKGNLQFNPGMLFSIGLVSTFITGGL
                     TGIILGDSTLDINVHDTYFVVAHFHLVMGISALYGLFAGVYHWFPKMYGRMMNKNLGY
                     VHFWVTAIGAYGVFFPMHFVGMAGLPRRYYTYTNFPYFDDLADTNVLITVFAIITAAA
                     QLVFLYNFISSIFYGKKATQNPWKSNTLEWTTPVEHVHGNWPGELPTVYRWAYDYSKT
                     NADGEYVIAGQDYAPQVVPLQENEEELHH"
     gene            81126..82148
                     /locus_tag="KQA_RS0201385"
     CDS             81126..82148
                     /locus_tag="KQA_RS0201385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013070095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction branch migration DNA helicase
                     RuvB"
                     /protein_id="WP_010177378.1"
                     /translation="MNSNLDATGENFTPQEHDIERALRPLSFGDFAGQSQVLENLEIF
                     VKAANMRGESLDHTLFHGPPGLGKTTLAHILANELGVGIKITSGPVLDKPGDLAGLLT
                     NLEPRDVLFIDEIHRLSPVVEEYLYSAMEDFKIDIMIESGPNARTVQIHLDEFTLIGA
                     TTRSGLLTSPMRARFGIQSRLQYYTTELLAGIVERSASILNVPIDERAAFEIAGRSRG
                     TPRIANALLRRVRDFAQIKGNGSIDIEISRFALKALNVDAHGLDEMDNKILTTLIDKF
                     KGGPVGITTLATAVSESAETIEEVYEPFLIQQGFIMRTPRGREVTELAYTHLGKTRGS
                     VQGGLF"
     gene            complement(82220..84760)
                     /locus_tag="KQA_RS19410"
     CDS             complement(82220..84760)
                     /locus_tag="KQA_RS19410"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177380.1"
                     /translation="MKNLLLFLSMTVCLFTTGNAQIIDFPDPNFKAALLEITYNDNGT
                     WYSLDRNNDGQIDSQEASYIKRINLNLKNLTSVKGIENFTKLEELSLFSNNIQEIDIS
                     NNKLLQKFNIGKNPITNLDVSQNINLKELIISITQISSIDITKNVKLEELAAHEANLS
                     VINLSKNILLKNLSLFSNNFSQIDVSNNSKLESLFLSNNIITELDVSQNPELKTLYVR
                     NNQLTNINITNNPKLERLNIGINQITELNVNNNTLLELISAGQNQISTINVTNNKELI
                     YLYLNNNKINTINLSENTKIQYLHLNSNLLETIDVRKCQLLNFHFDSNRNLKKVYMTG
                     QPFQFRANGEINIRLYNNRQNLEFICADQQYLSAIYELLKEANQTDVLLSNDCETPHN
                     RISGSVTYDNESDGCDNQDEAFTESVSFSLAGPAGFYTVFPDREGEYTFHVPDGNNYL
                     MFNNIANSAYFTFFPTIIFDPINDSFNIPEQIDSITTDFCIQPVGVFNDLEISIIPLT
                     RARPGFSAIYKVTYKNIGTTTQSGEVTLTYQNDVLTYSTASPTIDSNTNGLLTWSFTN
                     LAPMQSKDIIVTYRLNTPTDSPALNNGDILNYTAKVTASLDEETPENNIAKLTQTVVN
                     SYDPNDKTCLEGDILDPDDVGEYLHYLIRFENKGTAEAVNIRVQDDIDTTKLDIKSFS
                     PLNSSHLFTTTVTNNKVVNFHFNNINLPFDDANNDGYVLFKIKSKDNLVEGDQIVNGA
                     GIYFDFNPPVITEDEIVTVKREVIEVPTFSDYFSLTPNPTTGIINLELLDTNIKPTTI
                     TLYDINGNIVGFFPGIMRTMNISYLFPNTYFVKIQTNKGLFTTQLIKL"
     gene            complement(85166..86449)
                     /locus_tag="KQA_RS0201395"
     CDS             complement(85166..86449)
                     /locus_tag="KQA_RS0201395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen translocase"
                     /protein_id="WP_010177382.1"
                     /translation="MPGIKNYTPNKQLLKVMSINSIAVLVRLVTGFILSKAIAIFIGP
                     QGLGIIGNLRSFINSIQTIASLGFYNGVVKYVAEHKNNIKELSKILSTSYYLGFIAML
                     GTSMILYFFAPFWSSYVLNSSDYAHVIKILAAGISLMIVDYFCLAIINGFSRYKVYTI
                     LNITTTVFSLIVTVILLWQYRLEGMLYAIVITPALALFITLIIIFKQKSFVQLLKASN
                     ISWDYSKKLIEYSLMALLTAVIIPPTIIAIRNHIVDVEGLTQMGYWEAMNRISNYYLV
                     FVTSLLSLYLFPKLSAVKTTKQFKQEIFSFYKTLMPLVIIGLLILYFFRVFFIKLLLT
                     SEFLPMQRLFSWQLTGDFFRILSSVLAYQFMAKKMTKSYVFTEILSAVIWYFSSIYFI
                     NNYGYEGAAIGYLVCYSSYFFVLVIWFRKYFFTKE"
     gene            complement(86437..87555)
                     /locus_tag="KQA_RS0201400"
     CDS             complement(86437..87555)
                     /locus_tag="KQA_RS0201400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DegT/DnrJ/EryC1/StrS family aminotransferase"
                     /protein_id="WP_010177384.1"
                     /translation="MRIPFLNLHKLNKRFENNFKSQFDTFLTSGHYILGTKLTEFENA
                     FASYCNVSFCIGTGNGLDALTLILKAYIELGKLNIGDQVIVPANTFIATLLSVKQAGL
                     IPVLIEPDEDSFIINVRNVQQKITPKIKAIITTHLYGQVYGMDELKEFCSNAQLLLIA
                     DAAQAHGAIDQNGNKAGSIAHAAAFSFYPSKNLGALGDGGAITTNNTELANCIKKLRN
                     YGTSEKYRNELIGINSRLDELQAAFLIEKLNLLDDDNNKRREIALRYSNEITNENIKL
                     PFWNGSKNHVFYVYVIRVKNRINFCNYLNENQIGHMIHYPIPPHKQKALTNEFKNQSF
                     PITEKISNEIVSIPLNPILEVSEIDYIIQVLNNYTCQE"
     gene            complement(87583..88692)
                     /locus_tag="KQA_RS0201405"
     CDS             complement(87583..88692)
                     /locus_tag="KQA_RS0201405"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177385.1"
                     /translation="MKFKFSILHISLIVPISIFLGMIITQYKLFPYNQLRNINQNIKL
                     KILKKNAYDVTDLHVPNLDSILSVTKDNYTEIRAELRKTIFGNKTSSYKIKKNIFDKD
                     YNNLENLANIDKVYIEQSYHINSIAYIFYPKKSNGKSFIYHQGHRGNFLLGKKTIHFL
                     VKQGFTVAALDLPLVGFNNTPSIYLKKFGNVVLNNHKFMEHLDDPISFFINPIINILD
                     ILESKGYNEINMIGISGGGWATTIAAAIDERIKNSFPVAGTYPMYIRFQDPYLNYGHF
                     EGAHSALFKKVNYLDMYILSCLGENRKQYQILNLYDPKCCSGYMYKSYASFVEEKVKK
                     LSPSSEFKVIIDSTHFEHKISEFSHQIIEKKLFKK"
     gene            complement(88682..89632)
                     /locus_tag="KQA_RS0201410"
     CDS             complement(88682..89632)
                     /locus_tag="KQA_RS0201410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177386.1"
                     /translation="MIQQYTVKKYNKTHYQSWNTFIENSKNSTFLFHRDFMEYHNDRF
                     EDHSLLVLRKQTIVALVPANKNDTTFYSHQGLTYGGLLLLKSIGVTKVETIFLTIIEY
                     LKRNQFSTIRIKTLPVFYHKAPSFELESLFLKLGAKIFRREQNFAIDYNLPFEIHKTK
                     LKNYKKNQHLNFKIIETDNFTDFWEEILKPRLKTKHNAKPVHTESEILFLKSKFPNNI
                     KQFNIFLENKLLAGITIFKTDTVVKSQYGATTNDGEKLRALEFLFIYLIKKYKSEGYK
                     FFDMGIIAGNISLLKQKEELGCNQYLQDFYQLSIDQTNEV"
     gene            89825..91123
                     /locus_tag="KQA_RS0201415"
     CDS             89825..91123
                     /locus_tag="KQA_RS0201415"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177387.1"
                     /translation="MFKVMIKKITFLFYILFFIFNVVVVIDKGYVFTYDTASYLYIRP
                     NVQPAYSIFLNIVKRIFGINYKEATIGIQLLMSYLTMLYFSEVLKKYFKFNSVVMILL
                     FMLLTYPIYGSYGMCNKLVTKSLSTTFFLFFMASSVKWFFTKKNKHIFFMITFLVLLQ
                     LTRAQFLSISIALVLFVFYMWSLKELKKKMILVVLILSIPLISGLLEKTIYGVFHGHY
                     TSRQLGNVSISTLPFYLSELQDYKLMPDEEVVQYFRCVHGSLEEKKLLLCQLPKNSSL
                     KEKHQFYHDNYPKIMNQTIEYEAKSMYRGKEMSYAASYKNVDRIVGKTLIPLFMARPL
                     AWSEMFYMNLAFPYYSIIPVIFLILLVSYLFFKKKSKILQFQGLIYFFSLLILGNLFL
                     ISISLHCIRRYFMYYDIVFALLALLLLCNFRPIKKYIMQV"
     gene            complement(91197..91787)
                     /locus_tag="KQA_RS0201420"
     CDS             complement(91197..91787)
                     /locus_tag="KQA_RS0201420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177388.1"
                     /translation="MKNLFFSSLLTLVTLFIVSCSGDDAGAPIKPVIDLVDENLVGKW
                     KLTNFEVSNGTVDLKVDETTIEIPFTTEGSEFNTTALFETTPNKVTFDGTFKANTNFV
                     TPLMINQPTTREDTFESSKILGGTSTLNDWSISEGDSVIAGSKAEIIKFTKNEIQYKL
                     DIAQTSFISIIEEGFDLNGFTTTNPKGQIIVTLEKI"
     gene            complement(91871..93673)
                     /gene="typA"
                     /locus_tag="KQA_RS0201425"
     CDS             complement(91871..93673)
                     /gene="typA"
                     /locus_tag="KQA_RS0201425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translational GTPase TypA"
                     /protein_id="WP_010177389.1"
                     /translation="MSNTIKNIAIIAHVDHGKTTLVDKIMYHCQLFRENENTGDLILD
                     NNDLERERGITITSKNVSVTYKGTKINIIDTPGHADFGGEVERVLNMADGVLLLVDAF
                     EGPMPQTRFVLQKAIDLGLKPCVVVNKVDKENCTPDEVHEKVFDLMFELGAEEWQLDF
                     PTVYGSAKNNWMSTDWKNQTENIEPLLDMVLEHIPAPKFDEGTTQLLITSLDFSSFTG
                     RIAIGRLQRGSLVEGQQVSLVKRDGSILKSKIKELHSFEGLGRKKVSEVQVGDICALV
                     GLEGFDIGDTVADIENPEALKTIAIDEPTMSMLFTINDSPFFGKDGKFVTSRHIKDRL
                     TKELEKNLALRVNETDSADKFLVFGRGVLHLSVLIETMRREGYELQIGQPQVIIKEID
                     GVKCEPVEELTIDLPENVSGKAVEMVTLRKGELLSMETKGDRMICEFIIPSRGIIGLR
                     NQLLTATAGEAIMAHRFTEYQPMRGGIPERQNGSLVSMELGKAIPYSIDKLQDRGRFF
                     VDPGEDIYEGQVIGENSRGDDMTVNITKTKKLSNVRSSGADDKAKIVPAIKFSLEEAL
                     EFIQKDEYVEVTPNYLRLRKIYLTENERKRNKIA"
     gene            93956..94774
                     /locus_tag="KQA_RS0201430"
     CDS             93956..94774
                     /locus_tag="KQA_RS0201430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-8-phosphooctulonate synthase"
                     /protein_id="WP_010177390.1"
                     /translation="MQLNNIPKIKNLDSNNFFLLAGPCAIEGEEMALRIAEKVVQITS
                     DLNIPYVFKGSFKKANRSRVDSFTGIGDEKALKILRKVSETFDVPTVTDIHTNEDAAK
                     AAEYVDVLQIPAFLVRQTDLVVAAAKTGKTVNLKKGQFMSPEAMQHAIRKVHDSGNDN
                     AMITDRGTMFGYQDMVVDFRGIPTMKQYGTTVLDVTHSLQQPNQSSGVTGGRPDMIET
                     IARAGIATGVDGLFIETHFDPSKAKSDGANMLHLDYLKNLLTNLVAIRQTINSL"
     gene            complement(94782..95930)
                     /locus_tag="KQA_RS0201435"
     CDS             complement(94782..95930)
                     /locus_tag="KQA_RS0201435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_010177391.1"
                     /translation="MKILLVGEYSGFHNSLKKGLTNLGHEVTIIAHGDGFKNYPVDIN
                     LGIKYFKKNRLLNFIKNGFYTFFKIDLSMLELRNQFKKTVPLLEKYDAIQFINSIAFL
                     GTPKTEKVLFNSITAYNKNIYLHGGSMETPWVDYMLNKHISFSSLTPYIKDKSLKKEF
                     QYALKYLETNHVNHFNYLLNHIKGIIPSDIDYEIVYKGTPKALNMIPTPIDLSKLKFT
                     ALDLSNKINIFCGINTTNQLAKGIPYFLDALDIIKQKYPSKVTVKITRNLPYNEYMKV
                     YNESHILLDQCLSYDQGYNGREAMAKGKVVVSGANEDFKNYYNLTEATMPLVEARPNV
                     DYLVNKLSELIENPDKMLAISKRARKFIEQHHECTEVAKKYLKAWSLD"
     gene            complement(95930..96778)
                     /locus_tag="KQA_RS0201440"
     CDS             complement(95930..96778)
                     /locus_tag="KQA_RS0201440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytanoyl-CoA dioxygenase"
                     /protein_id="WP_010177392.1"
                     /translation="MDNSLEKHTCALLIDNEPFSFNVSGSFFKGKPEVLYQSQGNILE
                     NTEWESEGFKIISAFSDIEFKLLSNSIKKNILKGIKLAGITVTENDFNIGDYHKYITN
                     QENHLKVINHTKNLRNEDFDLDFEKLALKFSKHTNTKLTPYIKQLQSSHIQIRISRPN
                     SLDINPPHRDGYLDYWKNILNIWIPIAGCNEHSSLPVIEGSHLIPEDQIIRTKAKGAY
                     INGNQYYVPCIIKTTNGPFKMFRPNPKKNEALIFSPFLIHGAAINKNTDVTRIALELR
                     FDKKED"
     gene            96868..97974
                     /locus_tag="KQA_RS0201445"
     CDS             96868..97974
                     /locus_tag="KQA_RS0201445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_010177393.1"
                     /translation="MISSKMNKLNVAVIVISLSRGGAERSTGTISKILENLGHSVTLI
                     SIIDENEFEHGGEYYALGSTKNYKTVFGRKISKFLDAYQLFQKINFDVVIDGRTRPLF
                     LKELIFNNLIFKNIPVVRIMHNSYLPQSFPKLKWQARYLYKNDSLIAVSKKAQQIVED
                     TYGFDNVRTINYPVSQKKIVESAQAELNILETNYVLFYGRFDNESKNLLFLLEAYSMS
                     KLSELGIPLILVGKGPDKPTIENKIKELNLIYHVIFKNYTPNPMPYVKKALFTVMTSN
                     FEGFPMTLIESLTLGTPVVTLDFISGPSEIIETGVNGILVTTKTTKAFSLALNKMVED
                     VEFYNKCVQGTFESIKYFDNFYIAKKWETLLNEL"
     gene            97971..98399
                     /locus_tag="KQA_RS0201450"
     CDS             97971..98399
                     /locus_tag="KQA_RS0201450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WxcM-like domain-containing protein"
                     /protein_id="WP_010177394.1"
                     /translation="MKKTRINDCHIIELDKIEGDDSRGSLSVIEKDSIPFESKRIYYL
                     YDVPSDARRGGHAHKELHQFLIPVSGSFDIILNDGKKEQTFTMNKPNKGLYLCPGIWR
                     EIENFSSGAVCLVLASEVYLEEDYIRDFHTFLRLKLPKIQ"
     gene            complement(98382..99290)
                     /locus_tag="KQA_RS18305"
     CDS             complement(98382..99290)
                     /locus_tag="KQA_RS18305"
                     /inference="COORDINATES: protein motif:HMM:PF10111.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_040395979.1"
                     /translation="MTPFFSVIIPLYNKEDFIKTTLDSALKQNFIDYEIIIINDGSTD
                     NSLSVVEKINDKKIKIYSQKNSGVSTARNNGIKFANGKYIAFLDADDYWFPNHLSELN
                     RAISAYPEYKIFCNNYKVETKKNTYKENRFSYLPKPEFEDLYIIQNYFKSSLIADIAW
                     TSAVCIEKKLILDNDFFFDPDIISIQDIDLWTRLGIKHSFIFNKRETTIYALFVFDSL
                     SDSKNIDNKALLISKNKNSEGNTPYLKSYLDQNRFAIANQYKILGKKRKFKEFKSQIN
                     LSNLSFKRLVLLHLPHWLIKLLLNFR"
     gene            99375..100502
                     /locus_tag="KQA_RS0201460"
     CDS             99375..100502
                     /locus_tag="KQA_RS0201460"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="mannosyltransferase"
                     /protein_id="WP_010177396.1"
                     /translation="MASKKIQIIAFNNPYPVNYGGVIDVFYKIEALKEIGYQVYLHIF
                     YDDRVNISVLEKLCEEVYLYKRNKLFYNFFSLIPFSVKSRNSKELYARITNKTNIPVL
                     FESIQTTYILKKFHFNNETLVRTHNIEHEYYFGIAKSESCFFKKLIFYIEGWKLKRYQ
                     SVLKKADIILTLSERDTSYFNSIFKGKTLFLPVFHGNKKVKETMNSKSKFALYHGDLS
                     ISDNVESAIFICSLFYNLKQELVIASSVLPNRIKKIIKNYSNIKYINIREEEVLEDLL
                     AKAHVNILVSLQESGTKLKVFNALYKGKYCIVNANIVDDKNILKLCYVANTKSEFQKS
                     IQEIFGKDYQFSSERARVLKNYESLNLVKKLSYYLETNKIT"
     gene            complement(100681..101364)
                     /locus_tag="KQA_RS0201465"
     CDS             complement(100681..101364)
                     /locus_tag="KQA_RS0201465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter ATP-binding protein"
                     /protein_id="WP_010177397.1"
                     /translation="MSEAVLKLTNVTIFQREKAVLSNVSLQVLKGDFVYLIGKTGSGK
                     SSFLKTLYGDLALVQGEGEIVNFKLNGLQEKKIPFLRRKLGVVFQDFKLLNDRTVNNN
                     LAFVLKATGWKEKDKIENRIKEVLTKVGMESKGTIYPYQLSGGEQQRIAIARALLNNP
                     ELILADEPTGNLDPQTSLEVMALLKEINANGNTILMATHDYALLLKYPSKTLKCENQK
                     IFEVVQRKN"
     gene            101679..104684
                     /locus_tag="KQA_RS0201470"
     CDS             101679..104684
                     /locus_tag="KQA_RS0201470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat protein"
                     /protein_id="WP_010177398.1"
                     /translation="MKKSSIITCFFVLISSLVLAQQTEIYNTTNGLYQRAVDLYNNKE
                     FAAAQSFFRKVQATTVDQNVKANTSYYIAQSAVQMQQRGADVLMTNFVTDYPTHPKRN
                     SAFFGVGSYYFSVGKYAQARKWYQDVDEQRLSAPALETFYFNKGYSLYHSKRYDDAKK
                     SLERVVGSEKYGEQAKYYLGYIAYKANDYDQADTYFNEVSDSENYNKSLSYYKADRNF
                     KKGEFQKAIDNAEPRLVNANTKDKSQLNKIIGESYFNLEDYEKAVPYLEAYKGNKGKW
                     SNTDYYLLGYSYYKQGEYSKAVSQFNKIIAGKNAVAQNAYYHLADAYLKSEQKQQALN
                     AFKNASEMNFEAIIKEDATYNYAKLSYEIGNSFESVPAVLKTFLLKYPDSSHKQEIAT
                     LLVDSYLSTKNYKEALVVLDSGKGTENKKVFQKVLFYRGLELFKEKDFKEAILLFDRA
                     ISTDALPDFTQRAQFWKGESYYALEDFVIAISNYKAVKESGDNTWEELKLTTYQLGYS
                     NFKIKAYDKAIDYFKKFIASNPEQFYLQDATLRLADSYFVTANYWPAMETYNKSIAQK
                     HKRADYAHFQKAISYGFVNKHDRKIQDLEAFLINFPDSGYRDDAYYALANAYVAKNNI
                     NKGLENYKQLRSELPKSAFVSKALLKEGLIFYNDNKSQKALDKFKLLVAEHSNTTEAL
                     QAVKTARLVYIDLGKTDEYAEWVKSLDFVDISNEELDNTTYEAAEKPYQENNISKAIV
                     GFEKYLKQFPKGLHKLNSHFYLGQLYTKKGDKQQALPHYLAVAEMDKNEYTETALYKI
                     SQTYLENKSYDKAISFLKRLEESADFTQNSIFAQSNLMKSYYEQKQFEETLVYSEKVL
                     VNSTIETSIKADAQIYKARAALALQKTGIAKKAYAEVAKIATGKLGAEAIYNLANFSN
                     QNGDYEISNNYVQRLAKDYSAYKEFGAKGLVLMAKNFYGLGDAYQATYLLESIVKEFT
                     SYPEVISEAKELLQKIKAEEAKTNSSIKE"
     gene            104696..106414
                     /locus_tag="KQA_RS0201475"
     CDS             104696..106414
                     /locus_tag="KQA_RS0201475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_010177399.1"
                     /translation="MSLFFNNRSVLFVVFFIGVLGYSQTKKEENDTLSTEKVVIVKTF
                     NPTINDAFKIHPEPNFDEKEASIKEPLKFQINSVPVASTFVPEKTKSIAVKKEAPEAS
                     FKNYALLGAGNFGNVLAEVFSSIDINKESQFTALLEHQSSQGGIKKVRLDDFFYDTGV
                     QLSFGKQQKRKQWTIDLEAQHQLYNWYGLSSNLEIPEEQFNAIDPSHSFIDVNLGGNL
                     QLDHEVFNTANVRFRHFRDDYESTENNLKLNPKFTAPLDDYPISIPIIFDYLSGEFAD
                     NNVFQGSKYSFLILGVQPTIALNFKGVDVKIGVSGFLSNDFENSELKLTIHPNLTANY
                     NFNAYNLSVFGGATGGLKQNTYHEAIEKNPFVAPGIGITPTNQVFNAFGGVQGQWQEK
                     FSYMLKGEAEFVKDYASFIKNPILNSATENLNYGFNNSFGYFYQDYVAAKITAEVGYE
                     EQGLFNVLLQTTFARYNETPRQPLNIPAFTTSARGNYIVNSAWSIGANIFYVGVREDR
                     DRLNSDLYTELDGYFDLNLRADYKITDQWSAFALGNNLTGQNYERWLDYPVQGIQLLV
                     GAKYKF"
     gene            complement(106486..107307)
                     /locus_tag="KQA_RS0201480"
     CDS             complement(106486..107307)
                     /locus_tag="KQA_RS0201480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177400.1"
                     /translation="MISIKTFFKVIALTIFIVACASDDDSNGNRNPRILNLQSTGNSA
                     NELLSSKTHNKLILELVAVKGFEPKKEAVENLVNFIEKRTFKSNGVQVIQRSIASTNK
                     KKLSIKQIDSIEQKNRTQLSTPNQHAIFIYFSDADANPENSEGEMNNDNDSMSSLVLG
                     SAYRNTSMVVYENTLKKIVNQSNSVIPDEVLARVETFTLQHEFCHLLGLVNLGTRMQT
                     PHEDTDENGKPNKHCNVRGCLMQANALFESNLMGNIKALELDPLCVKDLQANGGR"
     gene            107353..107886
                     /locus_tag="KQA_RS0201485"
     CDS             107353..107886
                     /locus_tag="KQA_RS0201485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2059 domain-containing protein"
                     /protein_id="WP_010177401.1"
                     /translation="MKFKCFSLVLFLILSLQSTAQQSTLTESITQYLNINGTTEQYEH
                     AVSSLLVMLKQQYVSKNVPETVWEELNQQKPTAINQIKAMLVSAYRTHFDQTEVNDMI
                     EFYKTPTGQQMITDQTKLTQDDRDKMSFFYNSPTGKKILEESDALNQSVSEISENWSR
                     ALYKSMTARLTEKGYDL"
     gene            complement(107881..108585)
                     /locus_tag="KQA_RS0201490"
     CDS             complement(107881..108585)
                     /locus_tag="KQA_RS0201490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_010177403.1"
                     /translation="MENDIFGAAITDYFETRIPNSIIVKSNEFDDDEIPIPYLFRTFN
                     EMPKVEQKALDLSFGKVLDVGCGAGSHSLHLQNEKKLTLTAIDTSAGAVEICKKRGVT
                     TVLNEDFYIHQGTYDTILLLMNGSGIVGTLTNFASFFNKLKSLLTSNGQILIDSSDLI
                     YLFEDENGEYWVDAAQGYYGEMQYQLEYKNKTSQKFDWLYVDYNTLQRAAAFNNFNCE
                     LIIEGAHYDYLARLTL"
     gene            108619..109137
                     /locus_tag="KQA_RS0201495"
     CDS             108619..109137
                     /locus_tag="KQA_RS0201495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YkgJ family cysteine cluster protein"
                     /protein_id="WP_010177404.1"
                     /translation="MQEEIDRLPKEAKEQFKENKKFLERLRQKPPKKLDVIMQDLHNK
                     TFDQIDCLECANCCKTTAPIVTDRDTERIAKHLKMKAVDFEQKYVKVDSDGDQVFKTT
                     PCEFLAHDNYCLIYDVRPKACSEYPHTNRKRFHQLNKVTLANTSICPATYRMVEKLKA
                     QFGVLNKKEKQR"
     gene            complement(109134..109409)
                     /locus_tag="KQA_RS0201500"
     CDS             complement(109134..109409)
                     /locus_tag="KQA_RS0201500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3817 domain-containing protein"
                     /protein_id="WP_010177405.1"
                     /translation="MLQKFRILALLEGISFLIILFITMPLKYLFENPMPNKIIGMVHG
                     VLFLGYVVFAIFLKTELKWSNKQTAIILLCSIIPFGTFWADKKYLKN"
     gene            complement(109448..110683)
                     /locus_tag="KQA_RS0201505"
     CDS             complement(109448..110683)
                     /locus_tag="KQA_RS0201505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1343 domain-containing protein"
                     /protein_id="WP_010177406.1"
                     /translation="MTFFKNTFLILVFPLFSCGKPNPSIKTASKIDHTVISSVKEKKK
                     TTSILTGAQQITSYLKLLKEKKIAVVANPTSIIFNIKKQPIHLVDSLLSRGVNLKKVF
                     APEHGFRGTADAGEVIKNGKDIATGLPIVSLYGKHKKPNPEMLSDIDCIVFDIQDVGA
                     RFYTYISTLHYIMEAAAEANILVIVLDRPNPNGHYVDGPIRQPKFKSFVGLHPIPIVH
                     GMTIGEYAKMINGEQWLANKLTCELSVIPLKNYTHTTAYSLPIKPSPNLPNDQSINLY
                     PSLCLFEGTNVSVGRGTDLQFQLYGAPNFSKTDFSFTPTPKPGAKHPKFEAKLCYGEN
                     LQQHKKLDQLHLNWLLKAYKQSPNKNEFFTSFFKKLAGTDQLQEQIEAGMTAKQIKAT
                     WQKDLDQFNLIRKKYLLYP"
     gene            110731..111963
                     /locus_tag="KQA_RS0201510"
     CDS             110731..111963
                     /locus_tag="KQA_RS0201510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010177407.1"
                     /translation="MNFEYFIAQRLIKEKAFAKNISSPIVKIAIIAIALGIIMMLIAI
                     ATGVGLQRKIREKIALFNGHIEISNFDNNSSQVSIKPITTNQTFYPNFSEVPEVTHIQ
                     GVATKAGIVRTETDFEGVLVKGVGSDYKWDVFETYLEQGRLPNYNEKINEEVLISSYL
                     ANRLGYKLGDKVVTYFLKNDKARTNLRSFVVTGIYNSGYEEFDKAFVIADVRHIQRLN
                     KWKKDEVGAFEVFVTDFDAVNRINAAVYKNIPSNLDSTSISQKYGNIFQWLNMFDFNI
                     AGIIGIMILVAGINMITAILVLILERTQLIGMLKAMGSSNVSIRKIFMYNATYIILKG
                     LFWGNLIGLVLIGIQYFFKVITLNPSDYYVKYAPVHITIQQVLALNIGTLVLCVLVLW
                     IPSYVITKIAPIKAIKFQ"
     gene            111993..112541
                     /locus_tag="KQA_RS0201515"
     CDS             111993..112541
                     /locus_tag="KQA_RS0201515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_010177408.1"
                     /translation="MKARLVDNDADLHQILAIQKENHLDNVSISNKKERGFVTVKHDF
                     EVLKKLNSKARQIIVSDKNEVIGYALVMLKEFKDLIPVLIPMFTLFESIQYRGKKLSE
                     LNYYVMGQICIADGYKRKGLFEKLYLKHKEVYSEQFEYCITEVSSSNIPSMKAHEKVG
                     FKTISTFCDTTDEWNVLLWDWH"
     gene            112629..114536
                     /locus_tag="KQA_RS19415"
     CDS             112629..114536
                     /locus_tag="KQA_RS19415"
                     /inference="COORDINATES: protein motif:HMM:PF01757.20"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_010177409.1"
                     /translation="MSKKHFYRPDIDGLRAIAVMLVILFHAGFTSISGGFVGVDIFFV
                     ISGFLITSSINKQMSQGTFSFQNFYLKRIRRIIPVLVFIMFIVTIPAYFILFSDDFEN
                     YSRTIIHTILSTNNFHLWIKSNDYFAESTELIPLLHTWSLSVEEQFYIIWPPLLLLLH
                     KKFNLKNRLLGVIVLLFLSFMLSVFLTHINMQMAYFLLPARLFEMLMGGVLAIFWYKL
                     PEFSKIQNHIISSVGFFMMLLPALLLTQNDSFPGINALWPCLGASLFIISGKEASKMG
                     VFNTILKIRVLVFIGLISYSMYLWHWPLLVYVKYLGFELTKPIALGVIILTILLSYLS
                     WKFIEQPFRYRYIYDFKNTLLKVLLPSVIICVSLYGVIDHFNGFPNRFTALSEFDKDA
                     NFPSKLRRNCYRKLRIGNIEECGLGTPKDQLDGMLIGDSFANHSAAFLEVLANDAHMY
                     FHDSAAGGYPVLADVDDITGEYRYDPEFGEKRLALAKKYEYVILAANWERFLDKKSKN
                     YQLVLKTVGELVETGKKVIVIDPLRKTTPMDLHKMKMFKVRNIAKIKKEDLLVPFYKR
                     PDDYIVYEFKRKFPTIKIVNLNTVMCNGNYCDYEINDNIVYRNSNHLNTSGARLLGER
                     YLKQYGNPLKK"
     gene            114752..116224
                     /locus_tag="KQA_RS0201525"
     CDS             114752..116224
                     /locus_tag="KQA_RS0201525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_001296691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IMP dehydrogenase"
                     /protein_id="WP_010177410.1"
                     /translation="MIAHESKIVGEGLTYDDVLLVPAFSEILPREVSIQTKFTKNITI
                     NVPIISAAMDTVTESSMAIAMAREGGIGVLHKNMTIQQQASEVRKVKRAESGMIIDPV
                     TLPLTAVVGDAKANMREHRIGGIPIVDEQGKLAGIVTNRDLRFEKDVDRPLIEVMTSE
                     NLVTVSEGTSLKDAEVILQKNKIEKLPVVNEDHILVGLITFRDITKLTQKPNANKDQF
                     GRLRVAAALGVTADVVERATALVNVGVDAVIIDTAHGHTKGVVDVLKKVKAAFPDLEV
                     IVGNIATGEAAKYLVEAGADAIKVGIGPGSICTTRVVAGVGFPQFSAVLEVAAAIKGT
                     GVPVIADGGIRYTGDIPKAIAAGADCVMLGSLLAGTKESPGETIIFEGRKFKSYRGMG
                     SVEAMKKGSKDRYFQDVEDDIKKLVPEGIVGRVAYKGELNESIHQFVGGLRAGMGYCG
                     AATIEDLKENGRFVKITASGINESHPHDVTITKEAPNYSR"
     gene            complement(116293..116943)
                     /locus_tag="KQA_RS0201530"
     CDS             complement(116293..116943)
                     /locus_tag="KQA_RS0201530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YceI family protein"
                     /protein_id="WP_010177411.1"
                     /translation="MKKQLINILAVTVLTASFISCKKNKEVETTNAKTVEQVVTAEKF
                     KAVPAQTMIKWNAHKIVGGHQGTINASAGLIEVKGNDLVGGNFIFDINTIKCSDLPAG
                     ENYDKLIGHLKNEDFFDVAKHPSAAFQITSVTPKNGKSVIAGNLSIKGIKKNIEFPAT
                     VSVNGNTVTITSDEFEIDRTEWGVKYNSGKFADPAKLGDYLIKDNVGIQIAVTASK"
     gene            117301..117855
                     /gene="grpE"
                     /locus_tag="KQA_RS0201535"
     CDS             117301..117855
                     /gene="grpE"
                     /locus_tag="KQA_RS0201535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide exchange factor GrpE"
                     /protein_id="WP_010177412.1"
                     /translation="MSTKDKAKETVDEIIQDSTKDAKVEEKETQPVEEKDELTLAKEA
                     AAVEKDKFLRLFAEFENYKKRTSKERVELFKTAGQEVLQALLPVLDDFDRASKEIEKS
                     EDEALKQGVTLIHNKLKDILKLKGLEQVEVNTADTFDADIHEAITQIPAPSDDLKGKI
                     IDVVEKGYKLGDKIIRYPKVVTGN"
     gene            117870..118982
                     /locus_tag="KQA_RS0201540"
     CDS             117870..118982
                     /locus_tag="KQA_RS0201540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013072537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_010177413.1"
                     /translation="MKEDFYDILGISKGASASEIKKAYRKKAVQYHPDKNPGDAEAEE
                     NFKKAAEAYEILSDPDKKARYDQYGHQAFENGGGGGGFGGMNMDDIFSQFGDIFGGGG
                     GFGGFGGGGGGQRRSKGSNLRIRVKLTLEEIANGVEKKVKVKRKVQADGTTYKTCGTC
                     NGSGQVVRITNTILGRMQTAAPCNACGGSGQQIDKKPNGADAQGLIVNEETVSIKIPA
                     GVQDGMQLKVSGKGNEAPGNGFAGDLLVAIEELAHESLQREGDNLHYDLYISFSDAVL
                     GGSKEIDTVSGKVRIKIDEGVQSGKILRLRGKGIPNLNGYGKGDLLVHVNVWTPKTVT
                     KEQKTFFEKMKDDDHFSPSPEKSEKSFFEKVKDMFS"
     gene            119357..120256
                     /locus_tag="KQA_RS0201545"
     CDS             119357..120256
                     /locus_tag="KQA_RS0201545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein MscS"
                     /protein_id="WP_010177414.1"
                     /translation="MIILFLQQKIAEKVVDTLDKNVWQKIREILTLKLELGAFKISIL
                     SLIIVIVTFIVTKYALYFITKLITKRLDKENVPKFESLFSFIKYFIYALVGVMVFQAL
                     GINLTPILAASAALLVGVGLALQTLFQDILSGVFILIDRTVIVGDIIELDGKVGRVEE
                     IKLRTTRAVTIDNKVLVIPNHKYLTKSLFNWTQNGKKTRDTVAVGVAYDSDVNLVKKL
                     LLKAVHENKKILSEPEPIVLFEDFGDSSLQFKVVYTISDSFMGAIPRSELRFEITRLF
                     REHNIQIPFPQREIRVLSDHRNN"
     gene            120268..121431
                     /locus_tag="KQA_RS0201550"
     CDS             120268..121431
                     /locus_tag="KQA_RS0201550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_010177415.1"
                     /translation="MSKILIIEDEAAIRRVLVKILSEENEAYKVSEAGNGLEGVELIK
                     KEDFDLVLCDIKMPKMDGIEVLEAINKVKPEIPVVMISGHGDLETAVNTMRLGAFDYI
                     SKPPDLNRLLNTVRNALDRKELVVENKRLKKKVSKSYEMIGNSKAISEIKEIIEKVAP
                     TEARVLVTGPNGTGKELVAHWLHEKSERSKGPFIEVNCAAIPSELIESELFGHVKGAF
                     TSANKDRAGKFEAANGGTIFLDEIGDMSLSAQAKVLRALQESKVQRVGSDKDIKVNVR
                     VVAATNKDLKKEIEDKKFREDLYHRLAVILIKVPALNDRRDDIPELINHFSKKIAESQ
                     GTIPKDFSDEAVKLLQKYDWTGNIRELRNVVERLLILGEKEISENDVKLFASK"
     gene            121431..121940
                     /locus_tag="KQA_RS0201555"
     CDS             121431..121940
                     /locus_tag="KQA_RS0201555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177416.1"
                     /translation="MKLFNTLFLFFIVNSILAQHEPGAWVVGVQGAAKVDRISDVGGS
                     FQVHYAPNCYSTYIAEVGVLNTKDGIVPELGITINSIMFNFQSWMITGGMGFIMNSAE
                     LSKKEQDDAIFAFSDGKNSFGALLKIRTLVPINKWWQLSSAFNFKSVGGKFSTVTLGI
                     IYEFPLKGY"
     gene            121942..122808
                     /locus_tag="KQA_RS0201560"
     CDS             121942..122808
                     /locus_tag="KQA_RS0201560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase"
                     /protein_id="WP_010177417.1"
                     /translation="MKAEKANSSFKISDAKTTIDIGLSEDELKDELKSVRKKLGKLQD
                     TLYAHGKYAVLVCLQGMDTAGKDSLIREVFKDFNTSGIIVHSFKVPSTIERNHDYLWR
                     HYIALPARGKFGIFNRTHYENVLVTRVHPEYILGENIPHISSVNDVDDKFWKQRFEQI
                     NDFEKHLTQNGTLIFKFFLHLSKREQKNRLLRRLEKKDKNWKFSPADLKERKLWDAYQ
                     DCYEDAIRNTSTLQAPWYVIPADHKPVARYLVAKTLYDSLSAYTDIQEPELEEDVVFE
                     LRNYLHQLKSEK"
     gene            123205..129738
                     /locus_tag="KQA_RS0201565"
     CDS             123205..129738
                     /locus_tag="KQA_RS0201565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177418.1"
                     /translation="MILKKLSLYALAFFGTSGFAQSSFNYAEALQKSLFFYEVQQSGE
                     LPSWNRVTWRGDSALNDGSDVGVDLTGGWYDAGDHVKFNFPMAFSVTALSWGAIEYEE
                     AYKNAGQLDIIKRNIKFVTDYLLKCHTGPTELYGQVGNGGLDHAYWGSSEVMVMDRPA
                     YKISASAPGSDLAAETAAAMAAASILFKDSDPAYSKTLLDHAKQLYKFADDYRGVYSE
                     AITDAAGFYRSFSGFQDELVWGAAWLYRATNDATYLAKAESEYDNLGNEGQSSNKAYK
                     WGLAWDDKSYGSYVLMSQLTGKDKYKADAERHLDYWTDGFNGDRVPYSPGGQAHLTQW
                     GSLRHSSNTSLLAFIYSDKVETSATNKKKYHDFAVRQINYALGDNPINRSFMVGFGNN
                     PANNTHHRAAHGAWANSLQNRPDKPSHTLFGALAGGPSSPNDQFEDDRGDFIANEVAC
                     DYNACFTGALARMYSEFGGSTLANFPVKETPSRTEIRSYSKFNSNNAFGSTVKILLQN
                     RSAWPARVMDKLSYRYYFDIAEGVAAGKTIDDYDIQLNGVGGSATMSIKSAGGTLYYA
                     EISNIPSISPIGDPAFRNETQINFRVSNGVPYDTSNDPSASGLTGSSEIESVNIPVYD
                     NGVLVFGQEPDGTTTPVDPVNTAPVASINADKFSGEAPLTVTFDASGSSDAENDALTY
                     VWTFGNGETSTDENPSTIYTTAGSYLVSLVVNDGLLNSTEETITINVNDPAVNPVVVT
                     GGTLSGGPFTFTVGDGVADNVSGVTVSGNTGATSQWVVTDETGKILGLPPAPEAVNFD
                     EAPPGTCFIYNVSYNGTLNGLTVDANISGLSGDFQLSSNRVEVVRNAPIVVTPITVAG
                     GTLNGGPFTFTVGDGIADNVSGVSVSGNSGATSQWVVTDEVGKILGLPPTPEAVNFDE
                     APAGSCFIYNVSFNGALNGLAVDSNISGLSGDFQLSSNSIEVVRNAVVVVTPPTGDCT
                     FGAPIATPLETTYGYYTNMYAFGSSAPSMGNLSGFSFNWDLANNGLWSIAIQTTDGNP
                     SYYVDLRDKTTHNLGASQPSITFAGTGIPGLDGTYYTARDGENLALVSTTADYTLYFS
                     NSSTAPDCGDVIDTPIVVNGGTLTGGPFAFTVNDGIADNVSGVSVTGNTGSNFGWIVT
                     DEDLNILGLPGTPEAVNFDEAGAGVCLIWHIAYEDGLTGLTAGENAGNLVGNFDLSNS
                     IRVDRTAAIPSTVDGGTIVGGPFTFTVGDGIADNVSGVSVSGNTGSNFGWVVTDEDLN
                     ILGLPGTPEAVNFDEAPAGVCLIWHIAYEDGLTGLTVGENAGNLAGDFDLSNSIRVDR
                     TGTNVPTPTVDGATVATSTGAVAVETITGDGIADLINFTTTSTATLNYSYLITDAAGN
                     ILVVEADSHDFEGVSVGVCLVYGISYEGTLSVTGKSITDTDLASGAFDVSDNSISVDR
                     KDIPVVVDPTDPTTGGPDVNNKYIERFTEMRNEIYDPANGYFSKDGSPHHSVETLIVE
                     APDHGHESTSELYSYWLMMEAMQGRITKDWQPLAKVWSEMERMIIPTKADQPTNAAYD
                     ASSPAAYAAEFPLPSGYPAPLDFGAAVGQDPVSAELTAAYGPEVYQMHWLLDNDNFYG
                     YGNRGDGTSTPSYINTFQRGEQESVYETIPHPSWESFEFGNSENGFLPLFILDTNYAK
                     QWRYTSAPDADARAVQAMYWAVQYAKEQSGAIDPTLLDNTKKMGDYLRLAMFDKYFKK
                     IGSQDEQGSAGTGYDSAHYLMSWYMSWGGSADPASAWAFRISSSHCHFGYQNPVAAYA
                     LTTLDELDLQTPNGERDWTTSLGRQMEFYRYLQSADGAIAGGATNSWNGDYSTYPAGK
                     STFYDMAYDDNPVYHDPGSGTWFGWQAWSVERVAEYYYITNDPLAKEIMDKWVAWVKP
                     NVKLIGSDDFDIPATLEWSGEPDTWNAANPGDNANLRVTVTNFSKDLGIASSLAKTLT
                     YYAAATRKHATLDEEAKNLAKEILDRMWVTYRDDKGVSAPESRGDYKRMFEEVVHVPT
                     GYTGTMANGDEIKTGVTFLDIRSGLKDDPEYPAVKAAYDAGEDYTTRYHRTWAQMETA
                     LANAEYGFFFGEDDEAAGAKALDVELTVYPNPASELVTVTYPTEEDVALKVTLVDFAG
                     RVITTQELLNEKSTTIDVSNLASGMYIVRLETKGNVIRTEKLIIK"
     gene            129820..131211
                     /locus_tag="KQA_RS0201570"
     CDS             129820..131211
                     /locus_tag="KQA_RS0201570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family efflux transporter"
                     /protein_id="WP_010177419.1"
                     /translation="MGKHYAKYYWNNNTLASKKVLSKYIKEFPVNLRLAYPIMIGQLG
                     NVMVGFIDNVMVGKLGASSLAAVSLGNGLFFLALSLAIGFSLSITPLVAEADGQKDYL
                     KISLLLKNGIALSTLLGGALFVVIKLLQPFLTLLDQPEEVVVLANPYINILAFSIIPL
                     AMFQAMKQFSDGLSVTRYAMIATIIGNVLNVFFNYVLIYGKWGFPKLLLEGAAIGTLI
                     ARFSMVFFMLLIFYKQQNFKVYVSNIFSNILQLNIVKNLLKLGFPAALQMLFEFGIFI
                     SSIFLSGLLSTEDQAANQIALNVASITFMIAVGLGVTATIRTGNQLGKKDFKALIRIV
                     RSILLLVFLIEFVFAIVLVFLKDYLPVFYISDVNVIALAAKLLLVVACFQISDGFQVV
                     LLGTLRGLQDVNIPTLCLFIAYWCVGFPISYYLGNPSYLGSVGIWIGLFAGLTVSSGL
                     LYIRYLYLSKKFN"
     gene            complement(131280..132257)
                     /locus_tag="KQA_RS0201575"
     CDS             complement(131280..132257)
                     /locus_tag="KQA_RS0201575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006257250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase complex E1 component
                     subunit beta"
                     /protein_id="WP_010177420.1"
                     /translation="MKTIQFREAICEAMSEEMRRDESIYLMGEEVAEYNGAYKASKGM
                     LDEFGAKRVIDTPIAELGFAGIAVGSAMNGNRPIVEYMTFNFSLVGIDQIINNAAKIR
                     QMSGGQFPCPIVFRGPTASAGQLGATHSQAFENWFANTPGLKVIVPSNPYDAKGLLKA
                     AIRDNDPVIFMESEQMYGDKGEVPEGEYVLPIGVADLKREGNDVTIVSFGKIIKEAYI
                     AADTLAKEGISCEIIDLRTVRPLDLEAIYKSVKKTNRLIILEEAWPLANIASEITYQV
                     QQNCFDYLDAPVIKINTADTPAPYSPTLLAEWLPNNEDVIKAVKKVMYK"
     gene            132613..133359
                     /locus_tag="KQA_RS0201585"
     CDS             132613..133359
                     /locus_tag="KQA_RS0201585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein beta subunit/FixA
                     family protein"
                     /protein_id="WP_010177421.1"
                     /translation="MKILVCISHVPDTTSKINFTDDDTKFDTNGVSFVINPNDEFGLT
                     RAMWFKEKQGASVDVVNVGGPDTEPTIRKCLAIGADNAIRVNANPTDSLFVAQELASV
                     AKNGGYDLVIAGRESIDYNGGVVPGMLAALLDANFVNTCISLEVEGTSATAIREIDGG
                     KETIKATLPLVIGGQKGLVEESDLRIPNMRGIMMARKKPLSVVEPTGSASQSEPSSFS
                     KPAPKGSVTLVSADNLDELINLLHKEAKVI"
     gene            133474..134433
                     /locus_tag="KQA_RS0201590"
     CDS             133474..134433
                     /locus_tag="KQA_RS0201590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit
                     alpha/FixB family protein"
                     /protein_id="WP_010177422.1"
                     /translation="MSVLIYAESDNGSLRKGAFEVASYAKGVADALGTTVTALTVNVS
                     DVSELGNYGVSKVLQVSDNALTKFQAKAYSSIIEQAAKAEQSKVVVLSSSTNSKYAAP
                     LLGVALNAAVVSNVVSLPKSTSPFVVERTAFTNKAFQETQINSDVKVICVSNNSYGLK
                     ETSVSIEAEAFSPSVNGGSLEVVSIDKATDKVSIADAEVVVSGGRGLKGPENWHLIED
                     LATVLGAATACSKPVSDMGWRPHSEHVGQTGKPVATNLYIAVGISGAIQHLAGINASK
                     VKVVVNTDPEAPFFKAADYGVVGDAFEVVPQLIEKLKAFKSTN"
     gene            134611..135231
                     /locus_tag="KQA_RS0201595"
     CDS             134611..135231
                     /locus_tag="KQA_RS0201595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010520256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177423.1"
                     /translation="MSLVRLNIRGISYSQTQNGAYALILSEMEGERKLPIVIGAFEAQ
                     SIAIALEKEIRPPRPLTHDLFKNFADRFDVVVKQVIIHKLVDGVFYSSIICERDGIEE
                     IIDARTSDAIALALRFRAPIFTYKNILDQAGIYLKQQSDGEFLSENVDGPEEDSSDEK
                     SVELVSSSADFKNLTVDELYKLLDKAVTDEDYEKAARLRDEISNRN"
     gene            135383..136207
                     /locus_tag="KQA_RS0201600"
     CDS             135383..136207
                     /locus_tag="KQA_RS0201600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010520255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_010177424.1"
                     /translation="MKQYLDLVQHVMDNGAVKGDRTGTGTRSVFGYQMRFDLSKGFPM
                     VTTKKVHFKSVVYELLWFLKGDTNIKYLSDHGVRIWNDWANDNGDLGPVYGHQWRNWN
                     NEEIDQIKEIVETLKKNPNSRRMLVSAWNPSVMPDTSVSFEENVANGKAALPPCHAFF
                     QFYVANGKLSCQLYQRSADIFLGVPFNIASYALLTEMMAQVCGYEAGEFIHTFGDAHI
                     YNDHVEQLQLQLSRSPKPLPKIKMNPNKTDLFDFKFEDFELVDYEHHPHIKGKVSV"
     gene            complement(136363..137220)
                     /locus_tag="KQA_RS0201605"
     CDS             complement(136363..137220)
                     /locus_tag="KQA_RS0201605"
                     /inference="COORDINATES: protein motif:HMM:PF12388.6"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177425.1"
                     /translation="MKKLKIVAIATTAILMVQCQDENTADIQPTEETSIENQEANLDL
                     PVVNFTPVSNEVSPEIVKGLQNMGYDTVLDKIENLGNHYLVGGDMIVDKESILEAAHT
                     DPKGKQRRFNSIMRCSEARDVTVRNLIPSINTQVRNALNDWNRIRGSFLRLRLVNGGN
                     ADMTIMRVKGVAGAADRPRNGKPGRTVYFDPDFYKGIPRRGERMRFVIRHEIGHNLGF
                     LHTNEIDNQEKGQHIPGTPNRDRNSIMNSAGNLPFNPAVWPFNNFTEADKRALRKMYG
                     GNAQNNICF"
     gene            <137876..>138280
                     /locus_tag="KQA_RS19775"
                     /pseudo
     CDS             <137876..>138280
                     /locus_tag="KQA_RS19775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016513608.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start and stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(139846..140145)
                     /locus_tag="KQA_RS0201615"
     CDS             complement(139846..140145)
                     /locus_tag="KQA_RS0201615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase"
                     /protein_id="WP_010177427.1"
                     /translation="MSISKQFLKSKPECKVTFVWNAKEAKSVTVAGDFNNWETTQLPL
                     KKLKNGTFKGSINLPIENSFQFKYLVDNNSWVNDDSADNYIWNDFAGGENGVLEL"
     gene            complement(140360..141727)
                     /locus_tag="KQA_RS0201620"
     CDS             complement(140360..141727)
                     /locus_tag="KQA_RS0201620"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177428.1"
                     /translation="MKINLLSKAKNCLYIGFSLSVSVALSQEHIIKVNSNNTFASLQL
                     SEKEYDSWIQNDDFTTSKEVVSNLTKELYNNFEDNYDFIVFVLNEKEVPTTGKIDYFG
                     INNVINSKIEGISFTNDKSDDSKFYGSDGVLKSIMHFPEKEGMLFGPFLHEIMHNWGN
                     FDVIAGEAPSEENEDGSFTFSKIPGHWGLTGGSTPGQLGGFKQSDLIKNKDGSFTTPG
                     FSFNANGGNQVPYNEFELYLMGMIPLEEVAPFDSFSNVTDFSFEEDKDTGDFTSYTFK
                     AGEVIRYTPEKILNDLGPRNPSYKNSQKEFNMLTVIITKTALTEKEWEEYDAIIKVTT
                     QKADHDDKRLYNFWQATRGIGSLNPTIHKKTNTLSIDDITDHDEEFKIYPIPVTATLS
                     IENLKNSPVKNVILCDALGKEINSYPLATTTTIDVSTVASGIYYLIFKNDHKKLVETK
                     RLVIY"
     gene            142180..142626
                     /locus_tag="KQA_RS0201625"
     CDS             142180..142626
                     /locus_tag="KQA_RS0201625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177429.1"
                     /translation="MFSRSKSKESTIDLEQKELFEHAQARIKEKKGLYRHFIVFLVSC
                     IFMIVLNLGLNFGKEYKFLELDWFVFGVLGWSFFFLIHFFRVVLFSKFMGKEWKAKQL
                     ERLVAKQKAKIAKMEQKLNLEIPKDIVSEKSILLDNTDLNDTEKLQ"
     gene            142630..143112
                     /locus_tag="KQA_RS0201630"
     CDS             142630..143112
                     /locus_tag="KQA_RS0201630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="WP_010177430.1"
                     /translation="MIILIAAAAENNALGKDNDLLWHLPDDFKRFKKLTSGHPIIMGR
                     KTFESLPGMLPKRTHIIITRQDDYFKEGCLIANSLEQAVELAGTSAKIFIIGGGEIYT
                     QSLKIADSIELTRVHANFEADTFFPEIDTEQWELVDNEQHEADEKHTYSFSYLTYVKK
                     "
     gene            143172..>144271
                     /locus_tag="KQA_RS19425"
     CDS             143172..>144271
                     /locus_tag="KQA_RS19425"
                     /inference="COORDINATES: protein motif:HMM:PF04784.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF547 domain-containing protein"
                     /protein_id="WP_081483224.1"
                     /translation="MKPFSLFLFLCCITAMVSCAKQKETKTVVALESLEKNGIKTLED
                     AIKGEEFTDSIEIEGDEDFIEEIKEKPLVVNDEEKVVVETLKNTEKPIKKKDATKGVV
                     IEEEIATVPVKEIGSKNEKEGTSKKVQKIEKESTQVQHKVAKIATKEVESIGAMEFDH
                     TLFDAFLNKYVSSTGNVNYKMMKSHQIELESYINSLQNKTLKTTWTTNQKLAYWINAY
                     NAFTLKLILDHYPVNSITAIAGGKPWDKKWIALNGKMYSLNQIENDIIRPQFKEPRIH
                     FAVNCAAKSCPKLGNFAYTASNLNAKLTSQTKAFINSNLNQISATHLKISKIFEWYKS
                     DFGDLVPFIKKYSTVVINDNATVEYNEYDWSL"
     assembly_gap    144272..144318
                     /estimated_length=47
                     /gap_type="within scaffold"
                     /linkage_evidence="unspecified"
     gene            144355..145236
                     /gene="fabD"
                     /locus_tag="KQA_RS0201640"
     CDS             144355..145236
                     /gene="fabD"
                     /locus_tag="KQA_RS0201640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010520249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="[acyl-carrier-protein] S-malonyltransferase"
                     /protein_id="WP_029209407.1"
                     /translation="MKAYVFPGQGAQFVGMGKDLYDNAPIAKQLFDKANEILGFSITD
                     IMFEGTPEQLKETKVTQPAIFLHSVILSKVLGDDFKPDMVAGHSLGEFSALVANGVLS
                     FEDGLKLVSQRALAMQKACEASASTMAAVLGLDDEVVETVCNEIGAEVVPANYNCPGQ
                     LVISGGVDAIAKACEILKEKGARRALVLPVGGGFHSPYMEPARAELAAAIEATTFNEP
                     ACPIYQNVTTTAVNSAEAIKENLIAQLTAPVKWTQSIQQMIADGATSFTEVGPGKVLQ
                     GLVKKIDRSAETFGATL"
     gene            complement(145317..145616)
                     /locus_tag="KQA_RS0201645"
     CDS             complement(145317..145616)
                     /locus_tag="KQA_RS0201645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177433.1"
                     /translation="MKIMSLIISLLVITGIVWFLKINTADNKARKDAIQVEASIEKVN
                     CKQRLKGDKSLVAVAYKGQVYYIFFKNEKDCNKYKENQKVTAYFSKTYNKLYLDL"
     gene            complement(145623..146777)
                     /locus_tag="KQA_RS0201650"
     CDS             complement(145623..146777)
                     /locus_tag="KQA_RS0201650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DegT/DnrJ/EryC1/StrS family aminotransferase"
                     /protein_id="WP_010177434.1"
                     /translation="MKKIQMVDLKGQYEGIKNTVNNSIQEVLDNTAYINGPQVHKFQE
                     ELEKYLNVKHVIPCANGTDALQIAMMGLGLQPGDEVITADFTFAATVEVIALLQLTPV
                     LVDVDPNTFNIDPKAIEKAITPKTKAIVPVHLFGQAANMEAITTIAKKHDLFIIEDNA
                     QGIGASYTFANGTKKKTGNLGHVASTSFFPSKNLGCYGDGGAIFTNNDELAHSIRGIV
                     NHGMYQRYHHDVVGVNSRLDSIQAAVLLAKLPNLDTYNNARRASARKYNDAFKNIPQI
                     ITPVTHTKCEGICDTCDCHVFHQYTLKVKDADRDALVAHLNKNNIPCGVYYPIPLHAQ
                     KAYTDKRYLESDFPVTNQLVKEVISLPMHTELDDEQIAFITKTVIDFVTK"
     gene            147247..148371
                     /locus_tag="KQA_RS0201655"
     CDS             147247..148371
                     /locus_tag="KQA_RS0201655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gfo/Idh/MocA family oxidoreductase"
                     /protein_id="WP_010177435.1"
                     /translation="MKNEKRREFIKQLGLVAGSTALLPSLLSFDSIINTYKKEGSQKK
                     INVALCGLGRYAKILAKGLEQTKQCKLTGLVTGTPEKEITWGQKYNIPKKNIYNYDNF
                     DSIIDNKDIDLVYVVLPNSMHKEFTIRAANAGKHVIVEKPMGLNALECVEMIDACKKN
                     GVQLAVGYRLHYEPHHKEIKRMGQEKVFGNIRYIDASLGYRIKGWKKDAWHLKKAMSG
                     GGPLTNIGIYCVQSNRYILGEEPIAVTAQFGPVQRPDYFKEVEESITWQLEFPSGAVT
                     TSASSYSYNVDRLYASGDDGFFELEPALSYGPFKGKSSLGTFNFPVINQQQVQLDEIS
                     KCILNKEPLPMHIRGEEGHKDMLVIDAIYKSAATGKKVVI"
     gene            148384..148956
                     /locus_tag="KQA_RS0201660"
     CDS             148384..148956
                     /locus_tag="KQA_RS0201660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_010177436.1"
                     /translation="MINDLLIQNIKKNVSLPDTDLKRICNYFKPKTIPKKEFLLTQGS
                     ICKFEGFVLEGCFRIFIIDKKGHENTLYFAAKDWWVMDIDSFMNQKPSDLNIQAIEDS
                     KVLLITREDKTDLYNSVPSAEKLFRIMSQKSIVAWQQRLIRNHCQTAKDRYNYYISTY
                     PDIASKLTDKQIAGYLGITHEFLSKIKKKS"
     gene            149046..149534
                     /locus_tag="KQA_RS0201665"
     CDS             149046..149534
                     /locus_tag="KQA_RS0201665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme-binding protein"
                     /protein_id="WP_010177437.1"
                     /translation="MNLLRSARSCAIAFILTLACNGGYAQITNDITHDEAFKVLLAAK
                     KKAEHSNVLVNIAIVDAGTNLKAFIRMDNSFIGSIDVAIKKAKTARYFNIDTGKLGEL
                     TQPGGIIYNIEHSNGGLITFPGGIPIKNKNGEIIGAIGVSGGTIEQDRAIASAGIKAV
                     ID"
     gene            149556..151079
                     /locus_tag="KQA_RS19430"
     CDS             149556..151079
                     /locus_tag="KQA_RS19430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stress protein"
                     /protein_id="WP_010177438.1"
                     /translation="MKKILKKIIFGTVLLVLQICSAQVSNELMLYRKDFKDISGNNTV
                     SVTSYQKGDAHFVFAGGIGNIDVYSLNKNGELTPISNHELYKGKGPARGMVADSINGN
                     DFLFVANKHGNAIETFKILNNGALERVSLVADTNKTHLGTAITLQVIHMKESSYLFIG
                     GLEETPGLSSFQIHDDGKLTHVQSMEDNEIIHTDGVIGMYTHKINGRTFLYTGGFQDN
                     GVSSFRVYENGTFKNINNISDNTNDRYLTGTYPVTGVTLGNNNYVIVGHRHHKYYKRA
                     GFIKKTDFVYHGDAVSVFKINKKGALIPHFVLKDDETTKLQGQTRIEVVSVANNEAIL
                     AVGTRDDASIQLCRLNKEGILSPINYLETGFSIYYGLRSHKIGKENFLIAGSFRFDLK
                     KIVTYKIAPKINREGKVLRHMVNLKYKDGIEESKVNEAVKNFMNLKNEIPEIASIEWG
                     INDSTEGHSKGLTHCFTLTFADEHAREIYLFHKAHLQMVSKISPIIADVLVLDYWTK"
     gene            complement(151115..152038)
                     /locus_tag="KQA_RS0201675"
     CDS             complement(151115..152038)
                     /locus_tag="KQA_RS0201675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="WP_010177439.1"
                     /translation="MRALVISGGGSKGAFAGGVAQYLMQVQQRKYDLFLGTSTGSLLI
                     PHLSINKIDKVHDIYTNVNQNTIFSLNPFVVKHKGDREYVSINYLNTVLQFVKRKRTF
                     GESKNLRKNIRKNFTREEFEFARKNVTDVVVTVSNLSKSCTEYKSIHEFSYEDFCEWI
                     WISCNYIPFMSIAKKNGYEYADGGFGAIVPIREAIKRGATEIDAVILESENLDRNKIL
                     GKNPFSLMVNLFGYLLDQVEQHNVTAGKLAAKNKNATLNLYYTPTKLTENSLVFNKKL
                     MTEWWQQGFDYAREKFEQKELNELRDLDMRG"
     gene            complement(152101..154203)
                     /locus_tag="KQA_RS0201680"
     CDS             complement(152101..154203)
                     /locus_tag="KQA_RS0201680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="M1 family peptidase"
                     /protein_id="WP_010177440.1"
                     /translation="MSQFIKITSLIFSFCASIIYSRAQQKDLVDFKTIEAHIQLDTIN
                     QKVFGKIDVLFTPLKNTNQVYLDAQKMETVTPIKDAKVEYKDNKIWLKGDFKANTAYS
                     FSFNYSTTPKKALYFWGWDAKNIDPNSPNHKQIWTQGQGKYTSNWLPSIDDMNDKIIF
                     TLKIDFNTDYQVISNGSLIHKTTTNTTTTWVYQMQQPMSSYLVALAIGKYLKKEEKSA
                     SGVPLENYIYSDRITDYESTFNYHKKVFDFLETEIGIPYPWKIYRQVPVRDFLYAGME
                     NTACTLFSDDFIVDTNTFDDQNFVNVSAHELAHQWFGNIITETDSNHHWLHEGFATYF
                     ALLAEKELFGEDHFYYKLYESAEQLNHQSDLQKGKALVTPKGSSLTYYQHGAWAIVAL
                     RNNIGDAHFKKVVQQFLTTHQYKNVTTYDFLSIVFEVTGKDTSEFAKKWLHNTTFPAG
                     EALKIITQSEVMKRYLQLAGERTQPLIGKYQLLSDALDFPVNPYLGQEVVAQLQGDFS
                     KEALLLLEKAFESNQPQVLQALANSLTTIPKAFEPKMALLLKADSYATVEGALYNLWN
                     NFEAKKMNYLQATKNLIGFNDKNIRTLWLVLALNTPGFSTTDRTRFFNELNSYTAPNH
                     HYRLRSKAFEYLKLLQSYSDQSLQNLALGATHPNWRFKKNCSTTLKALYANEKYTQRI
                     NRLSATFPNKVKQLLTTD"
     gene            154283..156388
                     /locus_tag="KQA_RS0201685"
     CDS             154283..156388
                     /locus_tag="KQA_RS0201685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="WP_010177441.1"
                     /translation="MSADILQSPVAYVKGVGPTRATVLEKELGIRVCQDLLHFFPHRY
                     IDRTRYYTISELQQNDAEVQIVGMVTQLKNVKQKKGGSRLVATFQDKTGKMELVWFRG
                     AKWIQESIKINVPYVIFGKTKYYNGFSMPHPEMELLDAHKSSMSSIMQPIYSSTEMLQ
                     RRNITNKVVSKMVQNLFLTKGVFFDETLPKNILEHMKLIGKSEALLNIHFPKSQELLT
                     KASYRLKFEELFYIQLQLIRKNILQKQKIKGYAFEKVGELFTNFYENYLPFSLTGAQK
                     RVVKEIRRDMGSEAQMNRLLQGDVGSGKTIVALMSMLLAIDNGYQATLMAPTAILAKQ
                     HFDGISALVKDLPIHVSLLMGSTKTKARREIHADLENGQIHIIIGTHALLEDKVKFNN
                     LGLAIIDEQHRFGVAQRAKLWRKNELPPHVLVMTATPIPRTLAMSLYGDLDVSVIDEL
                     PPGRKSIKTMHKYDGQRLNVFHFVKQEIAKGRQIYIVYPLIQESEAMDYKDLMDGFES
                     ISRDFPKPEYQISIVHGQMKPADKDHEMERFVKGETQIMIATTVIEVGVNVPNASVMI
                     IESAERFGLSQLHQLRGRVGRGAEQSYCILMSGFKLSEDSKTRLQTMVQTNDGFEIAE
                     VDLKLRGPGDIMGTQQSGVLNLKIADIVKDNQILQVARAYAQQILKEDPNLVLPKNSM
                     IKQAYAQLIQHKNIWNYIS"
     gene            156476..157096
                     /locus_tag="KQA_RS0201690"
     CDS             156476..157096
                     /locus_tag="KQA_RS0201690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonylcarbamoyl-AMP synthase"
                     /protein_id="WP_010177442.1"
                     /translation="MAAFIKLYEENPNPKQIAEAVKVLKNGGLIIYPTDTVYGLGCDI
                     TSVKALNRIAKIKGIKLEKANWSFICKDLSNLSDYVRQIDSSTFKLLKRCLPGPFTFI
                     LPGNNQLPSVFKKKKTVGIRVPDNKICHDLVEALGNPIVSTSIHDEDEILEYTTDPEL
                     ILEKWGNLVDLVIDGGYGDNIPSSIVDVTDNIPVIVREGKGDTSLI"
     gene            157336..157920
                     /locus_tag="KQA_RS0201695"
     CDS             157336..157920
                     /locus_tag="KQA_RS0201695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177444.1"
                     /translation="MKKLLKLGLLSVALASSVIANASNKVKVEVLASNELSITMSEVV
                     EGEVLSITNKKGKLVFSEILSATSSYTKTLDFSKLTQGVYYVKAETESAVKVTPFIIV
                     PDQVKIIKGATKTYNAPVFKVENGIAEVSIDNKDLHDVSITVYAKNSSIPLEEVRLNT
                     PKITKTYNFESLPVSEYKIVIYQGDYSYVKTVKR"
     gene            158419..159003
                     /locus_tag="KQA_RS0201700"
     CDS             158419..159003
                     /locus_tag="KQA_RS0201700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177446.1"
                     /translation="MKKILKLGLLSVALLTTVVVNASNKVKVEVLASNELSITMSEVI
                     EGEVLSVSDKKGEVVFSEILSASSSYTKTLDFSKLTQGVYYVKAETAKAIKVTPFIIV
                     PDQVKIVKGATKTYNTPVFETENDIIKLDIDNKDQHEVSITVYAKNSSIPLEEVRLNA
                     PKITKNYNFKSLPVSEYKIIVYQGDYSYVKTIKR"
     gene            complement(159079..159966)
                     /locus_tag="KQA_RS0201705"
     CDS             complement(159079..159966)
                     /locus_tag="KQA_RS0201705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_010177448.1"
                     /translation="MTEQKINYNKPSFEHLAPDIGNSLIYKRFNIENKNKQPIWHYHP
                     EIEIVYVNEGSGKRQIGSHVSYYQNGDLICIGANLPHCGFTDGFSKTRNETVIQMLPE
                     YLGKDFFNVSEMNPINALLDRAKQGLVFFGETKKEVGAIIENMYSKSPFERILDSLLI
                     LHKLEASKEFEILNAEGFVLKAQAQDNSRINNTFNYVQKNFKKQISIEEISDFVNMTP
                     PAFCRNFKKVTGKTFTQFVNEYRLVHATKLLTEKQESIQGICFECGFNNFSHFNKVFK
                     KYTGKTPTDYRKEMNFTIS"
     gene            160131..160718
                     /locus_tag="KQA_RS0201710"
     CDS             160131..160718
                     /locus_tag="KQA_RS0201710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177449.1"
                     /translation="MKKLFKGGLLSVALLAAVVVNAAEKMNVKVLGSKALNVSLSGVA
                     KGESLSIVDKSGITLFSETLSQADVFEKTFDLTYLPEGVYFLESNEEKRINVSPILIA
                     NNKVSLIAGGSKVYNEPRVVVNGSIAKVVLDNSSKTDVVITVRDADDSELLRSEVLTA
                     ENIYKKFDFSALPKGETYTITVKEDDYYFIKEINL"
     gene            160877..161944
                     /locus_tag="KQA_RS0201715"
     CDS             160877..161944
                     /locus_tag="KQA_RS0201715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate synthase"
                     /protein_id="WP_010177450.1"
                     /translation="MAGNSFGKVFKLTTFGESHGVAIGGVIDGCPAGVTIDFDAIQAE
                     LDRRKPGQSAIVTQRKEPDTVEFLSGIFEGVTTGTSIGFVIRNANQKSKDYSHIKDSF
                     RPSHADYTYYKKYGDVRDYRGGGRSSARETASRVVAGAVAKQVLKGVSFNAYVTGVGH
                     LKLTTPYNELDLSATESNIVRCPDQNMASEMESYIKQIRKEGDTVGGVVSCVISGVPV
                     GLGEPVFDRLHAELGKAMLSINAVKGFQYGSGFEGSALKGSQHNDLFNADGTTKTNLS
                     GGIQGGISNGMDIYFDVAFKPVATIMQDQHTIDKEGNIVEMQGKGRHDPCVVPRAVPI
                     VEAMAALVVVDYMLQNRASQV"
     gene            complement(162022..162732)
                     /locus_tag="KQA_RS0201720"
     CDS             complement(162022..162732)
                     /locus_tag="KQA_RS0201720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_010177451.1"
                     /translation="MQDNSILKCAIVDDSKLQRLAIVKLIEEHSSLELVAEWNNAIET
                     KNGLLDIPVDLLFLDIEMPILTGFDLLDDLENKPKTIFVTGKTKYAFKAFDYDAIDYL
                     RKPLKRDRFNAAVEKALSQTKMAATSKSAENEDYIFVKSNLKKRKIFLNNLKYVEALG
                     DYVKLIMDNSDPVVVLATMKSFESQLPSERFLRVHKSYIVNLKKVERYNNRNIEIDQE
                     QIPVSRHKKAALSEALSS"
     gene            162910..163248
                     /locus_tag="KQA_RS0201725"
     CDS             162910..163248
                     /locus_tag="KQA_RS0201725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019388304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="WP_010177452.1"
                     /translation="MNHYETVFILNPVLSEEQIKETVKKYEDLLTENGAKMVAKEDWG
                     LKKLAYPIQHKKSGFYHLFEYTVSGEVINKLEILFRRDERIMRYLTVSLDKHAISWAE
                     RRRVKLKQKA"
     gene            163251..163547
                     /gene="rpsR"
                     /locus_tag="KQA_RS0201730"
     CDS             163251..163547
                     /gene="rpsR"
                     /locus_tag="KQA_RS0201730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010229177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="WP_010177455.1"
                     /translation="MASIEQQAKGKKDGEIRYLTPLNIDTNKEKKYCRFQKSGIKYVD
                     YKDPDWLLGFLNEQGKILPRRLTGTSLKYQRKVSVAVKRARHLALLPYVADLMK"
     gene            163560..164012
                     /locus_tag="KQA_RS0201735"
     CDS             163560..164012
                     /locus_tag="KQA_RS0201735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="WP_010177456.1"
                     /translation="MELILKKDVENLGFADDIVEVKNGYGRNFLIPQGYGVLATVSAK
                     KVLAENLKQRAYKEQKLVDDAQALANKLNGLEIKISSKSGAGGKLFGSITNADVADAL
                     AKEGISIEKKFISVPGGSIKRLGSYEAPVRFHRNVIANAAFEVVAEKA"
     gene            164095..164577
                     /locus_tag="KQA_RS0201740"
     CDS             164095..164577
                     /locus_tag="KQA_RS0201740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177457.1"
                     /translation="MKYARLSKEQLEALHQEFINFLATQSITGDEWAEIKANKPEVAE
                     EEIDVFSDMIWEGVLNKVEFLEHFSKDQIHLFFLTEEKMHLIAIKVKNKAIDLLTDEG
                     YKWLQQNLMDDSVAFFNATKEYTEDKNVDKFKIIEQGANITKGDLYAYFAKLLDNKKD
                     "
     gene            complement(164861..165721)
                     /locus_tag="KQA_RS0201745"
     CDS             complement(164861..165721)
                     /locus_tag="KQA_RS0201745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein"
                     /protein_id="WP_010177458.1"
                     /translation="MQESITQNVTKTSSDVMNSLSGLFNSLQEGVAQYGLKIVGGIVA
                     LIIGLWIIKVILKAVRKAFDTSKIDSTLKPFLLTLVGFLLKVLLFISIAGIVGIPTAT
                     FAALLAAVGLAIGGAFNGSLGHMAAGVMLLIFRPFKVGDLIETNGKLGFVKEISVFVT
                     ILETFQNKTEIIPNGSITAAAITNLTTIGHLRVDMPFAIQYGTDIKKAKEVVMNVLKA
                     DDKVMKDPAPRVAVNNLGPNGVELLALPYSTSDDYWDVYWDTRQKIVEALGEANYDAP
                     LPQRIVTMKS"
     gene            complement(165837..166262)
                     /locus_tag="KQA_RS0201750"
     CDS             complement(165837..166262)
                     /locus_tag="KQA_RS0201750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF393 domain-containing protein"
                     /protein_id="WP_029209408.1"
                     /translation="MDYNNLPKDIKIILFDGVCNLCSGAIQFMIKHDKKRNFRYASLQ
                     SELGKELLAERNIDPKIIDSIILIDPKKAYYFKSTAALEISKELSGLYPLLRIFLFFP
                     EKMRDPIYDFIAKNRYKWFGKKESCMIPNDEIKSLFLDF"
     gene            complement(166249..167166)
                     /locus_tag="KQA_RS0201755"
     CDS             complement(166249..167166)
                     /locus_tag="KQA_RS0201755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177460.1"
                     /translation="MRIPNPDLLLMKKSLTPIAISLLLSIHLVNCQESSKNRPNPIEL
                     TSDFKSYWYQGEAEISTYELSQNRYGELRNGTATLIYVTEDFLPIKQVKADISAPKNI
                     PVLKLNSVKKFTTGIYPYSIMQSSFSPLKGEKKHALKTTASIQEWCGQTFMQLNNKKN
                     FEIDIKSYFASEGDQKLSLQKSILENELWNLIRIHGDKLLPKGEINCIPSFEFLRLNH
                     KKTQSYKAIASIQKNNNLNTFSLTYPELKRSLKITFQQQFPYIIESWSEEISPHLPTT
                     AKRITTKLLPYWNQNSNKFTPLRKELGLQ"
     gene            complement(167217..167807)
                     /gene="maf"
                     /locus_tag="KQA_RS0201760"
     CDS             complement(167217..167807)
                     /gene="maf"
                     /locus_tag="KQA_RS0201760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation protein Maf"
                     /protein_id="WP_010177461.1"
                     /translation="MLQEKLKNHQIILASGSPRRQQFLKDLEIDFEIQLQPVDEVYPD
                     HLKAEEITNYLSELKAAAFKQRLQHNDILITSDTIVWHNHHALGKPQSAEHAKLMIAS
                     LSNDWHDVISSVSFTTKNKQITKHFTTKVHFKELTIEEIDYYVTNYNPIDKAGAYGIQ
                     EWIGLIGIDKIKGSYFNVVGLPTHIVYETLIALTKP"
     gene            complement(167828..168301)
                     /locus_tag="KQA_RS0201765"
     CDS             complement(167828..168301)
                     /locus_tag="KQA_RS0201765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA
                     (pseudouridine(1915)-N(3))-methyltransferase RlmH"
                     /protein_id="WP_010177462.1"
                     /translation="MTITLLAIGKTDSLQLTQLIEDYKKRLSFYIKFNFEIIPDLKKV
                     KNLSETQQKEKEGELILKKINTSDTLILLDENGKQFNSVDFSNYLQKHMNSGIKNLFF
                     VIGGPYGFSETIYKRANGKISLSKMTFSHQMVRLFIIEQLYRGFTILKNEPYHHR"
     gene            168351..169208
                     /gene="nadC"
                     /locus_tag="KQA_RS0201770"
     CDS             168351..169208
                     /gene="nadC"
                     /locus_tag="KQA_RS0201770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007649995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylating nicotinate-nucleotide
                     diphosphorylase"
                     /protein_id="WP_010177463.1"
                     /translation="MISKEQFNHEIELIIANAIREDVGDGDHSSLACIPKDTQGKAKL
                     LVKDEGILAGVAFAKQVCAYVDPNLEIEVLIPDGSAVKYGDIAFYISGSSLAILKAER
                     LVLNAMQRMSAIATKTKFFVDLLAGTGTKILDTRKTTPGIRALEKWAVTIGGGENHRF
                     ALYDMIMLKDNHIDFAGGITQAINQTKSYLKETGRDLKIIVEARDLNEIKEILKSDGV
                     YRILIDNFNYEDTREAVRLIGDTCLTESSGGIDEHTIRKYAECGVNYISSGALTHSVY
                     NLDLSLKAV"
     gene            169210..170133
                     /locus_tag="KQA_RS0201775"
     CDS             169210..170133
                     /locus_tag="KQA_RS0201775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YihY/virulence factor BrkB family protein"
                     /protein_id="WP_010177464.1"
                     /translation="MSFKLTKIGLKIPGVLLLTKVLKKIVIPGFEGLSIYDLVKMYVN
                     GIVEGAFSTRASAISFSVFTAIFPFLLFLLNLISVIPIDGFQEEFIVFINSLLPPRTS
                     DFFDSIIYDIANKPRPGLLSSTFVLSMVFMTNGINAVFSGFQNSFHTKISRNFLKQYG
                     VAFWVAIIVALFLISTVYIILYFTYLVTAYEQFLIGDTIFWLKFGRVGIFILMIFTTM
                     ATLFYFGTKEGRITRFFSPGAVLTTVLIIVTTYLFGFYIDNFSRYNELYGSIGALLIL
                     MFYIWINANLVLLGYELNASLRNLKMQTVNK"
     gene            170147..170710
                     /locus_tag="KQA_RS0201780"
     CDS             170147..170710
                     /locus_tag="KQA_RS0201780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chalcone isomerase"
                     /protein_id="WP_010177465.1"
                     /translation="MKKVLLALVALMMLNSAVAQTVIGDATLPNNKTYESHELILNGA
                     GLREKLWFDLYAAGLFLKEKNTDADAVVAADQPMAIHLVILSGMLSKKKMIGAFRDGF
                     ENTNDKATVQKLQSKIDKYVSFISEEISVSDRYDIIYTTEKGNELYKNGKLLGAIEGL
                     EFKKALFNIWLSKEPVDDDLKDSMLGN"
     gene            170759..171325
                     /locus_tag="KQA_RS0201785"
     CDS             170759..171325
                     /locus_tag="KQA_RS0201785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_029209410.1"
                     /translation="MKQLLITLALLCSVVATGYAQIPVGRTVMEYEVEYDDTTLKMNG
                     AGTCSMLFIELYSGGLYLQEKSSDPIAIAYDDETMAIRIKITSKLIKRETMLSAIEEG
                     FEKATEGKTGPLKDRIAKVREYYAKPISKGDLLELVYVKGKGVFCYLNSKELGVIEGQ
                     DFKFALFKIWLGENPASESLKKGMLGDF"
     gene            171507..171764
                     /locus_tag="KQA_RS0201790"
     CDS             171507..171764
                     /locus_tag="KQA_RS0201790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2061 domain-containing protein"
                     /protein_id="WP_010177467.1"
                     /translation="MITEKVAGANTTYAQDASSEKPIRSVVKAVSWRVVGTLDTLVVS
                     YLVLGEGRLGEASAIAGVDFVTKMILYFAHERVWNKVKWGK"
     gene            171843..172472
                     /locus_tag="KQA_RS0201795"
     CDS             171843..172472
                     /locus_tag="KQA_RS0201795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoadenylylsulfate reductase"
                     /protein_id="WP_010177468.1"
                     /translation="MSFTQEEIVKYNEELKGKTPLEIVQWAVSKAKKPVVTTNFRPYE
                     ASILEVCVAAKADIPVIWCDSGYNTPNTYRHAEAVIAQLNLNVDLYVPQQTVAHRDVV
                     MGVPGVDDPKHAEFTKRVKLEPFGRAMEAHKPDVWFTNLRKGQTTLRDSLDILSLGAN
                     GVLKVSPFYNYSDAELDVYLSEKGLPNEHKYFDPTKVLGNRECGLHTSN"
     gene            172660..173562
                     /locus_tag="KQA_RS0201805"
     CDS             172660..173562
                     /locus_tag="KQA_RS0201805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase subunit CysD"
                     /protein_id="WP_010177469.1"
                     /translation="MSKELSINPLETEAIHIFREVVSQFEKPVLLFSGGKDSITLVRL
                     AQKAFWPAKIPFPLLHVDTGHNFPETIEFRDRLAKELGVELIVRNVQDAIDAGKVKEE
                     TGKYASRNSLQTVTLLDALEEFKFDAAIGGARRDEEKARAKERIFSVRDDFGQWDEKN
                     QRPELFDMLNGKIDLGQNVRVFPISNWTELDVWSYIEQEEIEIPSIYFAHKRKTFVRD
                     GMIWSAEDDVVYREEDEIVEERLVRFRTVGDMSCTAAVLSDAVSIEKVVGEIRESTIS
                     ERGARIDDKRSEAAMETRKQQGYF"
     gene            173708..174955
                     /locus_tag="KQA_RS0201810"
     CDS             173708..174955
                     /locus_tag="KQA_RS0201810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase"
                     /protein_id="WP_010177470.1"
                     /translation="MEVLKIATAGSVDDGKSTLIGRILYDTKSLTTDKLEAIETRSKA
                     NGFDYLDFSLATDGLVAEREQGITIDVAHIYFSTAKKSYIIADTPGHIEYTRNMVTGA
                     STSQASIILVDARNGVIEQTYRHFFINNLLRIKDIVVAVNKMDLVDFSEEKFNAIKAE
                     FEKMIAQSDYKDQNITFVPISALKGDNVVSTSENTPWYKGESILDHLEKLEAQDVFEK
                     GQARFPVQTVIRPKKDEFHDFRGYAGKLYGGDLAVGDQVTVLPSLTKSKIKEIYFFDK
                     KFDKAGRGSSINVTLEDNINVSRGDMIVKTGEEPGVHKTLKAKVCWMDSKNLVGGTKY
                     LLQHGVNRVQAMVTGIDNVLAPDFSGEDASADALALNQIGEVNIKLAKPVFYDKYAEN
                     KTNGSFILIDPQTNHTAGVGFIQ"
     gene            175075..177165
                     /locus_tag="KQA_RS0201815"
     CDS             175075..177165
                     /locus_tag="KQA_RS0201815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HEPN domain-containing protein"
                     /protein_id="WP_010177471.1"
                     /translation="MQSFRTEIENPIVEKDIIELADKIQMFHNGKIDEEKFRSLRLAR
                     GVYGQRQEGVQMIRIKLPYGKVRSNQLRRICAVSDEYSRGRLHITTRQDIQIHYVDLN
                     RTPELWAELEKDEVTLREACGNVVRNVTASETAGFDVNEPFDVQPYAHAIFEEFLRNP
                     ICQEMGRKFKVSFSSTDEDTGLSYLHDIGFIAKIENGVRGFKVMVAGGLGSQPHLAET
                     LYEFLAAEEIIPAMNAILRVFDRFGERKSRAKARMKFLMAKIGLDAFKELVEEQRIAV
                     PYTSVAIDADAYPQPVIAEVSEIPSVEIKDQKAFTQWKATNLIPQKQAGYIAIGVKVL
                     LGDFYTDKARLLADLVDKYAAGEIRLTLRQNIVIPHVKEELIEVVYAELEKLGFVDAG
                     YNKAVDITACPGTDTCNLGIASSTGIAEELEKVIASEFPQYLNNEDVVIKISGCMNAC
                     GQHNMANIGFQGMTIRTKDKKVAPALQVLLGGGNFGNGEARFADKVVKIPSRRGPEAL
                     RRILNDFDANGNGKKFEEYYAEKGERYFYDFLTELSEADSLPAEYFIDWGTNEEYVKA
                     IGVGECAGVVIDLIETLFLESEEKIANAKISFDNGVYSDAIYHAYSSQINSAKAILLA
                     ENKKTNTQADIVAGFDKEFVETGVIKLEGTFADSVYAINKNAPTKDFATDYIADAEAF
                     LVAVRKFRAASQNA"
     gene            177169..177942
                     /gene="cobA"
                     /locus_tag="KQA_RS0201820"
     CDS             177169..177942
                     /gene="cobA"
                     /locus_tag="KQA_RS0201820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III C-methyltransferase"
                     /protein_id="WP_010177473.1"
                     /translation="MSNYNENTSKGKLTVVGAGPGDVELITLKAIKALKSADAVLYDA
                     LVNPELLDYCTNADLLYVGKRKGCYAFQQEQINELIVQYGKSHGHVVRLKGGDPFIFG
                     RGAEEMEYAAKQGMEVAMVPGLSSSVSVPAMQNIPVTKRGSAESFWVITATTKEHKLS
                     KDVLTAAKSNATVVILMGMHKLGQITEVFANEGKSETPVAIIQNGTRDTEKVVVATIA
                     TIEKEVKKQELSSPAIIVIGEVVNHRTSLLEMQQKLNEV"
     gene            178034..178618
                     /locus_tag="KQA_RS0201825"
     CDS             178034..178618
                     /locus_tag="KQA_RS0201825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional precorrin-2
                     dehydrogenase/sirohydrochlorin ferrochelatase"
                     /protein_id="WP_010177475.1"
                     /translation="MERNNLYPVFLKVKNLNVLIVGGGNVAEEKLHFLTKSSPDAKVL
                     LVAPMFREGTIALANKFCATMVTDVYHEKYLEGRHIVIATTEKPEVNVQVWKDCRAQA
                     KLVNVADNPPYCDFYMGGIVTKGNVKVAISTNGKSPTTAKRLRQFFEEVIPENVDDLV
                     QNLNEYRKTIKGDFEEKVETLNEFTKGLIAKKEK"
     gene            178618..179673
                     /locus_tag="KQA_RS0201830"
     CDS             178618..179673
                     /locus_tag="KQA_RS0201830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="WP_010177477.1"
                     /translation="MIKTDILIIGAGPTGLFCVFEAGLLKLKTHLIDALPQPGGQCSE
                     IYPKKPIYDIPGFPEVLAGDLVDNLMEQIKPFEPGFTLGDRAETIETLDDGTFVVTTK
                     RGVKHNAPVVAIAGGLGSFEPRKPPIPGIEGFEDKGVSYIIRDPEVYRDKKVVIAGGG
                     DSALDWSIFLADVAAEVTLVHRRKEFRGALDSVEKVEELSKAGKINLITDAEVKELFG
                     EGELSGVGIKHKEKGDIKLEVDNFIPLFGLSPKLGPIGNWGLEIEKNAIKVDNSYDYQ
                     TNIPGIYAIGDVNTYKGKLKLILSGFHEAAIMCQSAYQRIFPDKKYVMKYTTVGGVTG
                     FDGSKKEAKKEVVKAIG"
     gene            179822..180139
                     /locus_tag="KQA_RS0201835"
     CDS             179822..180139
                     /locus_tag="KQA_RS0201835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_010177478.1"
                     /translation="MSDVTIKITDREGKVHEVQAPTDMAMNLMEVCKAYELPVEGTCG
                     GMAMCASCQCYVTSDTPLPEMGYDEDMMLAEAFHVEDNSRLGCQIPITPELDGLEVTL
                     APE"
     gene            180342..181694
                     /locus_tag="KQA_RS0201840"
     CDS             180342..181694
                     /locus_tag="KQA_RS0201840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent monooxygenase"
                     /protein_id="WP_010177480.1"
                     /translation="MKQKKIAIVGSGLVGSLLAIYLRKRNYQITVFDRRPDIRKIKFS
                     GRSINLAMSVRGWNALEAIGIKEEVEGLGIPMYHRYIHVNTKDDYTQKYGKDGEAIYS
                     ISRGVLNRKMIDLAEKEGVVFKFEEKVWDVNLPEAKLYTGETEKGKWEEHEFDLIFGC
                     DGAFSRIRHKMQRRSRFNYSQDFLNTGYKELSIPADANGKHVIDKNALHIWPRGKFML
                     IALPNLDGSFTCTLFMPHEGENSFESLTTPQEVRVFWQTYFPDTLQIMPTLLEDYMSN
                     PTSALVTMKCYPWTYWNKVALVGDSAHAVVPFYGQGMNAGFEDVFELDQIIERLGDTD
                     WQNIFETYQEQRKPNADAIAELSYRNFMEMSQKTADPNFILRKKIEKKFSEHYPELWQ
                     PLYSRVTFSNRPYSEAISYGEVQAEIMDQVMQMENIKQDWDTDVVMEFIKEKSSKSMI
                     "
     gene            181733..182173
                     /locus_tag="KQA_RS0201845"
     CDS             181733..182173
                     /locus_tag="KQA_RS0201845"
                     /inference="COORDINATES: protein motif:HMM:PF13673.5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_010177483.1"
                     /translation="METHFVSIGSSLYKEACQLRKELFFKDLENAELLLNDNYEKNSM
                     HLVIESKGAVIGTGRLTITDNNTIGIISQMAIDPDFQRLGLGKFILQSLLKRGRELNV
                     NRITLNARLTAITFYAKNEFIPIGEVFASTKTGVLHQQMELQLG"
     gene            complement(182223..182588)
                     /locus_tag="KQA_RS0201850"
     CDS             complement(182223..182588)
                     /locus_tag="KQA_RS0201850"
                     /inference="COORDINATES: protein motif:HMM:PF06094.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamylcyclotransferase"
                     /protein_id="WP_010177485.1"
                     /translation="MNNEIFLFVYGTLLNKHKNPFAQLLKKNSTKIAKGYIYAKKYHL
                     GEFPGIKLDSNKTYKTYGELLKITSNNTFVLSELDFYEGFFPKKPEESLFIRTTTKVF
                     TKGNIVDAFVYEYTKEINP"
     gene            complement(182581..183225)
                     /gene="msrA"
                     /locus_tag="KQA_RS0201855"
     CDS             complement(182581..183225)
                     /gene="msrA"
                     /locus_tag="KQA_RS0201855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-methionine (S)-S-oxide reductase"
                     /protein_id="WP_010177486.1"
                     /translation="MKSLVILSLFILGINACINNPKNPISKINSEPIQTQRNDGLQNA
                     YFASGCFWCVEAIFESVKGVQEVVSGYSGGITDNPTYKQVGSGNSGHAETIEVQYDPK
                     IINFKTLVKVYYGSQNPTTYGQAPDFGSAYRSIIFFQNENERLIAVEARKEVQNTISK
                     KVRTEIIPFEKFYKAEAYHQDYEKRNPEYPYIVRVSIPRLNRFKAKFPELLKNE"
     gene            complement(183343..185010)
                     /locus_tag="KQA_RS0201860"
     CDS             complement(183343..185010)
                     /locus_tag="KQA_RS0201860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="WP_010177488.1"
                     /translation="MLEISDLKSKKLPELQEMAKALKVPKFRTLKKLDLVYQILDHQA
                     DDPTKVAKVASVLKEEPTETKVNESKPEAPTKTAKETTTPAPSKPKRERKERVVPKKE
                     NNNTPELAKPKRKAPEKDAAPVKEVVKNEKREPNKPRFEKNDRGNNANNNHKNKNHKN
                     NNGNTRDNKGNRDPRNRYKEPDFEFDAIIESEGVLDIMQDGYGFLRSSDYNYLSSPDD
                     IYVSQSQIRLFGLKTGDTVLGQVRPPKEGEKYFPLIKVNQINGLSPQVVRDRVSFEHL
                     TPLFPQEKFNIADRQSTISTRIMDLFSPIGKGQRGMIVAQPKTGKTMLLKDVANAIAA
                     NHPEVYQMILLIDERPEEVTDMQRNVQGEVIASTFDKEAHEHVKVANIVLEKAKRLVE
                     CGHDVVILLDSITRLARAYNTVQPASGKILSGGVDANALHKPKRFFGAARNIEGGGSL
                     TIIATALTETGSKMDEVIFEEFKGTGNMELQLDRKISNRRIFPAIDLVSSSTRRDDIL
                     LDDTTMQRMWVLRKFLADMNPVEAMESINQRVKQTKNNEEFLISMNG"
     gene            185302..185700
                     /locus_tag="KQA_RS0201865"
     CDS             185302..185700
                     /locus_tag="KQA_RS0201865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4293 domain-containing protein"
                     /protein_id="WP_010177491.1"
                     /translation="MIQRIQSVYLLLAALVSGVLSYFFPTGFDKVGEISAPFYYEMLL
                     ISALLSFIIIFVFKNRKLQFVLGRLNILLNVILLGVFVYLTLTVSGEVFASEKGIGRF
                     IPVLSIVLIVLANKAIKKDEQLVKSVDRLR"
     gene            complement(185789..186088)
                     /locus_tag="KQA_RS0201870"
     CDS             complement(185789..186088)
                     /locus_tag="KQA_RS0201870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDGSH iron-sulfur domain-containing protein"
                     /protein_id="WP_010177493.1"
                     /translation="MRYYLKSILTQVEVYCNLELKKYTMSDKKTPIKVSLEPGKKYAW
                     CTCSHSENQPFCDGSHRKHNATPSLAFEVTEAKEASLCTCKLTNNPPYCDGSHRK"
     gene            186249..>188702
                     /locus_tag="KQA_RS18330"
                     /pseudo
     CDS             186249..>188702
                     /locus_tag="KQA_RS18330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522299.1"
                     /note="too many ambiguous residues; incomplete; partial in
                     the middle of a contig; missing stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
     assembly_gap    187632..187681
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="unspecified"
     gene            complement(189197..190444)
                     /locus_tag="KQA_RS0201880"
     CDS             complement(189197..190444)
                     /locus_tag="KQA_RS0201880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA family protein"
                     /protein_id="WP_010177496.1"
                     /translation="MKKTLLIIITTLTIGALHSQENTYNKWSIELDAGALKTFNLASP
                     GHFSPVPEFVAGNFGVRYSLNTKFGIKADFGYQDINNDDNSIEFETKYYRGSIQGVIN
                     LGNIMGFRTTAFKNIGLLFHGGGGLSSFDYNTLGNTGDELAVNFILGLTPQLKLSKRV
                     SFQVDLSYLRHLGQNFNWDGAQNVSGFGSMLTATAGFAINLGKNENHADWTIEDGASS
                     KQLEELSTKIANIEADMIDTDQDGVADYLDREPNTTSGVTVNTKGVTIDNNRNGIPDE
                     FETALDRKYANDTPTATTAPEVSYDEAIKKLLGEGYVNVYFNTASATPSIYSLDAINY
                     LIEYMKEHPEAKAELIGFADQRGSDSFNSSLSARRAKKVYDILIESGIAAERLSHTGN
                     GETASGTSKESLQLRRKVTFKLK"
     gene            190800..191051
                     /locus_tag="KQA_RS0201885"
     CDS             190800..191051
                     /locus_tag="KQA_RS0201885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type B 50S ribosomal protein L31"
                     /protein_id="WP_010177497.1"
                     /translation="MKQGIHPENYRLVAFKDMSNDDVFITKSAANTKETIEIDGVEYP
                     VIKLEISRTSHPFYTGKSKLIDTAGRIDKFKNKYAKFKK"
     gene            191190..192365
                     /locus_tag="KQA_RS0201890"
     CDS             191190..192365
                     /locus_tag="KQA_RS0201890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase"
                     /protein_id="WP_010177499.1"
                     /translation="MNYILFDGPQRQALLPFTYTRPVADIRIGILTIREKWERYLGST
                     TSTVTEDYLAEKWPMVELESNTFICGGILPTKKLVKAIKALQLKEVLYSENEELIAFC
                     VPEGEDPDLDSYKAIQFNDAFAEVKNTWDIFSLNEQAIEADFELLTVDETSQKLSETN
                     KVIGDGRVFIEEGASVECAIFNTTKGSIYIGKEATVMEGAIIRGPFALCEYATIKMGA
                     KIYEGTTVGPHSKVGGEVGNSVIFGYSNKGHDGYLGNSVLGEWCNLGADTNTSNLKNN
                     YAEVRLWSYETSGFAKTGLQFCGLMMGDHSKSGINTMFNTGTVIGVSANIFGGGFPRN
                     FIPSFSWGGSAGFVTYKTNKAFEVAEKVMQRRKIDFTAQEQAVLEHVFEETVRWRKE"
     gene            192501..193076
                     /locus_tag="KQA_RS0201895"
     CDS             192501..193076
                     /locus_tag="KQA_RS0201895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_010177501.1"
                     /translation="MKSLLKVIALYKNEEALLKGLLKNNRSAQRKLYELHAPKMLSVC
                     RYYIKDLHHAEEVMLNGFFKVFQNVNKFKNEGSFEGWIRKIMVREAISYLRSQKKIEF
                     ITETIVLESEYENNIHSTIEVDQIQHCIDLLPEGYKIVFVMYAIEGYKHSEISKMLKI
                     TEGTSKSQLFKARKLLQKKVNELNRTGYATK"
     gene            193063..193857
                     /locus_tag="KQA_RS0201900"
     CDS             193063..193857
                     /locus_tag="KQA_RS0201900"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177503.1"
                     /translation="MLQNEFEKVNKEMLEARSIQPSVDAWDRLSKRLDDDQQNKHKQY
                     KRKYWWLGIAASLIGALFITQQFLYSDFITRSTDVDIVVTENKDIDHLNRKKILKTTT
                     LVTEKQEFNIDSNKSVKHKTALVNREEKSSKKEAKKLVVLNVVPKEKVMMPSQVAHLE
                     KKDTVLKGVTFQDQKIKELLVEVDALEETEVVLSNEIIEDLLLKAQIEIDIENSQIEN
                     KETVNASSLLKSVENDLDMSFRNKVLKALKENYSKVKTGIVQRRDD"
     gene            194012..195076
                     /locus_tag="KQA_RS0201905"
     CDS             194012..195076
                     /locus_tag="KQA_RS0201905"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177505.1"
                     /translation="MNVITKYMVLVLGFVMNIQVANAQDTIQKDVNQFKIKKLETLKA
                     DIKKQEREFLKQEVAAIDELYSKKEITKEQAASQKMEAAKKRALNIDNRIAIINNKIL
                     ILNRNQKDANYKGVIIGDSLKEVFNSIDCESDVPDEKEYDKRIKSGLVLAFGFNNALF
                     DGMDLEDSPYKFAGSRFFEIGWAWNARVFEHTNFMRLRYGLSMQINRLKPDDNKFFVQ
                     EGNKTMLANFPSNLKKSKLTMTNLVLPLHFEFGPSKKEEKETYTKYSTKHKFKIGVGG
                     YGGLNIGTKQKLKFKEDGERVKEKQKRDFNRTKLIYGVSSYIGFGASTLYVKYDLSPI
                     FKNQDVDQNNISIGIRFDVD"
     gene            complement(195259..201912)
                     /locus_tag="KQA_RS19435"
     CDS             complement(195259..201912)
                     /locus_tag="KQA_RS19435"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177507.1"
                     /translation="MKTKTLYLVLLFLVTLSSYAQTYEARINFQNNPNITTPPTGYIA
                     DHGKAFGTSQITIDNSNYNYGWKLKSDDTPFDASADVPGNNNGIGRNRLGIAYDNATD
                     IEKLTGTLVHLQGNHISTWESQPRGNEIYWEIEIPNGIYDITIGVGDVSNSIDSRHAL
                     TIEGISIVPGFIPTPRETREETLTIEVTDGLLTVNALGGFNTKINYINIDTSTNTADL
                     NSLNFTNTNVSTITPENTTVTLIEELTASSDPATLTLSIENLLEVPADTSITNGWLTI
                     QKTGIVGNYTFEINTSNLADGTQETATIIATTKGYKPAIINLALTVGIIPCNPISTLD
                     CNQLKAKLPLQLTFDGSQGGISNTGFTMVDAPSARLASDQPIFSNEIPGYEPSKLLLE
                     NNQLIITATKGIAYQDNTTSRNTNSQINALGTGIDFSELTNFDIITTINQPYSDTSNN
                     FEQAGIWLGLNEDNFIKFVIRNGNNLEVLTELNALAPNAERINLNVPNLNTSKVQLRL
                     HIDVNTNSITAFYKLNDTTEVSIGTIELPQEIRDGNTNYQNLSFAGIYVSKRNENENT
                     EVTYTFEDFSIIPTIEEELINLKINFTTNGSPDIIDYLKDTGLPFEDRGNNFSYGWLT
                     TDGTSPLDLSRNTRNRNTNGVSELQNTLLHMQYGDTGGNNGNTTEGIWELELPEGLYN
                     IIVSVGDPLVDSPATTPLHTINIEGINTINDFTPTGNATTGNRFTTATLTTNITDGRL
                     TIDASGGFNTKINSIEIEQIANSVRPFFTDVNPANNTTDVALENFQIGVSLITPNGYE
                     LDENTIDGNVNLFEVTPTGEVLIPSNSNDTGGGDFINLTPLTPLKENTTYIYRITSNV
                     EANLIGNLNDRLSFFPFESTFTTGMRSTQGSNSRDLTGVAFQKVFGTDLGDGTENERF
                     SSLIIGPDGKLYASTIGNFASDGKIHRWTIETDGSLSNLEILSPELNGAPHPIDGIRD
                     NDTRLIIGLTFDPTSTPTNPIAYITHSKSALSNAPEWDGVLSRLSGPNLEVVEDILIH
                     LPRSAKDHLTNSLAFDESNDLYISQGSNSAGGEIDPAWAFRPERLLAAAILKVELDKL
                     PTNLPLSVYTTDDISVINNAPSDNILMSNNTYNPYATNSPVTIFASGVRNAYDLIWHS
                     NGWLYVPTNGTAGNNTNSPNAPSTADYTLARRIDGLTSIPDVPALQGGNTQKDWLFKT
                     QGGSYHGHPNPYRGEFVLNHGGLAYSNLPGQEDNPYIDVPKYPSTVLPDPNYQEPAYD
                     FGFNKSPNGVIEYKSNAFGGRLQGLLFVSRFSGQDDLLGLDVNSASGDVIDAYNAIPG
                     LQGFDDPLDVVEDVTTGNLYVSEYDRAGGGTPRLTLLRALSGPNNIAVSSDELFFETT
                     VNTDGPMTETNTISVSNTGQSTLEINTISLSGNFSNQFSFSPTATAVSINPGETYELD
                     IIYAPDLNQQDLGFQDAILTIESNNPANPNTRINLYALKKRGFEGGEEPTLQSVVNTI
                     GVGIDVGWTTLANGVNPDPIGDEVETELWVKASDAPVTLTPVARYSPAEELPYGWYTN
                     QQTTQQFNVIDTLETGLQNAQRLFPPSKSGIKEFDPQNEVFGIFVESLFFNRISYTQD
                     PLNIDVAHRTRIYPNKDRNGSIIENSFLIAFEDLNNGDYQDYVFILDNATPATILPTS
                     NGILSLENLTKIPTTNIGFPAEDYLTFHKIRDIRPNTDVQDSNTLRLNNVGTEALVVS
                     DIKISGPSVFSFSILDTTGNPISLPFSIEAGSFADLPIIFDGDGSDGKSFFINEMTVT
                     SDAITTPEVKATLNGSHQQGQEGGREINAQQVFDAFGLQTSMLSIVNDNGTITPPNFR
                     SFRPSSNFPIATNIDMGYEGDMIFSEAFVQADPTQPVIGFQISAMHGPGGNGARFVAL
                     DNTDTVGDINFFHSRTWFQTLLPRNNRGDNISFDTATTISEPFRIAISNYLTTGGNNI
                     DGRRPDLLGARVYRVINNKGELIPNEYIVLQDFVQNGCGAGSANCDWNDNIFYFKNIR
                     PQAVPTATAITNQTATIAQNFELNVTDSFDKGYPGNKLTYIVNLSNGTALPNWLTFNE
                     ATGTVSGIPPVNSQGSILSIAIEAIDFNGLTASTEFTLAIIDTNPPTQPIVTTNATTT
                     NSDIIIFPNPTSDLINIQTQDINSIQSIDFFDSNSAILIASFTTNQLETPNGLQFSTI
                     SYPQGIYLLKINFNNGTSEEHLIEISR"
     gene            complement(202547..203161)
                     /locus_tag="KQA_RS0201915"
     CDS             complement(202547..203161)
                     /locus_tag="KQA_RS0201915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177509.1"
                     /translation="MIKNLFLTISILFFLNTYSQKNGVNIIEEVGKKRTLIFAKNTTN
                     KPRSVFFKVHANGYRRSGDRPVIKQLPPNSKTLLITLIPLVDVPSRYTYTFVANKTLE
                     NIQLKGKEESEADVAELMKQEIVVFTNSSCSKCDNLKKQLNNKHIKYREIDIDLRERF
                     YKYTWKLLEKKGYRTDTLKLPLASVKGKIFHPINSIATFLNEIE"
     gene            203311..204078
                     /locus_tag="KQA_RS0201920"
     CDS             203311..204078
                     /locus_tag="KQA_RS0201920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="WP_010177510.1"
                     /translation="MELKLSRPICFFDLETTGVNISKDRIVEISILKVFPNGNKESKT
                     WLVNPEMPIPTETTAVHGVTNEKVANEPTFKQLAKVISDMIKGCDLGGYNSNKFDIPL
                     LAEEMLRADMDFDMSNNVAVDVQNIFHKMEQRTLVAAYKFYCDKDLTNAHSAEADTTA
                     TYEVLCSQLDKYPDLENDMEFLSEFSTRRKTADFAGFIAFNEKEQEVFTFGKHKGKLV
                     EEVLDKEPGYFGWIQNADFPLYTKKILTAIRLRKFNA"
     gene            204085..204696
                     /locus_tag="KQA_RS0201925"
     CDS             204085..204696
                     /locus_tag="KQA_RS0201925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAA hydrolase family protein"
                     /protein_id="WP_010177513.1"
                     /translation="MKIICIGRNYAAHIEELKNEKPSDPVVFLKPDTSVLLKKQPFFM
                     PDFSNDVHHEIEFIIKINRIGKHINPKFAHKYYDEVSVGIDFTARDVQNELRAKGLPW
                     ECSKAFDGATVLGKWVSKSKFPDISNVNFKLYKNDVVVQDGFTKLMLYSVDELIAYVS
                     KYFTLKIGDIIFTGTPAGVSPVAVNDQLKGYLEEEEMFHIKVK"
     gene            204697..205038
                     /locus_tag="KQA_RS0201930"
     CDS             204697..205038
                     /locus_tag="KQA_RS0201930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hpt domain-containing protein"
                     /protein_id="WP_010177515.1"
                     /translation="MSISYDLEKVKELAGGDESFVEILLQTFLEEIPEDLKNMSDAVA
                     VNDAKVAYQYAHKMKPNFQLFGIDVIDHIKRIESWANEEITFDEAKVALLVVEEKAEK
                     AIVSLRELLNK"
     gene            205045..206307
                     /locus_tag="KQA_RS0201935"
     CDS             205045..206307
                     /locus_tag="KQA_RS0201935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence/damage-inducible protein A"
                     /protein_id="WP_010177517.1"
                     /translation="MLAEIITIGDEILIGQIVDTNSVFIATELNKIGVDVHQISSIRD
                     DREHILKALAEAQSRVDLVLVTGGLGPTKDDITKHTFCEFFNDTLIENKDVLEHVKGL
                     FDKYIKSPISEVNKKQALVPSKAEVLTNEFGTAPGMWLVDKNTVFVSMPGVPFEMKAI
                     VKDQLIPRLQERFNRPYILHKTILTYGMGESRVAERIEDFENNLPTYIKLAYLPSLGR
                     VRLRLSARGDNEKQLKLGIAKAVEQLKDLIGDIIVGFDENESLEHVIANLLTTHNFTL
                     ALAESCTGGKIARGFTKIGGASAYFKGGLVPYDTALKTTILGVPKALIEAHSVVSTQV
                     AASMAEQSLKLFQSDFAIATTGNAGPTKGDSDAEVGTVCIAIASPKGVVSEQFVFSNH
                     RERTIGKAVNKSLELLQEQILAVLGTAE"
     gene            206444..206683
                     /locus_tag="KQA_RS0201940"
     CDS             206444..206683
                     /locus_tag="KQA_RS0201940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011710112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_010177519.1"
                     /translation="MSRVCELTGKKAMVGNNVSHAMNKTKRRFNANLIKKRFFIPEEN
                     SWVTLKVSTAALKTINKIGISAAIKESVEKGIYKK"
     gene            206711..206893
                     /gene="rpmG"
                     /locus_tag="KQA_RS0201945"
     CDS             206711..206893
                     /gene="rpmG"
                     /locus_tag="KQA_RS0201945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011963553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_010177521.1"
                     /translation="MAKKGNRIQVILECTEHKATGQPGTSRYITTKNKKNTPDRIEIK
                     KFNPILKRMTVHKEIK"
     gene            206901..207053
                     /locus_tag="KQA_RS19780"
     CDS             206901..207053
                     /locus_tag="KQA_RS19780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010250750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4295 domain-containing protein"
                     /protein_id="WP_010177523.1"
                     /translation="MAKKSVATLQTGSKRLTKAIKMVKSPKSGSYTFVESIMAPDATK
                     DFFNKK"
     gene            207166..208119
                     /locus_tag="KQA_RS0201955"
     CDS             207166..208119
                     /locus_tag="KQA_RS0201955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002990307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle-docking protein
                     FtsY"
                     /protein_id="WP_010177525.1"
                     /translation="MGFFKKIFSKDKKESLDKGLEKSKTSFFSKLGKAVAGKSKVDDE
                     VLDNLEEVLVSSDVGIKTTVKIIDRIEARVAKDKYLGTAELDQILREEIAGLLSETNL
                     GEAEEFVIPKDKKPYVLMVVGVNGAGKTTTIGKLANQFKKQGLSVVLGAADTFRAAAI
                     DQLQVWADRVDVPIVKQSMGSDPASVAFDSLKSGVAQNADVIIIDTAGRLHNKINLMN
                     ELTKVKNVMKKVIPDAPHDVLLVLDGSTGQNAFEQAKQFTAATEVSSLAITKLDGTAK
                     GGVVIGISDQFQIPVKYIGVGEGIDDLQVFNKFEFVDSFFK"
     gene            complement(208251..209444)
                     /locus_tag="KQA_RS0201960"
     CDS             complement(208251..209444)
                     /locus_tag="KQA_RS0201960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyhydrolase"
                     /protein_id="WP_010177527.1"
                     /translation="MSTQKETNLREEYQLTDEIIDKFGITNPDKLSAATKRALKWPRD
                     LGKDWFFEYEVYDLKGDLAYEEGVVRRDPSALIKVDGLYYVWYTRSTGPSQGFGGDIE
                     NDKVFPWDRCDIWYATSEDGITWKEQGPAVERGPKGAYDDRSVFTVEIMVHEGVYYLS
                     YQTVKSPYTVRVKNQIGLAWSNSPNGPWTKSEEPILSPADNGVWEGTEQNRFRVEKKG
                     DFDSHKVHDPCIIPFNGKFYLYYKGEQMGEEITFGGRQIRHGVAIADNPKGPYIKSEY
                     NPISNSGHEICVWPYNNGVAALITTDGPEKNTVQWSPDGINFDIKSVIKGAPHAIGLN
                     RTLDSEKGPVEILQWGVTHKYMNYDYQYIRGFKTWTIENHTAPGEATKDGTTSNEGSV
                     ITDKF"
     gene            complement(209528..212083)
                     /locus_tag="KQA_RS0201965"
     CDS             complement(209528..212083)
                     /locus_tag="KQA_RS0201965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4982 domain-containing protein"
                     /protein_id="WP_010177529.1"
                     /translation="MKLFFLISSLALFFISCNQPKSQDTVTPKITDFNFGWKFYLDKG
                     TTDASSENFDDSKWNAVLLPHDWVIEESIDTTNASNQLYMGSGYRKGEGIGWYRKSFA
                     SPSKDKKVYILFDGVYNNSEVFLNGKSLGIHPYGYSPFYFDISNKLKTDATQNILAVK
                     VDHRTYADSRWYSGAGIYRNVSLITTNKLHIPVWGTFITTPKVSKESADVSIKTTLKN
                     NTQATQNFTLKTVIIDPTTDNIITSSASEQTVETNTTIEATHILNITSPKLWDIKHPN
                     LYKIETTITQNDKIIDRDQSSFGVRSIRFDSNTGFFLNGENHKIKGVCLHHDGGLVGA
                     AVPKGVWKRRLLKLKEGGVNAIRISHNPASNEFLDLCDEMGFLVQDEFFDEWDYPKDK
                     RFNQKEKKALPETEGYPRFFQEWAEKDLKNTILSHRNHPSIFQWSIGNEIEWTYPRNA
                     AATGFFNNMNWDGNYFWSEPPYAPEEIKKQLETLPKGKYDIATTAQKLSKWTKELDKT
                     RPVTANCILPSASHLSGYADALDVVGYSYRRVLYDYGHKNYPNKPIMGTENLAQWHEW
                     KSIMERPHISGTFLWTGIDYQGEIREPWPTVVQPSGLLDIAGFEGGSFGMMRSLWNNK
                     PNMFVTTQHIEKSLYKLDNKGKIIAKDPEAWKHALWQWHPINRHWNYENGKMIAVESY
                     SNCTEIELFLNGKSFGKKFLIDNDDHIYKWAVPFNAGTIKLVGIKDGKTITENITTAG
                     APTKIKLSVDNSQLTNNNYDVSHIVAQLVDKDGNPVKTEEQKITFNVPASLRVLGVDN
                     GDKQNNQDFNSNSLTTSKGRALLIVQSTETITEATINATSNTLKSNEILIKVN"
     gene            complement(212298..212957)
                     /locus_tag="KQA_RS0201970"
     CDS             complement(212298..212957)
                     /locus_tag="KQA_RS0201970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="WP_010177530.1"
                     /translation="MGITKIAPSVLAADFANLQRDIEMINNSQADWFHIDIMDGVFVP
                     NISFGMPVLKAIQKHATKPLDVHLMIVDPDRYIKTFVELGAEIITVHYEACTHLHRTL
                     QLIKSYGVKAGIALNPHTNIELLKNVLTETDLVCLMSVNPGFGGQSFIENTYSKITAL
                     RQMATEQQTDLLIEIDGGVSNKNANQLIDAGANVLVAGSYIFGASNPVETVKNLKEQL
                     L"
     gene            complement(213145..214008)
                     /locus_tag="KQA_RS0201975"
     CDS             complement(213145..214008)
                     /locus_tag="KQA_RS0201975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015482077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="WP_010177533.1"
                     /translation="MRQLKITKQVTNRETASLDKYLQEIGKVDLITADEEVELAQRIK
                     AGDERALDKLTKANLRFVVSVAKQYQNQGLTLPDLINEGNLGLIKAAKRFDETRGFKF
                     ISYAVWWIRQSILQALAEQSRIVRLPLNKIGSINKINKTYAFLEQSHERPPSAEEIAN
                     ELDMTISDVKESMKNSGRHVSMDAPLVEGEDSNLYDVLRSGESPNPDRELMHESLRTE
                     IERALETLTPREADVIRLYFGLGNQHPMTLEEIGETFDLTRERVRQIKEKAIRRLKHT
                     SRSKILKTYLG"
     gene            complement(214183..214641)
                     /locus_tag="KQA_RS0201980"
     CDS             complement(214183..214641)
                     /locus_tag="KQA_RS0201980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_010177534.1"
                     /translation="MENFELDNYDRSIIKELELDGRKAYSAIAQKLDISNTMVNQRVN
                     KMIENGILTGIGPIINEKKAGYDWGAFTGLTLKKDHDSEKIIKKLKEIPEITECYFVT
                     GSFTLFVRINAKSHEHMREILYNKLDHIKGIQKTDSIVDLGCAFKRNITL"
     gene            214797..217391
                     /locus_tag="KQA_RS0201985"
     CDS             214797..217391
                     /locus_tag="KQA_RS0201985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_010177537.1"
                     /translation="MIKINFLLGLLLLSTFGMLGQIEVTGSVTDNIGNFLPNADIIEK
                     GTTNGTTTDFNGNFKLEVNKGATIVISYVGFESQEIEITTQTSFQITLNPDNSLKEIV
                     LVGSRSPKRTVVDSPVAVDIIDIAEVTSKTGKVEITELLQFAAPSFNAQKQSGADGAD
                     HITPATLRGLGPDQTLVLINGKRRHQSSLVNLFGTRGRGNTGTDLNAIPASSIKRIEV
                     LRDGASAQYGSDAIAGVINIVLKTSVNKLTGEVFYGASDVNDNGGFGIPAKEGLDGNT
                     YKATANYGVALNEKGGYVNVTGEFLKKEKTFRPGADFRSKFGEASIDAFHGFFNSEIP
                     INDLSTFYAFGGASIKDTDAFAFDRGANDNRNVTTIYPNGFTPRISSIIRDRSISAGI
                     KSKFRDWDVDFNTTYGINEFHYFIKGSLNASLLEASPTEFDAGGHSLSQNTTGIDLTR
                     NFDVLSGLNIAFGGEYRIENFNIFTGEEASYTQYDLKGVPLSSATPVEDRPTAAQSRP
                     GGSQGFPGYSPANEVDQFRTNLSAYIDGELDVNDNFLIALAGRFEHYSDFGSTFTGKL
                     SSRLKLIPNLNMRGSLSTGFRAPSLVQLFYNLKFSDFEAGELTETLLSQNASPVTQSF
                     GIGKLKEEKAKSASVGFSYSGNGFSASIDGYYTKVDDRIVLTGSFNESSGLNPNLGVA
                     AARFFANGVDTEVLGLDFVFTYTTRFDEHKLGANLIGNLNKLNITEINTGDISEANID
                     TFFGEGEQAFLKFSSPEYKISLGVDYAYSKYSANIVTTFFGNVGPFVSNDDSSLKNTY
                     GSTSTTDISVAYSITDNIKITIGSNNVFNQYPDEQDPNGTESFGIYDAVQQGFGGAFY
                     YTRLSYSF"
     gene            217476..218744
                     /gene="rocD"
                     /locus_tag="KQA_RS0201990"
     CDS             217476..218744
                     /gene="rocD"
                     /locus_tag="KQA_RS0201990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine--oxo-acid transaminase"
                     /protein_id="WP_010177539.1"
                     /translation="MNLEKTFIDQEEMYGAHNYHPLPVVLKKGEGVYVYDVDDKRYYD
                     FLSAYSAVNQGHCHPKIIEALTSQANKLTLTSRAFFNDQLGPFEEFISKMFGYDKVLL
                     MNSGAEAVETAMKLARKWGYQKKGVAQNKATLVFVTGNFHGRTLSIISASQDPVSKNG
                     FGPYMEGISIVPYNDIEALEVCLSTNKNIVGFIVEPIQGEAGVILPDATYLKRVRALC
                     TEYNVLYIADEIQTGIARTGNLLASCGDCKCTDRCNLTKEIKPDIVILGKALSGGVYP
                     VSAVLANNEVMLCIQPGEHGSTYGGNPLACVVSRAALDVIIEEKLTIQAKEKGAYLRD
                     KLEMLKDKYPLIISVRGKGLLNAIEIDSSEQSELAWQICLEFRDNGLLAKPTHGNKIR
                     LAPPLIITYDQIDECVCIINKSLQKFSCHE"
     gene            218737..219735
                     /locus_tag="KQA_RS0201995"
     CDS             218737..219735
                     /locus_tag="KQA_RS0201995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidinotransferase"
                     /protein_id="WP_010177541.1"
                     /translation="MNKGNSMVQDKVNTEGTKVFSQRPALTSNVMMVRPANFGFNDET
                     AENNAFQINNTEISTAEIAAKAVQEFDRFVTMLKKNDVNVEVIQDPQFPVNPDAVFPN
                     NWISFHHPDFVVTYPMFALKRRNERRKEIIDDLKLAYSIKAQFEFEHFEKEKMFLEGT
                     GSIVFDRTHKIAYACKSIRTNEYLFNKFCEDLHFTPILFDAVDKKGQPIYHTNVMMTV
                     GVDFVIICMESIASVVDRKKLEALFKETGKAIIPISIPQMEQFAGNMIQLKNKNEESL
                     LVMSSKAFNSLTQVQLIEMENYAKIIHADLDVIETYGGGGARCMIAEIFLKPLHGK"
     gene            219760..221013
                     /locus_tag="KQA_RS0202000"
     CDS             219760..221013
                     /locus_tag="KQA_RS0202000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidinotransferase"
                     /protein_id="WP_010177543.1"
                     /translation="MEETKILIDSQPKYSVQAEFNRAQAVIMHEPSSELYYGVLHPHA
                     ALFDSYFNAAKAAKEHKQFQQLLKNRGIEVFTVKEALLKNVVDELGEPIEGKELEEFR
                     DFARSCVRLNTPSLTGLSYDEIVEQHIYLDKVFKKMHPVDLVRTILLQPNLILKRTLT
                     NTFVTADYNANPVMNLYFSRDQIITTGKGVVLTNLNSPQREIETRILCMCLKKIGIKP
                     LLDLSKVNKSAHIEGGDFFMLNNIALIGEGMRSNRLAIEILMKADVIGTEQVALIKDN
                     YHYQPQMHLDTYFNIIDKDLVAISHNRYNAGPGTKQELLVDIYVKGAASYQLTEVSIP
                     FKKYLEDYLKVEVIVISDEDQKNYGLNFLCISPRNIIAVKGQSEDYKNKMALHNVAVE
                     WVDFENLKQGWGAAHCTTQVINRKI"
     gene            221017..222645
                     /gene="pruA"
                     /locus_tag="KQA_RS0202005"
     CDS             221017..222645
                     /gene="pruA"
                     /locus_tag="KQA_RS0202005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="WP_010177545.1"
                     /translation="MSNAFYTIPEPSNELVKSYAKGSLERKLLFEAYDEMYKRRIVVP
                     LYINGEAIFTENKEAIRPPHDFNHVVGDYVKASPSHVKSAIDSCLKAKADWEQMPWQD
                     RAAIFLKAAALISGPYRYKINAATMIGQSKNVYQAEIDSACELIDFFNFNAKFLEEIY
                     SSQPISSVGIWNRTEYRPLEGFVYAITPFNFTAIAGNLPAAPVLMGNVCVWKPSESQM
                     YSANIIMEVLIEAGLPKGVINMVSGDPVMISDSVLNHKEFSGLHFTGSTKVFKTLWKQ
                     IALNLDHYKTYPKIVGETGGKDFVWAHPSADAAIVGTALIRGAFEYQGQKCSAASRAY
                     IPKSMWAELKVFLEAELKTIRVGSPRKVSNFINAVIHEASFKKLVEIIEFVKASNDAS
                     ILFGGGYDNNIGYFVDPTIIVAKNPNFRTMTEELFGPILSIYVYEDTQWEKVLKTVDQ
                     TSEYALTGAIFAQERSVITKATAILRNSAGNFYINDKPTGAVVGQQPFGGARGSGTND
                     KAGSIYNLLRWVSPRTIKENFVPPTNYSYPFLEE"
     gene            222687..223262
                     /locus_tag="KQA_RS0202010"
     CDS             222687..223262
                     /locus_tag="KQA_RS0202010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarC family protein"
                     /protein_id="WP_010177547.1"
                     /translation="MVFDIKEIITATMILFAVIDIVGSIPIIIDLRKKVGHIQSGKAT
                     IVSAILMVTFLFVGKQMLELIGIDVNSFAVAGSFIIFFIALEMILGVQLYKAESLQTA
                     AIVPLAFPLIAGAGTLTSILSLRSEYQPVNIIIAILINCLVVYIVLKSSVKIEKVLGN
                     QGIDVVRKIFGVILLAIAVKLFTTNIKGLLA"
     gene            223304..224140
                     /locus_tag="KQA_RS0202015"
     CDS             223304..224140
                     /locus_tag="KQA_RS0202015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177550.1"
                     /translation="MLLSLSACKKEVPQIAEADTEFISRSHLSNEEEISKVPILNFGT
                     FHMGNTNDARKTEFDEKNEENKRKVHKIANALAKFKPTVIIVERLPKYDKKLLASYNE
                     YIKNPKESFKNPSEIELLAFEVGRLSNTKRMYGIDHHMDYNYMIGDEIKNQIDATMYN
                     QFDINPLLYYPKINVDEDKLSLLDKLKLTNQDDYLDFLIEANADILTHAGTDANFEGA
                     DEAAKYYKRNLRMYSNLNRIKLEPTDRVFMIMGASHTAFFRDFIKRSPKYKMVDTFDY
                     LK"
     gene            complement(224153..225493)
                     /locus_tag="KQA_RS0202020"
     CDS             complement(224153..225493)
                     /locus_tag="KQA_RS0202020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M28"
                     /protein_id="WP_010177551.1"
                     /translation="MKKGLLLVSFLFLIKFSFAQIESKIYDIIENVSAKQIEKDIRKL
                     AGFGTRNTFSDTLSETRGIGAARRWIKAEFEQISKNCNHCLEVSYQKDFVTKSMSKRV
                     PKDAWVVNVLAIQKGSKYPNRYVIMSGDIDSRASDTMDFTTDAPGANDNASGMAGTIE
                     AARVLSKYTFENSIIYVGLSGEEQGLFGGAGLAKYAKEQAWDIIGVLNNDMIGNIKGV
                     DGVIDNRSFRIFSEPTNITDTEDQIKRRRYYGGEVDGISRQLARYVHKSVQTYMPEMN
                     PMLIYRLDRFGRGGHHKPFNDLGYAGIRIMEAHENYTQQHQDIRTENGIDYGDTVEHV
                     NFGYAAKLTAVNAINLAQLAWASPPPTEVKIGGIVESSVKLKWKKISDSNIKGYKIYW
                     RSTTSPTWDYSRYVGNVDQFTLKGIVIDNYFFGVSSVSMEGIESPVVFPNAVFK"
     gene            complement(225667..227883)
                     /locus_tag="KQA_RS0202025"
     CDS             complement(225667..227883)
                     /locus_tag="KQA_RS0202025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010521877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="WP_010177554.1"
                     /translation="MIPQVFKEVIDLGDGREITIETGKLAKQAHGSVVVTMGKTMLLC
                     TVVSNYKQSDVDFLPLTVDYREKYAAAGRYPGGFFKREARPSTEEILVMRIVDRVLRP
                     LFPKDYHAETQIMIQLMSHDPEVMPDALAGLAASTAIQLSDIPFEAPISEVRVSRING
                     EFIVNPTFAQLAESDIDMVIGASADSVMMVEGEMDEISEEEMIEAIKVAHEAIKVQCA
                     AQVRLAEAFGKKETREYTPEDTDEELAKVVNDFAYDKCYAIAKQASAKHDRGAAFGEI
                     KEELQAQYSEEELAEKGDLISKYFNKTQKEAVRNLTLEEGIRLDGRKTTDIRPIWCEV
                     DYLPTTHGSAIFTRGETQALATVTLGTSRDANIIDNASHEGEERFYLHYNFPPFSTGE
                     ARPLRGTSRREVGHGNLAQRALKGMVPEDCPYTVRVVSEILESNGSSSMATVCAGTMA
                     LMDAGVQIKKPVSGIAMGLISDGDRYAVLSDILGDEDHLGDMDFKVTGTEDGITACQM
                     DIKVKGLSYEILVNALKQARDGRLHILSKLTDTIATPAGDVKDHAPKMVTRVIPNEFI
                     GALIGPGGKNIQELQKTTDTTIVINEDPVTEEGIVEILGTGAEGIDAVLARIEAMLFK
                     PQVGSVYEVKVIKILDFGAVVEYKEAPGNEVLLHVSEFAWERVENVTDVLNLGDELDV
                     KYFGIDSRTRKEKVSRKALLPKPEGYVARPPRDDKGKGRDNRGRDNRDRKPREKRD"
     gene            complement(228156..228425)
                     /locus_tag="KQA_RS0202030"
     CDS             complement(228156..228425)
                     /locus_tag="KQA_RS0202030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007096857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_010177556.1"
                     /translation="MYLTKEVKEEIFAKHGKGKNDSGTAEAQIALFTHRITHLTEHLK
                     QNRKDYNTERSLVKLVGKRRSLLDYLIKKDILRYRAIVKELGLRK"
     gene            complement(228549..229061)
                     /locus_tag="KQA_RS19785"
     CDS             complement(228549..229061)
                     /locus_tag="KQA_RS19785"
                     /inference="COORDINATES: protein motif:HMM:PF08534.8"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TlpA family protein disulfide reductase"
                     /protein_id="WP_081483225.1"
                     /translation="MISKSYNKANELTKNSKYGKIIGTFIKLSKNPKKGDQFTDFTQN
                     DSNGKSITFSNVKKKYTLIDFWASWCLPCKKLNPELRKVYHEFNAKGFEIVAVSLDQN
                     QEAWLNAIRKDQLDWIQLSDLNGWENPVGYMYGVKNIPENFLIDTKGTIIDTRLNPKK
                     LRKVLSNVLN"
CONTIG      join(AHHE02000004.1:1..37365,gap(68),AHHE02000005.1:1..106838,
            gap(47),AHHE02000006.1:1..43313,gap(50),AHHE02000007.1:1..41434)
//