spacer

EBI Dbfetch

LOCUS       NZ_JH621247           229115 bp    DNA     linear   CON 25-JUN-2014
DEFINITION  Aquimarina agarilytica ZC1 Scaffold2, whole genome shotgun
            sequence.
ACCESSION   NZ_JH621247 AHHE02000000
VERSION     NZ_JH621247.1  GI:402294977
DBLINK      BioProject: PRJNA173055
            BioSample: SAMN02470972
KEYWORDS    WGS; RefSeq.
SOURCE      Aquimarina agarilytica ZC1
  ORGANISM  Aquimarina agarilytica ZC1
            Bacteria; Bacteroidetes; Flavobacteriia; Flavobacteriales;
            Flavobacteriaceae; Aquimarina.
REFERENCE   1  (bases 1 to 229115)
  AUTHORS   Lin,B., Lu,G., Li,S., Hu,Z. and Chen,H.
  TITLE     Draft Genome Sequence of the Novel Agarolytic Bacterium Aquimarina
            agarilytica ZC1
  JOURNAL   J. Bacteriol. 194 (10), 2769 (2012)
   PUBMED   22535944
REFERENCE   2  (bases 1 to 229115)
  AUTHORS   Lin,B., Lu,G. and Hu,Z.
  TITLE     Draft Genome Sequence of the Novel Agarolytic Bacterium Aquimarina
            agarilytica ZC1
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 229115)
  AUTHORS   Lin,B., Lu,G. and Hu,Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-FEB-2012) Department of Biology, Shantou University,
            Da Xue Road No. 243, Shantou, Guangdong 515063, China
REFERENCE   4  (bases 1 to 229115)
  AUTHORS   Lin,B., Lu,G. and Hu,Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-DEC-2011) Department of Biology, Shantou University,
            Da Xue Road No. 243, Shantou, Guangdong 515063, China
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Bacteria are available from China Center for Type Culture
            Collection (CCTCC) or Biological Resource Center (NBRC, Japan) with
            the following accession numbers, CCTCC AB 2010229 and NBRC 107695.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method       :: SOAPdenovo v. 1.04
            Genome Coverage       :: 50x
            Sequencing Technology :: Illumina HiSeq 2000
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 05/23/2014 20:57:13
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.5 (rev. 435325)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 3,335
            CDS                          :: 3,273
            Pseudo Genes                 :: 23
            rRNAs                        :: 3 ( 5S, 16S, 23S )
            tRNAs                        :: 35
            ncRNA                        :: 1
            Frameshifted Genes           :: 17
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..229115
                     /organism="Aquimarina agarilytica ZC1"
                     /mol_type="genomic DNA"
                     /strain="ZC1"
                     /db_xref="taxon:620914"
     gene            <1..2258
                     /locus_tag="KQA_RS0201050"
     CDS             <1..2258
                     /locus_tag="KQA_RS0201050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015345282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=3
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177308.1"
                     /db_xref="GI:497863152"
                     /translation="DTPSGTYVVEYEICEVGASPVNCDKAEATIVVANPIVATDEDFS
                     ATPLTVGDSSPSVIDMNDTLDGSGPVTVGINPGDVGLTGTNVPAGLTFNPDGTISVDA
                     DTPSGTYVVEYEICEVGANPANCDKAEATIVVANPIVATDETLAPVDTLGGDVTIPSV
                     IDSGETLAGTPVTVGTGAGDVTVSPNPSGSTPVGFTLNNDGSIVVPENTPSGTYTVDY
                     QICENGSTPANCAMATATVIIDNSIVATSETLASVNTVGGDTTTPSVIDSDETLAGIP
                     VVIGTSPGEITVNDNPNTTNPTGFIVNPNGTITVPEGTPSGSYDIEYEICENGASPVN
                     CAIAVATVVIENPIEAEIDDYTTTSITGGASTPNILGNDTLAGSPVVLGSAPGEVSLI
                     GTNVPSELTLNPDGTITVSSTASTGTYTLEYQICENGTTPVSCDTATATVRVENSLVA
                     SNDDFTSTPFGTGSTTPSILDNDSLNDLGPVVPGTGIGEVTLSPVNIPEDLTLNPDGT
                     ITIADEALPGTYTLEYQICENGANPAKCETATASIEVLDDPIQATNDDFTATRFSPGD
                     TTIIVIGDNDTLNNEPIDLGIGTGQVTITDNPNGTNPEGIKVNPDGTVTIDLDVKSGS
                     FVVEYQICENDAVPANCDVASVLIEVAAGDVEVFNGLSPDGNGLNDFLRIDGLQDTSS
                     NSIEIYNRWGVKVYETKNYGSNGNVFRGFSNGRVTIDENQLLPTGTYFYVLNYTKDNR
                     NEVKQGYIYIN"
     gene            2321..3271
                     /locus_tag="KQA_RS0201055"
     CDS             2321..3271
                     /locus_tag="KQA_RS0201055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_010177309.1"
                     /db_xref="GI:497863153"
                     /translation="MEKKFFRSAMVILGIIISTVAQAQQDPQYTQYMYNPSVVNPAYA
                     GSRDVLSIVGLHRSQWVGVEGAPRTQTLGIHSPIGIGRVGLGGNIVHDEIGPSQETYL
                     TADFSYTIPTSEKGNLSFGIKAGAHILDVDFTKLNISDAGDIFDRNIDNKVSPNIGLG
                     LFYYTDKFYLGLSAPNLLQTRHFDNVNINTSTGSSFLSKERVHYYITTGRTFDLSSNV
                     KFKPAILSKIVFGAPLQLDLTANFLIWEKLTLGAAYRWSAAWSALAGFQISDSLMIGF
                     GYDRETTPLGDTSFNDGSYEVMMRFELFRKQNKIITPRFF"
     gene            3284..5269
                     /locus_tag="KQA_RS0201060"
     CDS             3284..5269
                     /locus_tag="KQA_RS0201060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope biogenesis protein OmpA"
                     /protein_id="WP_029209397.1"
                     /db_xref="GI:656263443"
                     /translation="MNTKNIKNVILYSFLGFSALVAQEQKIKKANKAFENYAYIDAQK
                     TYLSVVEQGYTSADVYEKLGDSYYFNADLESAAIWYGKLFYEYASNVKPEYLFRYSHA
                     LKNIGNYELSDKVMEQFGKVTGVKEQRVKFFNKDRNYLALIEKQSGKFKVYNVEGVNT
                     SGSDFGPSYYNDNTIYFASDRSNIAKKNIHTWTNAPFLNLFKADKDSNQLTNLNNSSK
                     VNGNINSKYHESSTVFTKDGKTMYFTRNNYTDKKKKSDTNGTTKLKLYRAVLKDGRWS
                     NELELPFNSDEYSVAHPALSKDEKRLYFASDMKGTKGLSDLFFVEILGVNKYSEPQNL
                     GSNINTEGRETFPFISNNGDLFFASDGHIGLGGLDIFIAKATPSKKNFEEAYNVGKPI
                     NSKYDDFSFILNSSKKEGYFTSNREGGLGNDDIYAFEQVEELITTCDQYLKGIITDAE
                     TRALLPGSKVTLLTEDLKPITSTVADGNAFYELPIECDNKYVIRAEEPNYKPTEVDFA
                     SSSVFEFNHNQPIQLRKGAPIINNVAAKVGDDLAKLLQLNPIYFDFDKDFIRPDAALE
                     LQKVIAVMKEYPNLEIDVRSHTDSRAPFAYNIDLSTRRNKNTIKYIVEKGGMSTSRLT
                     GRGYGEIELTNECADGVNCSEEKHQLNRRSEFIIVKQ"
     gene            5445..5855
                     /locus_tag="KQA_RS0201065"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            6225..6998
                     /locus_tag="KQA_RS0201070"
     CDS             6225..6998
                     /locus_tag="KQA_RS0201070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008467574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177312.1"
                     /db_xref="GI:497863156"
                     /translation="MKTKLLYLFTFITTLSFSQTNLVPNGNVESWTNSTTLDNWITEN
                     NVSQNTTDSTEGNSSASLLIIGNSSVNPKIVTKVPLTSGITYTVSYKFKYTTSSFTGS
                     RSVCLKLVKDGSATTTTRCSTLNDNLWNFKEITFTPDQTGDYDLSISTSNFSGINTFE
                     VLIDDIKVFDPLNLSVDYFKNDDQNQNIYPTITNGKIYFDKIENVDELNISVFNCIGQ
                     KENFVVNNNTIDLSRLATGIYFISLKTDKLNTVKRILKK"
     gene            complement(7366..7740)
                     /locus_tag="KQA_RS0201075"
     CDS             complement(7366..7740)
                     /locus_tag="KQA_RS0201075"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_029209398.1"
                     /db_xref="GI:656263444"
                     /translation="MKEIYNSPTKNAAEATLNDFAQKWESKYSYAVKSWRDNWEKLTV
                     FYDFPVGIRKIIYTTNLIEDLNGKIRKYTKNKLSFPTDNAVMKSTFLALRESTKKWTI
                     PIRNWGIILDLFLTIFKERVQL"
     gene            complement(7737..8021)
                     /locus_tag="KQA_RS0201080"
     CDS             complement(7737..8021)
                     /locus_tag="KQA_RS0201080"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_029209399.1"
                     /db_xref="GI:656263445"
                     /translation="MYIAVDLLRDGKKDVLGLWLGKNESAAFWMNVLIDMKTRGVEDL
                     LITATGNLIGFTQTIRNILPESTTQICLVHQIRNAAKYIVCKDKRSSLLT"
     gene            10715..11866
                     /locus_tag="KQA_RS0201095"
     CDS             10715..11866
                     /locus_tag="KQA_RS0201095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017445420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-agarase"
                     /protein_id="WP_010177314.1"
                     /db_xref="GI:497863158"
                     /translation="MRNFLVLSICAIFSNVYSQWDTGWFPNPDNYVPKYNGKSWQRLG
                     WMSDGFNDGWLNETKWKRGYLNEWNDKGRTRWNSWPDYVKVSNTWGQGCAQIGHYWND
                     ASAGGWANTISCGIISSRNTVKYPVYLESRIRVANTELSSNFWLLDTGENRREIDVLE
                     CYGGNSWNGNRATSNFHFFTDSDRKDHFKRSDHWRGFPWRNNFHRFGVLWLNPWDVRF
                     FIDGKREGYNFYSINLKTKDGLQLNKDWWNYSTEMKIILDVEEHKGTAQDPIWKYKQG
                     LWNTDRKMLVDWIGVWKPNTGGKKLNTSSINTAELPKVYPNPVKQGQELVLSNIEKGQ
                     NFIFSSVDGKIISSFNIPHEDKLFLNTKDISPGLYILQVDTNVIKLIVK"
     gene            12366..15167
                     /locus_tag="KQA_RS0201100"
     CDS             12366..15167
                     /locus_tag="KQA_RS0201100"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-agarase"
                     /protein_id="WP_010177315.1"
                     /db_xref="GI:497863159"
                     /translation="MKNYLLFMLFSVQLLFAQSVKLPEGFTKDSSLSDDFNYGSDKKG
                     MSDKWDDFNSSGWKGPGPTEFRSENITFKDGKLIIKASHFEGGEKHFENGRTWTRQVH
                     TGYLVSKEDNPISPPVYFEASLKANAIGLASNFWAKRGNIDNSSEIDVVETYSDTDNG
                     SNNYHFFRDKKDYNDQRRPPVGNDVESNFNVYSCFWKSKTEVIFYVNGKQTRHIYPCA
                     PDPRDRLVDPAGRFFDENLRIILDCEVHTWRIKQKIANALPTKAALDKLTDDQQMQVD
                     YMHVYKPGSGYKVSDPCGSDSSDSTDSAADDKSFSSLSFNQSTEGANNNPLILSAPNT
                     VERNIKGYPLKASFSQDGYAIFHLKDRNNGWKSYGHVGKQVTSGKQYNFWLKTNEYIS
                     GNNLDLVWEIKVNNGAKGFAVKSTNVNNGGNNQDTFSNNSSPTIQNAPSSIVRNIKGY
                     NLQAYFPQGGYAIFHLKDKNNGWKSYGQVGKRVTSGSTHNFWLKTNQYISGNNLDLIW
                     EVKVDNGAKGFAVKSTSLNSGGGNQNTVSNNSNATIQNAPSSIVRNIKGYNLQAYFPQ
                     GGYAIFHLKDKNNSWKSYGQVGKRVTSGSTHNFWLKTNQYISGNNLDLIWEVKVDNGA
                     KGFAVKSTSVNSGGGNQNTVSNNNNPTIQNAPSSIVRNIKGYNLQAYFPQGGYAIFHL
                     KDKNNGWKSYGQVGKRVTSGSTHNFWLKTNEYISGNNLDLIWELKVDNGVKGFAVKST
                     GANSGGGNQNTVSNNSNPTIQNAPSSIDRNIKGYNLQAYFPQGGYAIFHLKDKNNGWK
                     SYGQVGKRVTSGSTHNFWLKTNEYISGNNLDLVWELKVDKGAKGFSVKSAYVNNGNKS
                     LIQKQSDDYIVKSNSIKFINYTNNSSFRVYNLLGELKDVDMIHSSDSVILDFSNMNHG
                     VYLVKTSKEKVIKFLNKRR"
     gene            15600..18077
                     /locus_tag="KQA_RS0201110"
     CDS             15600..18077
                     /locus_tag="KQA_RS0201110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004918568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_029209400.1"
                     /db_xref="GI:656263446"
                     /translation="MREMKKNYGLLIMLFFRVFTYGQVILNIPDVNFKNALLNNDPVI
                     DTNGDGEIQNGEAFVFGGPLFLDNKGIVDMTGIEAFNNVRIIRASSNQIETIDLSKHT
                     SLQELYLSNNKLRQLDLSKNSRLLRLEVASNNLVSLDLSSNANMRNVNVSSNTIKILD
                     FSNSPFMERFIANGNDLRFINAQNGSNTGLTDFVVSNNPNLSCIMIDNVVSFIVPLTW
                     EKDATASYSENCVAPIVNIPDAAFKGILLNHSPAIDTNSDGEIQISEAEAVSNINTSR
                     NGDIEDLTGIEYFVNLRTLDCRASALKTLDVSKNVNLTTLYCSSGEITSLNISKNTEL
                     EDLRCGDNFIKSLNISKNPKLEILLADKNDMETFFVSDIENTVLHTLHVQENKLRILN
                     EAKFPALVSFRCEQNLITSLDISNNPNIRTFYAFSNALTSLNLKNGANTLFSPLLTNN
                     PDLYCIKVDDVDYSNTNWNGLSNKDDQAVYNETCSTRGILIPDDNFKEALLNYIPVID
                     INQDGQIQSFEATAFTGTMNVVNKDIADLTGIEHFTNITNLFCNNNSLTALDVSQNTK
                     LTTLHCGFNDLSALDISKNTELIDLFFSFNKIKTINIASNTKLQTLIGFNAELETLVS
                     ARDNYPSLTRLFLANNKLSTLITSPFSNLQILTCQDNEISALDFSLNTKITEILVQNN
                     QLTSVDLKNGNNGIFKSLDSDFSGNSDLECIQVDDLDFSNNRWIGLKRDSGVQFSEDC
                     GANLSVNEFELTANTNIFPVPVIDRLTINSIYDIVAVEVLNLAGNTVLLSNENTESID
                     MQDLPSGLYLLKITYNEGVVYKKIIKN"
     gene            complement(19150..20850)
                     /locus_tag="KQA_RS0201115"
     CDS             complement(19150..20850)
                     /locus_tag="KQA_RS0201115"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177317.1"
                     /db_xref="GI:497863161"
                     /translation="MKYFHVLLGLFFSFLTAASAQTTDILTGLTKPRGIAINGDELYF
                     TELTANRILKIDLTQTNPSPVEVVTGLDTPKELVFNGNTLYVSEANRISRVDVTSSLP
                     ATRQDFFVGIEQPQGMLIHNNYLYTKGANNNVFKFNLDNPTIDVSLVFGANLIYDFVK
                     IGNDAYVTQENAIRKFDLTANTPSLGNVINSSQEPLLAGINVGMTAINNTIYFLQNPT
                     GRLLSFNINDPVGTFGQLLNISAVGDVTSYKGDLYISDFDNGKIIKYELPDTTPTTDI
                     AHYYSLDSQTVVDEIGNEDPTVVLSTVVSSGAINRSHAFDNADNITLFNFAPTSFTIN
                     FWFKTNDINKTQRIFHRGGYGGSAYDRYSYSLVYIPNQGFRLGLGSDAGSNAALIYAN
                     TSADLTDWHMITCTYDLSTQTARIYIDGNLEASDTSLQGIYANPNYQLFLEFSRYPLP
                     GSPQAIDGNLDEIGLWTRAISDTEVTTLYNETATLSIDDFDLTGARVELFPNPAKNFI
                     KVSNLNTSGQFKIYNLLGQPVKQGSIDNNQTIDISNLIKGLYLLKFKNDAKTLRFAKE
                     "
     gene            21262..21693
                     /locus_tag="KQA_RS0201120"
     CDS             21262..21693
                     /locus_tag="KQA_RS0201120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014937181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucine-rich repeat-containing protein"
                     /protein_id="WP_010177318.1"
                     /db_xref="GI:497863162"
                     /translation="MGDFTSHPNIDTDGDGEIQIAEAKAVEVLNLRNKGILDLRGIEY
                     FVNLKELYIEHNRLTSLDISKNKQLKELYAQGTLLTTLNIASNEKLEVADIRGGELEM
                     LEVDNCGNPHLRELILTDCFFTNLDKSKFPNLKIQFCNYID"
     gene            21847..23646
                     /locus_tag="KQA_RS0201125"
     CDS             21847..23646
                     /locus_tag="KQA_RS0201125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002681106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of chromosome condensation, RCC1"
                     /protein_id="WP_010177319.1"
                     /db_xref="GI:497863163"
                     /translation="MKNNYFLLITLFLSVTLFGQSVVNIPDVNFKNALINHSPTIDTN
                     SDGEIQLTEAEAFSGSLAVSNKNISDLTGIGAFINITRLGCSGNNLSTINISNNKKMQ
                     FLACLENHLKSLDITNNLDLKALWINSNEMETLDLSKNLALQELSCFKNNLSRLDVSK
                     NLDLQIFYCYENNLTTIDISKNVNLKVLWCSNNDIKSLDVSKNMYLRELSCSNINLTS
                     LDISKNLELDRLSCSNNKLTALDLSKHTKLERLNASNNQLTRLNLKNGVNTDFEHSFL
                     NFRNNPDLTCIQVDDANFSNTNWSSIKDDTADFSEACDYVIVFPDANFKTALLNHDPV
                     IDTNDDGEIQISEAESAITLNIARANINSLEGIAYFVNLEELFCAINNLDAIDISQNV
                     KLKKLYCASNNLRELDIAKNTVLEELSFGFNGVKSIALTSTKLKLITATNGILEELLV
                     LRGTTYPDLKEIYLTQNNLTQLFLPAFPNLEFLSCADNKLTSLDLSSNTKIKEVYAFN
                     NLLTEVNLKNGNNENIDVTRGLTSFALNIDLDCIEVDDVAYSNANWQGIKDSATQFSE
                     DCGAGLSITDFELASNTSVFPIPVIDDLTINSN"
     gene            24140..25162
                     /locus_tag="KQA_RS0201135"
     CDS             24140..25162
                     /locus_tag="KQA_RS0201135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014937181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177321.1"
                     /db_xref="GI:497863165"
                     /translation="MKKNYLIFFAHLLVLAIHGQGIVNIPDANFKDALLNHNPVIDTN
                     GDSEIQVSEAEAFLGRINIFAKNVSDLTGVEAFVNISGLNCGFNNLTEIDVSKNTEIT
                     FLSFGLNPIKQINISSNLKLEELLGNFSDLETLLMPNVINENLTDIFLNDTEISQLDT
                     TPFPNLNIISCINAKLNSLDVSNNTKLRQLLVQNNRLVSLNLKNGNNPFLLGFDRTAS
                     NFTNNPDLDCIQVDDADFSNTNWGTIKDSGAQFSEDCQGSLGIEELELASHTSVFPIP
                     VIDDLTINSKYNIVSCEVLNLIGKTVLVVNENTDSIDMGHFPTGVYLVKITYDEGVVF
                     KKVCKK"
     gene            complement(25229..25906)
                     /locus_tag="KQA_RS0201140"
     CDS             complement(25229..25906)
                     /locus_tag="KQA_RS0201140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018477012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_010177322.1"
                     /db_xref="GI:497863166"
                     /translation="MTKFKNAASTIAVLKEKISNQGTDSLEDFLGFYHENDINTIELL
                     YLEEKGCEIYGKTLEEIRALGPAFLAEIMHPEDIERCVNLLTEFAKKGSEEETLIYNQ
                     RLKMVGDEDYKTYFTCVKADFTKSVFQAVTTAMTQIDDFYLEVNTVLESSKYIEENVS
                     FYTSFSKREKEIIKWVCNGKNVNEIADILFLSHHTVIKHKKNIYKKAGFDSKIQLIEF
                     ALNFNLI"
     gene            complement(25903..26574)
                     /locus_tag="KQA_RS0201145"
     CDS             complement(25903..26574)
                     /locus_tag="KQA_RS0201145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006843874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator containing a CheY-like
                     receiver domain and an HTH DNA-binding domain"
                     /protein_id="WP_010177323.1"
                     /db_xref="GI:497863167"
                     /translation="MQNFSITEISRQILSGEKTIQEISDYLPCHIHTNSLDDFRILEA
                     DSTVLNHIDRTADELLQHGPELMIEMVNPDDLRNAIDANFKYLENLETQNHVAFFQRV
                     KFPKEKEEHCFYTRGRVLDDNRIINLSVPTHELKLFNHTVLDLFQNSSFIKRNLAVFD
                     SLTKKEVMLCQYFCQENSLKDIADSLHLSIHTIKNHKINIYKKLNVNNFYDFYYFCTK
                     FKIDK"
     gene            complement(27361..28458)
                     /locus_tag="KQA_RS0201150"
     CDS             complement(27361..28458)
                     /locus_tag="KQA_RS0201150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,2-oxophytodienoate reductase"
                     /protein_id="WP_010177324.1"
                     /db_xref="GI:497863168"
                     /translation="MKLLEKVQLGGVNLKNRMAMAAMTRGRVDRNGLVGDITVEYYTQ
                     RASAGLMLTESIRISKEATGSPLTPGIFTDKQIEAWKKVTTAVHEKGGVIIAQLWHTG
                     RMGHSVDRNGKLPLAPSPIPIWGMQHFTSQGKKEYEIPQEITIPEIKQTIKDFGQAAK
                     NAIAAGFDGVQLHAANGYLPSQFLAESANQRTDEYGGSIPNKCRFVLEVMQELISSVG
                     SEKVGIKISPFHPYGDIILDDPSATYSYLIKELNKLDFAYVEIQKRSTFFPSPKHYAT
                     DNEIELFGRMIRHTVIANAGYDKDSAEAELEKGIAKLISFGTLYIANPDLPERFEKNF
                     RLNKPDRATIFGGGKHGYIDYPFCNNTPPNK"
     gene            complement(28742..29734)
                     /locus_tag="KQA_RS0201155"
     CDS             complement(28742..29734)
                     /locus_tag="KQA_RS0201155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_010177325.1"
                     /db_xref="GI:497863169"
                     /translation="MKKLLEVLNKVGLDGFILMIGSMILLAYFLPQPGMIKEPVSLGQ
                     IANIGVSFIFLFYGLKLSIEKLKVGLSNWKMHIIVQLTTFLFFPLLVLAFRPFFVKTD
                     LELLWLGIFFLAALPSTVSSSVVMISIAKGNVPAAIFNASISSLIGVVATPLWIGLFI
                     ASATGSFDVSDIVLKLVLQVLLPVIIGISLNSRFGNIAKKYKKQLKYFDQAIILTIIY
                     TSFCKSFSEHLFASFSALELAGLAVGMMALFFTVFFCVGLLSKWFGFSNEDRITVLFC
                     GSKKSLVHGTVMSKVLFQHSTITGIVLLPLMLYHALQLIAASVIAQRMARRKEV"
     gene            complement(29794..30822)
                     /locus_tag="KQA_RS0201160"
     CDS             complement(29794..30822)
                     /locus_tag="KQA_RS0201160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016197922.1"
                     /note="catalyzes the formation of
                     tetrahydropteroyl-L-glutamate and methionine from
                     L-homocysteine and
                     5-methyltetrahydropteroyltri-L-glutamate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase"
                     /protein_id="WP_010177326.1"
                     /db_xref="GI:497863170"
                     /translation="MKKILPTSIVGSLPKPAWLAPPKKLWSPWNLEEDQLLEGKQDAL
                     RIALQEQQLAGVDIISDGEQTRQHFVTTFIEHLSGVDFKNRKTVKIRDRYNASVPVVV
                     DEVTRQKAVFVDDAKFLRKQTDKPIKWALPGPMTMVDTLYDGHYKSREKLAWEFAKAL
                     NEEARELQDAGVDIIQFDEPAFNVFFEEVNDWGIATLERAIEGLHCETAVHICYGYGI
                     KANNDWKKTLGSEWRQYEEIFPKIQSSNIDIVSLECHGSRVPFNLIELVRGKKVMVGA
                     IDVATNTIETPEEVADTLRKALDFVNIENLYPCTNCGMAPLSRNVARGKLSALSAGAE
                     IIRKELGI"
     gene            complement(30852..31856)
                     /locus_tag="KQA_RS0201165"
     CDS             complement(30852..31856)
                     /locus_tag="KQA_RS0201165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177327.1"
                     /db_xref="GI:497863171"
                     /translation="MKNTQNTIKTDFSFTLMSRRLDENYHPESNTRLTTNFANLARGV
                     DRQQNLRNALNMINNRFNALAHLDNPKGDRYHVELEIMTVTLNIDHKKSIDNLPMMEV
                     LKTNILDRKTNQYVEGVAGNNFSSYVRDYDFSILLIEYNKDKPKFTVPEKFGDLHGKL
                     YQSFVRSETYKEHFKQSPIICLSVSGNKIYTRTEFQHPVLGFEYLQNEYSLTDQYFSK
                     MGMKVRFFMPANSVAPMAFYHTGDLLKEYTDLGLISSISTMETFQKIYRPEIYNANSV
                     AGKIFQPSLKHEDYSLTRVEYDRVERSQLAIEQGKYCEEYFIKPYQYILEQWAADFDL
                     "
     gene            complement(32981..34828)
                     /locus_tag="KQA_RS0201175"
     CDS             complement(32981..34828)
                     /locus_tag="KQA_RS0201175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008677313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_029209401.1"
                     /db_xref="GI:656263447"
                     /translation="MITPFFGQIDNENRFYRETFNNGVSKNVITDYGATVNDNTDDSP
                     AVRRAINDVSKQPNGGKIYFPAGEYRIKFVHLESNVHLVFSPNAVIKLPENDNPWGAI
                     FWVGSRNAVENVSIRGDGGKFTVNMDGANTDEICIFVKVENVKNFKFENARVIENLTE
                     QSAFVLGRGFNNQAPEGGIIKNIDVLNASYGYGCVQAGKADRVLFKNLSSEGGIALRL
                     EPANFETVGATDIVGRNIIGTNGNAAVMLSPHSAVGGTVNINGVTSNSCSFGVRVERG
                     FGDRGIGSFANNSRITGIQVNYGTTAQIRPNHRVFVPCPLKSLTSSRPGPDGYSYIGP
                     AIAPVIYDSNSFGVFFGTIGYNGFSNQPKLPIVGINDKFPDANCNNNGGGGNNGNNGN
                     TFVLTKRNASGFSIDGGNGGANQQNVYLWNRSTSNVNQQWEEINRGNGFFSYRKKNTN
                     FCLDGGTGGANGQTVKLFTCGTNNQNQHWRKVNINGRFRLEKRNAPGFSIDGGNGGAR
                     QQNVYLWASSNTNQNQQWSFDAVSGAKSLDDKSPETILYPNPAQHTVSVSNIEEFHTV
                     TIFNIEGAKVLSTPLNNNNLDVSLLANGVYLLELTGDTFKRVERIVINK"
     gene            complement(35176..35871)
                     /locus_tag="KQA_RS0201180"
     CDS             complement(35176..35871)
                     /locus_tag="KQA_RS0201180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_029209402.1"
                     /db_xref="GI:656263448"
                     /translation="MLAGHFTTALIAKQKFPKGSLLYFLIIVQLQDFLWFIFHYLGLE
                     PTTPSDAFDATLTNMAVDMLYSHDLLPQLVWFIIVFAIGKFLFKSTQIGLVSILLVAV
                     HFILDFFSGHMHHLFGADTMEAGLGLYASSPYLAIFIEAIFSTGALWYFFTEETKKGI
                     IRTRKNKLAIIAVFGYGIIFMLLIATRSFREILGIPEFDLGFNTNMPTLIFTYGVMLY
                     CLNYFVPKFKTIE"
     assembly_gap    37366..37433
                     /estimated_length=68
                     /gap_type="within scaffold"
                     /linkage_evidence="unspecified"
     gene            37791..38522
                     /locus_tag="KQA_RS0201195"
     CDS             37791..38522
                     /locus_tag="KQA_RS0201195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrilase"
                     /protein_id="WP_010177333.1"
                     /db_xref="GI:497863177"
                     /translation="MKICIAQTEPIKGDILKNIENHKKLIMLSVKKGADLIVFSELSL
                     TGYEPELAQKLATTKDDQRFNEFQEISDVHKITIVIGLPTKNDQGTCISLILFQPNKP
                     RMTYSKAYLHPGEEKYFITGENLAPIPIGNHKVAFAICYETSITEHIEKAFNNKADVY
                     VASVLNTVSGVDKDIHRISEIAKKYTMLALMSNLVGESGGYDCAGKSSVWNKEGKLIG
                     QLDDTNQGIIVFDTATHQVMKVKDE"
     gene            complement(38595..40367)
                     /locus_tag="KQA_RS0201200"
     CDS             complement(38595..40367)
                     /locus_tag="KQA_RS0201200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-porphyranase"
                     /protein_id="WP_010177334.1"
                     /db_xref="GI:497863178"
                     /translation="MKLKSLLLFAFAMYLSSAIYAQRNDRGLNFGNTPLPNNLQSFAS
                     WDLITGLSDDFNHNNKNSAKFQDVWAQSYLPDPGFRGPGSTVWQGGNLVEVRNGRMEV
                     RARPGSGGLVNCGIVSSKRTIRYPVYMEARIKVSNIRNSSNFWMLNKCDNEEIDVLEC
                     YGGDPDEFYSKQMSTNFHLWHRRGGQSHAGAQTATNCGGQDLTDFTYQTFFTTSNNDF
                     WRNAFHTFGVYWASPTELEFYIDGQPRFDGQHFVPGRAARNLTGKFSDARLQCPNAAV
                     LNCTTEALLRNVQGQSGGGVPYPNRQFNDPTHIIIDTEAHAGRPVESVANLNNNNRNV
                     MLVDWVRVYRPNINGGGGGSTPPPPPPTANNDGAPIGSIISLRKSGGDRRFVSAVTEL
                     NNDLYANKTSVESNRQRFRVDRHRSGVVALYSLSARKYIQTNNSNQNVIVRARGNSDL
                     SWERFEWRNVGNNKVALRSLQVNKWVQAAWNQNNAALFPRGNAPLGWETFDWRRESGG
                     KILSSTEATETVAYPNPVLGGNDVFLEGINQGDTIIVRNSTGSALVNMVATDTTEVIP
                     TSNLASGIYFIQVNTGTSLKLIID"
     gene            complement(40752..44111)
                     /gene="secA"
                     /locus_tag="KQA_RS0201205"
                     /gene_synonym="azi; div"
     CDS             complement(40752..44111)
                     /gene="secA"
                     /locus_tag="KQA_RS0201205"
                     /gene_synonym="azi; div"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177335.1"
                     /note="functions in protein export; can interact with
                     acidic membrane phospholipids and the SecYEG protein
                     complex; binds to preproteins; binds to ATP and undergoes
                     a conformational change to promote membrane insertion of
                     SecA/bound preprotein; ATP hydrolysis appears to drive
                     release of the preprotein from SecA and deinsertion of
                     SecA from the membrane; additional proteins SecD/F/YajC
                     aid SecA recycling; exists in an equilibrium between
                     monomers and dimers; may possibly form higher order
                     oligomers; in some organisms, there are paralogous
                     proteins that have been found to be nonessential but do
                     function in secretion of a subset of exported proteins;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="WP_010177335.1"
                     /db_xref="GI:497863179"
                     /translation="MGILDSVLKVFVGDKSKKDVKAIQPILDKIKKAEATLVNITNDE
                     LRAKTTAFKQIIIDAKADIVAQIDDLKVKANNTADIDAREDIYTEIDSLETKALEITD
                     KKLSEILPDAFAVVKETARRFTNNETVEVTASEYDRELSATKEYVTINDTNANWATSW
                     NAAGTLVTWNMIHYDVQLIGGVALHNGNIAEMHTGEGKTLVATLPVYLNALTGNGVHL
                     VTVNDYLARRDSEWMAPLFQFHGLTIDCIDNHRPNSEARRNAYNSDIVYGTNNEFGFD
                     YLRDNMSHAPEDLVQRKHNYAIVDEVDSVLIDDARTPLIISGPVPKGDIHEYDMLKPG
                     IASIVSLQQKFLTGVLAEAKKLIKEGNTKDGGFKLLQAYRGIPKNKALIKYLSEEGVK
                     QLLQKTENQYMQDNNRDMHLIDVDLYYVIEEKNNQIDLTDKGIAHISKEEDSDFFILP
                     EIAVEISKIEKLGLNAEEEAAKKEELFREYSVKSERIHTITQLLKAYSLFEKDVEYVV
                     MDNKVKIVDEQTGRIMDGRRFSDGLHQALEAKENVKIEDATQTLATVTLQNYFRMYHK
                     LSGMTGTAVTEAGEFWEIYKLDVIEIPTNKPIARDDRQDLIYKTKREKYNAVIEDVVK
                     IAQAGRPVLIGTTSVEISELLSRMLNMRKVKHNVLNAKLHQKEADIVAEAGNPGVVTI
                     ATNMAGRGTDIKLSKEVLDAGGLAIIGTERHDSRRVDRQLRGRAGRQGDVGSSQFYVS
                     LEDNLMRLFGSERIAKLMDKMNIEEGEVLQAKMLSNSIERAQKKVEENNFGTRKHLLE
                     YDDVMNAQREVVYKRRRHALYGERLKVDIANMLYELSESIAQGNNISQDYKNFEFELI
                     RYFAMPSPVTEQEFNSLNAEKLTGKVYHAALKHYQSKMEHTSAEVYRVIKQIYEDPNN
                     QFERIGVPFSDGIKSLNVGTNLEKAYNSEGKQIISDFEKNITLALIDDAWKTHLRKMD
                     ELKQSVRLAVHEQKDPLLIYKFEAFELFKSMLQGLNKEVISFLFKAELPSANPDDVQA
                     AEQHQQQEMQTQKEEIQNLEERTNQNRAIADAQHQQQQAPVETIVREEPKIGRNDKIV
                     IKNLMNGETKTLKFKQAIPLLEKGWVVVQKA"
     gene            complement(44280..44501)
                     /locus_tag="KQA_RS0201210"
     CDS             complement(44280..44501)
                     /locus_tag="KQA_RS0201210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003441576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177336.1"
                     /db_xref="GI:497863180"
                     /translation="MYWTLELASYLSDAPWPATKDELIDYAIRTGAPLEVVENLQAIE
                     DEGDSYDSIEEIWSDYPTDEDYLWNEDEY"
     gene            complement(44602..45171)
                     /locus_tag="KQA_RS0201215"
     CDS             complement(44602..45171)
                     /locus_tag="KQA_RS0201215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin adenosyltransferase"
                     /protein_id="WP_010177337.1"
                     /db_xref="GI:497863181"
                     /translation="MKIYTKTGDEGFTSLYGGKRVPKSNDRIDAYGTIDELNSFIGLL
                     RDQEISITHKNFLTQIQIELFSIGSILATPHNNQKKKLNIQKISIEEIEALENEIDHL
                     DTSLNPMTHFILPGGHVTVSYCHVARSICRRAERLAYALHHHEPLEKEVLIYLNRLSD
                     YLFVLARKLSKELTVEEIKWIPKKTNKEV"
     gene            complement(45954..47831)
                     /locus_tag="KQA_RS0201225"
     CDS             complement(45954..47831)
                     /locus_tag="KQA_RS0201225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_029209403.1"
                     /db_xref="GI:656263449"
                     /translation="MNFVSVENVSKAFGERVLFENISFGINEGQKIGFVAKNGTGKSS
                     LLNIITKSAPSDTGQVVYRKGLKVAFLPQEPNLDPQLSIEETIFTGDNESLQAIEAYE
                     KAVLNPEDADAFQAAFDRMDQAQAWDFETEYKQILSKLKLDNLSLKVASLSGGQKKRL
                     ALTNVLLSKPELVFLDEPTNHLDLEMIEWLEEYFAKEKITLFMITHDRYFLENVCNEI
                     VELDHGKLYNYRGNYAYYLEKKEQRLTAEATELSKAKHLFKKELDWMRRQPKARTTKS
                     KSRIDDFFEIKKKAHQRRADHQVTLEINMERMGSKIIEFHKVSKSYGDLVITNKFDYV
                     FQRGERIGIIGKNGTGKSSFLNLLTGIELPDSGKVITGETIKIGYYTQKGIKVKEGQK
                     VIDVIREFGDYIPLKKGRQISAGQLLEQFLFDRKKQHDFVEKLSGGERKRLYLCTVLI
                     QNPNFLILDEPTNDLDIVTLNVLESFLLDFPGCLAVVSHDRYFMDKIVDHLFVFEGKG
                     VIEDFPGNYSDYRAYENSPKTKKEPEATITPEVKQHKNSWKKEQKNTSLSFNEQKEYN
                     KIERELKKLELQKKEIEQQFATENFEGDALIEKSKELGKITNAIEEKEMRWMELAEKM
                     G"
     gene            complement(48109..49209)
                     /locus_tag="KQA_RS0201230"
     CDS             complement(48109..49209)
                     /locus_tag="KQA_RS0201230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_029209404.1"
                     /db_xref="GI:656263450"
                     /translation="MRNIFFFMLLTGTIISVKSQTRKYSNEFLNIGVDAAAFGKSNAV
                     VASTNDVNSGYWNPAGLINIKDKQLALMHASYFANIANYDYAAFATPIDDKSAIGVSV
                     IRFGVDDILDTRALITSGGDITPIEELPRFSTADYAFTLSYSRKPFNKNFSYGVNAKV
                     IRRVIGDFATAWGFGLDAGLLLTSKNKAWKFGIMVRDLTTTYNSWQIEDGIFDNDLGD
                     DPRGNGSINALNNQEAPETTEITLPSVRMGLNKTFTINRDIFIDFEADGNFRFAQTND
                     VISNASFSISPAFGFEANFRKLIFLRGGVGNFQKVKQFDNTNELGFQPNFGVGFHYKG
                     VSVDYALTDIGDQSVSLYSNVFSLRIDWSLFR"
     gene            49319..50065
                     /locus_tag="KQA_RS0201235"
     CDS             49319..50065
                     /locus_tag="KQA_RS0201235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine synthase"
                     /protein_id="WP_010177341.1"
                     /db_xref="GI:497863185"
                     /translation="MSLKKQIPNIITLLNLFSGCIAVYFACMNQLFLAAVFTALGIFF
                     DFFDGFFARLFNANSELGLQLDSLADMVTSGVVPGVFMFQLLLESSAINDSFPIENIG
                     GNVIEWVPFLGFFVTLASCYRLANFNIDTRQTSSFIGLPTPANTLLIISIGLVSMYQS
                     SGIIEVLMDNVWVLLSIVALSCYLLNAEVRLFALKFKNWNIKDNWVRYLLIISSLVLI
                     LLFKYLGITLTILLYVLLSLIFSGEETNGV"
     gene            50150..50222
                     /locus_tag="KQA_RS0201240"
     tRNA            50150..50222
                     /locus_tag="KQA_RS0201240"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:50183..50185,aa:Gln,seq:ttg)
     gene            50318..50833
                     /locus_tag="KQA_RS0201245"
     CDS             50318..50833
                     /locus_tag="KQA_RS0201245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177342.1"
                     /db_xref="GI:497863186"
                     /translation="MSNTIVYEDRSKRFDENMIKGRIAETIVEQMFIRMGYDIYRYGM
                     ENTVPGIIQDLYNCKPKEVSDEIRKMPDFIIKNPNDNSVYYVEVKFRADGKFLLKELG
                     KNYPYKNAYILVVSKKHIRCVLYSELEESGELLMKKEYLLGYREDFKTNREIILYFCE
                     LAKKYFSCLES"
     gene            complement(52362..53474)
                     /locus_tag="KQA_RS0201255"
     CDS             complement(52362..53474)
                     /locus_tag="KQA_RS0201255"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177344.1"
                     /db_xref="GI:497863188"
                     /translation="MNLLFKQFNILIKYHFNTLLIATLSIFLLACEDESTIIDSFPFQ
                     ISVTGTNEALLSETIQNELIILPENLVDSTVFSFSYNADDKGHYKIDGTKIQENTIYD
                     LSIKSLDYTLEFVPTEEGEIEIEIFVDDNKKHSATAKVIYSVTKELTDFKFSFTPLKE
                     EVLFGERTSLNLNIEQTSDELLTYTMNISSNSNGEINWIGYSNLPETISNLSKGNYVF
                     DYIPTEVIEKNNFTVTIVASNGVTKTKTFDGLTAEPVEFDFSLSKTVITINSGSINDF
                     INVTLNRPSFATGYFYDLDYYLRISTTTENILFNNGKIVFGENILLDNFSGIQNETFS
                     YSLNYSGNVVPGEVIFTVFNNTGFEVSKTVTVKTDF"
     gene            complement(53493..54197)
                     /locus_tag="KQA_RS0201260"
     CDS             complement(53493..54197)
                     /locus_tag="KQA_RS0201260"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177346.1"
                     /db_xref="GI:497863190"
                     /translation="MKKLFFSIAVIAMAQGAFAQNETELQKQSEETLHFQLNRLQMQN
                     KQIENELKLLQKSYSTRSFRLMKKEKSRKTTYASFETIIGITDNEGLGYQANFSIEID
                     TDKNKGLEMGLYYDNNDLLAKELEIPSEVFILNLGYTKQLSFLSNKTSTITTRFTIGG
                     AVGAELLNDGKDKLSNGAILETEDGLIYGGYTGIFSLFKINNNLSAVFRNSNFFTTSD
                     VSLHKFIIGAGIRYHF"
     gene            complement(54214..55617)
                     /locus_tag="KQA_RS0201265"
     CDS             complement(54214..55617)
                     /locus_tag="KQA_RS0201265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008611951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TraG family mobilization protein"
                     /protein_id="WP_010177348.1"
                     /db_xref="GI:497863192"
                     /translation="MKLDFLKPKTPPFYLKSGRFSKHYRINNLNRGAIAVGGAGSGKT
                     YSYINPLLSYCVKHKGCITFDPKGELTPLINGIAKQNEKPIINFSLDNNFNTINVLSL
                     CEDKSDIIEFSSYFLSGIVGIPKNDAAKYFFNSAKSILTGTILFLRKKHPKFCSIPHI
                     IALFLTANPEQIIKLIFSDEEAKRSAQVLSSVSGDKKLLGSMMSTFTAFFASLDVPRI
                     FRNLLSDTDLPLPNDPNNPSIINLIFNLQKRDIYSPIYSSIIGLILKKMNIPDQHESA
                     VIIDEFTVLSIPNFSNIPETARSNKIATCIAIQDFSQLVLKYGKEEASSIIANMGSQF
                     LFRTTSPETLDHFQKTLGKREVEKTSISEKQGGLSLDGPTHSYSSIERDILRREKVIN
                     YKAGMCTAIIAEGNERLIEGKRLNGNHYLKKIKPIPIQPQKNIDEQRAYEKVYSDINF
                     LLKKSTTTPTLTKKFNL"
     gene            complement(55614..56273)
                     /locus_tag="KQA_RS0201270"
     CDS             complement(55614..56273)
                     /locus_tag="KQA_RS0201270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000024818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177350.1"
                     /db_xref="GI:497863194"
                     /translation="MSYAILRLNKIKSLSGSLGNHIDRCTSDGELCYPSNIQDRAILN
                     NIHWDKNGQSYTQKEWANYCKKTPFQDRIQNEIKSRYKIQKNIRKDAVKAIDYIMTSD
                     NAKMAEIFSDENLVQSWMKDNKTFLSETYGEENVLSMHLHLDETTPHLHAVIVPITND
                     GRLSAKEFINGRKSLAEQQTRYAELMEKYGMQRGEAGSKTKHEQLWKKDKPQHTQIYE
                     R"
     gene            complement(56378..56950)
                     /locus_tag="KQA_RS0201275"
     CDS             complement(56378..56950)
                     /locus_tag="KQA_RS0201275"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177352.1"
                     /db_xref="GI:497863196"
                     /translation="MIVDFKKSETQLKKQNMIPSRMKLQLLQLLVRNVMILFFPIAII
                     SGLFFLFAESLTTESLQCLKETNLRGKKAFYFLLRNLDFNLKNLSISLCNIVLFSFLK
                     FQKKYNWKDAFYKTSLLGVLQLIIYSCYSIAMSNKKQGIVLGEHDLLRIYFETDKIFY
                     AWYIPLGWIAIYYFILYTKKGGQIIHNRYF"
     gene            complement(58236..58538)
                     /locus_tag="KQA_RS0201290"
     CDS             complement(58236..58538)
                     /locus_tag="KQA_RS0201290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177358.1"
                     /db_xref="GI:497863202"
                     /translation="MSNPILYGFSKKDLEHTIELVVNRLRKTELIDESSANPEEDRLT
                     QTEAADLLGVSVQCLIKWKKKELIPYYKIGRTVFYSKKELLTQARKNSKLVKASRK"
     gene            complement(58677..59789)
                     /locus_tag="KQA_RS0201295"
     CDS             complement(58677..59789)
                     /locus_tag="KQA_RS0201295"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177359.1"
                     /db_xref="GI:497863203"
                     /translation="MYNIEYIKKMVTSLEWLDTNSEKETPEFYLVKGMIANLPFLDRI
                     KLLGSILGMPEDNDLLSLPFTPGHFNLFFDLEYCRIHPHTNELLIYDKLMLDEANYNY
                     SQGDDSALEAFNWLHQPENIDHLEINNYHVRIQQKIVSKIYLTGNNFNNGETDPDSIL
                     EILYGITTGLQYRKFLLKKYKEPIVNHSSKYMHPTIANDFLTLENKKITNKSLLDLTE
                     STIWELLTQLQSNEDLKSNQDYLTQIINIDTSTISKQNLSKFIKRFFEEYCTLLPINS
                     NDFFDFLFVKQSFNHERLDLNRDQLEKIMEMFLFLSEKNALKKSKKIQIIRNLHSYFN
                     TKLSIPMLKKIYNKSTTHPKKNTLLNYSMSWKELSI"
     gene            complement(59792..61027)
                     /locus_tag="KQA_RS0201300"
     CDS             complement(59792..61027)
                     /locus_tag="KQA_RS0201300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_010177360.1"
                     /db_xref="GI:497863204"
                     /translation="MQVSFTLRKDKINKDGFIPVRMIITLNGERIRRNVKSVRTKQKD
                     WKNQRVKANLKNEDYNFHIEFNKELDELENKLKLIHRHALLNNIPLTKEYVIDKLEND
                     SINSNSIAPSFFESFQEFIDTNKSTKANGTIKKYISCKNFIKDFDVAKKYNLRFDNVD
                     VNFYEDFRDYAFEERNTLNNYYGRIISVLKTFMNWSYERKYHENLEFKKFKTVSNTIE
                     VIYLTMDELMKLYNYEFESKRLEHVKDFYCLGCFSGLRFSDIKQLKPSNIYEDYLKLN
                     VQKTKTIDHKIPLNAFSKAILNKYKDTLYEPIPKISGQKFNQYIKECCKIVGIDTPVN
                     TTRYIGQKRVDKVFPKHQLITSHTARKTFVTNSLILGMKEMVVRNITGHKDESSFKRY
                     VEIADDFKKNEMDNTWNKI"
     gene            complement(61082..61381)
                     /locus_tag="KQA_RS0201305"
     CDS             complement(61082..61381)
                     /locus_tag="KQA_RS0201305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="WP_010177361.1"
                     /db_xref="GI:497863205"
                     /translation="MEKQMNVHPGEMLREDFLKPMGITAYKLAKSIGVSDSRVGKIVR
                     EEMGISGEMALRLSKFFGNSPEFWSNLQSFYEIRKAQIEKEDDINKIQPYTKQAV"
     gene            complement(61394..61675)
                     /locus_tag="KQA_RS0201310"
     CDS             complement(61394..61675)
                     /locus_tag="KQA_RS0201310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid maintenance system killer protein"
                     /protein_id="WP_010177362.1"
                     /db_xref="GI:497863206"
                     /translation="MIKSFGDKETEKLFAGHSSKKIDASIQKKAFRKLVQIHSSKDLN
                     DLTIPPGNRLHQLQGNLKEYHSISINMQWRIIFKWNNHNAYDVEIIDYH"
     gene            complement(62063..62890)
                     /locus_tag="KQA_RS0201315"
     CDS             complement(62063..62890)
                     /locus_tag="KQA_RS0201315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_010177363.1"
                     /db_xref="GI:497863207"
                     /translation="MKNILVPTDFSSDAYNALSVAAQLARKNDSTIHLLHLLELPSHI
                     NDPILGSNGNFPEAILFMKNIHSKFKELIDSPLLEGLKTHEDVNTQPIPQGIIKSCND
                     NEIDFIVVGSHGKEAFSDLFVGSNTEKIVRTANTPVLVVKEPTNIKNVKNIVFACNFK
                     DEEVRSLNALHEFSEEVNAKIHLLYINTPRNFKTTHAIEEEMKAFLSKTPFKKDNLHI
                     YNDTTIERGVLNFSNDINANLICVDVHERKGLSHFINGSISEDLINHTQIPILTYKL"
     gene            63049..63513
                     /locus_tag="KQA_RS0201320"
     CDS             63049..63513
                     /locus_tag="KQA_RS0201320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177364.1"
                     /note="in Streptococcus pneumoniae this gene was found to
                     be essential; structure determination of the Streptococcus
                     protein shows that it is similar to a number of other
                     proteins; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177364.1"
                     /db_xref="GI:497863208"
                     /translation="MFKQKVESLLEEALVERSNLFLISFQITGANIIQVILDGDEGVS
                     VDDCIEISRAIEHNLDREEEDFSLQVMSAGITEGLVHIRQYPKNIGRTLNVVTEKEEI
                     EGELIATTADDFTLQWKAREPKPVGKGKVTVQKTKVIPYGEVKKAHVVVKFN"
     gene            63522..64754
                     /locus_tag="KQA_RS0201325"
     CDS             63522..64754
                     /locus_tag="KQA_RS0201325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010523244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor NusA"
                     /protein_id="WP_010177365.1"
                     /db_xref="GI:497863209"
                     /translation="MENIALIDSFSEFKDDKSIDRVTLMSILEETFRSALKKKYGSDD
                     NFDIIVNPDKGDLEIWRNRIVVDDGEVEDENQEISISEARKIEPDFEVGEDVSEEVKL
                     IDLGRRSILALRQNLIAKIHEHDNTNLYKQFKELEGEMYTAEVHHIRHRAVILLDDDG
                     NEVILPKEKQIPSDFFRKGENVRGVIEKVELKGNKPSIIMSRTAPSFLEKLFESEIPE
                     VFDGLITIKNVVRAPGEKAKVAVDTYDDRIDPVGACVGVKGSRIHGIVRELGNENIDV
                     INYTNNVQLYITRALSPAKVTSVKINEETKRAEVMLKPEEVSRAIGRGGHNIRLAGML
                     TGYEIDVFREGVEEDVELTEFSDEIDAWIIEEFSKIGLDTAKSVLEQDVADLVKRTDL
                     EEETVNEVMRILKSEFDD"
     gene            64811..67666
                     /locus_tag="KQA_RS0201330"
     CDS             64811..67666
                     /locus_tag="KQA_RS0201330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="WP_010177366.1"
                     /db_xref="GI:497863210"
                     /translation="MAGVNNMRLNKVLREFNISLDRAVDFLSAKGHEIDARPTTKISA
                     EIYQLLTDEFQGDKSKKVASKEKGEEKRKEKEAIRIQIETEQEEKRKKAQSNEVVKAK
                     AKLDGPKQVGKIELNKPNQEAAPKTSSKPEPVTETEKEAPVKKEVPVKKEVATPKKEV
                     EKAPEEPQVVSNRPKKQGIKITGQAPIAKPVKPKVAKVDEEKAKAAPAAKQAAASPAA
                     TSGPKHAEVGDAPSEKVKTQYKKLDGPNFTGQKIDLSQFKKPEKKKDDKSSSNDANKR
                     KRKRISKGPNQGQGGGRGGNNRGGGKFQPRGKRAPIVKAEPTEEEVQKQVRETLEKLQ
                     GKSGKGKGAKYRRDKRDQHRQKTEEDQAAQAAESKVIKVTEFVTASEVATMMDVSVTQ
                     IISACMSLGMMVTMNQRLDAETLTIVADEFGYTVDFVTADIEQAIEEVVDAPEDLLER
                     APIVTVMGHVDHGKTSLLDYIRKENVIAGESGGITQHIGAYGVQLDSGQKIAFLDTPG
                     HEAFTAMRARGAQVTDIAIIVIAADDDIMPQTKEAISHAQAAGVPIIFAINKVDKETA
                     NPDNIKTKLAAMNLLVEEWGGKIQSHDISAKTGLGVKELLEKVLLEAELLELKANPNR
                     IATGTVVEAFLDKGRGYVSTVLVQSGTLKVGDYLLAGKNSGKVKAMQDERGNRVLEAG
                     PSTPVSVLGLDGAPQAGDKFNVMDDEREAKDIASKRAQLHREQSVRTQRHITLDEIGR
                     RIALGDFKELNIILKGDVDGSVEALTDSFQKLSTDEIHVNIIHKAVGAITESDVLLAS
                     ASDAIIIGFNVRPAGNARMVADKEEIDIRMYSIIYDAINDLKDAMEGMLSPEMKEEIT
                     GTAEIRQTFKISKVGTIAGCMVLTGKIFRNNQIRLIRESVVIYTGELAALKRFKDDVK
                     EVAKGYDCGMQVKNYNDIKEGDIIEAFQEVAVKKKLK"
     gene            68080..68574
                     /locus_tag="KQA_RS0201335"
     CDS             68080..68574
                     /locus_tag="KQA_RS0201335"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177367.1"
                     /db_xref="GI:497863211"
                     /translation="MKKINLLPLVLLALLLSNCSNDDDNSNSKEMDFSGDWIGTKFLV
                     NEAYDFNNDGIPSRDYKIELPCLIQNITLNPDGTGLFKANIHGQAEGQTTPFPLTCVE
                     YEENPMTWSLNEEETKILLRFSETVVEEFPIVSEVVIERFSESLLDDTIGIPGKVVYE
                     KQTK"
     gene            complement(68682..69083)
                     /locus_tag="KQA_RS0201340"
     CDS             complement(68682..69083)
                     /locus_tag="KQA_RS0201340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sporulation protein"
                     /protein_id="WP_010177368.1"
                     /db_xref="GI:497863212"
                     /translation="MKDRFNFFSFLFLLLSIASQAQNSSDNANSETNSPATININVDP
                     NIEKLVKTKFSENNKDNYKIQLYYGNLNKAHAVLSNFNTKFTDWPGKIEYETPNYKVW
                     VGNFQTRLEADRALMKISKNFPHAFIFKPEK"
     gene            69304..70596
                     /locus_tag="KQA_RS0201345"
     CDS             69304..70596
                     /locus_tag="KQA_RS0201345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_010177369.1"
                     /db_xref="GI:497863213"
                     /translation="MRQVKHRNSVSKLLLLGLAFLLTFSTTTTAFAQADAGKGKELFN
                     SLCAACHKRYKKATGPALFGVTERHSTEWLYKWIKNSTALIASGDAEAIEIYEQYNKT
                     PMNSFPQLSNADIDNILAYVMEPKAAPAPGAVPVGGAQKATDDSGSGSVNSWVLGLLA
                     VVLLVLVGVLFMVNKTLRQFAKANNIDLPVKEERKPIWKAFIENQFLLLVSAVFLLLL
                     SGYFVYGYLMQVGVDQGYEPVQPIHYSHRIHAGDNKIDCKYCHSSARVSKHSGIPSLN
                     VCMNCHKSIGEVAEATQAEGLAEYGVDYNKQIQKLYKAVGWDADKQAYTGKTEPVKWV
                     RIHNLPDFAYFNHSQHVMVAGVACQKCHGPVEEMEIMYQHAPLTMGWCINCHRETNVK
                     VEGNAYYEKIHEELSKKYGVDKLTAAQMGGLECGKCHY"
     gene            70695..73790
                     /locus_tag="KQA_RS0201350"
     CDS             70695..73790
                     /locus_tag="KQA_RS0201350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinol:cytochrome C oxidoreductase"
                     /protein_id="WP_010177371.1"
                     /db_xref="GI:497863215"
                     /translation="MSSNKKYWKSVEELSDSSMVEALKQNEFSEDIPVEEFLGDKEML
                     DESSTSRRDFLKYVGFSTAAATLAACEGPVVKAIPYVVQPEQIVPGVANYYATTIADG
                     FDFANVLVKTREGRPIKIESNRLAGANGAANARVHASVLSMYDNTRLKTPQIGGKSTD
                     WAKFDKQLASKLSGVSGKIVLLTQTFASPSTDKLIGEFASKYPNVSHVIYDSVSNSEA
                     LAAYEQVYGVRGLADYDFEKASTIVSVGADFVGDWQGGGYDAGYAKGRVPQHGKMSRH
                     VQFEANMTLSGANADKRIPTTPSQQKQVLAALYGYVMGYAVNASLPAPINEAAKKAAQ
                     QLKAAGSKAVVVTGIQDKDAQVIALAINNKLGSKVFNAERPKLTSQGDAAKVNALVAD
                     MNAGKIGALLIAGVNPVYSLPNSKEFVSGLKKVGVTVSFASSNDETAALCEFVATTPH
                     YLESWGDVEINKGVYSLVQPTIRPLFKTRQFQDTLLQLIGSGLTYDAYMKNVWKSSIL
                     GGASFNKALHDGVFKTAVVSSVAAEGDVEEGAEAAAFTSSFATSVRSLTSAKAKGLEL
                     TLYTKTAMGSGNQAVNPWLQELPDPLTRASWDNYLTVSKADAASLGLENKNVANGALN
                     GSYATVTVGGATLENVPVIIQPGQAKGSVGLALGYGRKQGLKEEMQVGVNAFSLYQNF
                     NNVQSVKVDKAGGEHEFACVQLQKTLMGRGDIIKETTLEIFNTKDKPVYNPTPMVSLD
                     HEETPVTSPDVDLWDEFDRTIGHHFNLSIDLNACTGCGACVVACHAENNVPVVGKSEV
                     RRSRDMHWLRIDRYYSSEETFEGDNETKDGFDGLGDSLSGFGELEVASENPQVAFQPV
                     MCQHCNHAPCETVCPVAATSHGKQGQNHMAYNRCVGTRYCANNCPYKVRRFNWFLYNQ
                     NDEFDFHMNNDLGRMVVNPDVTVRSRGVMEKCSMCMQMTQKTILDAKRDGRVIKDGEF
                     QTACSNACVSGAITFGDINDKSSKVAKSLEGDRMYHLLEHVGTKPNVQYQVKVRNTKE
                     A"
     gene            73821..75272
                     /locus_tag="KQA_RS0201355"
     CDS             73821..75272
                     /locus_tag="KQA_RS0201355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase"
                     /protein_id="WP_029209405.1"
                     /db_xref="GI:656263451"
                     /translation="MMSHYEAPIRRPLVTGDKSYHDVTLDVVAPVEGKANKQWWIVFS
                     IAFVAFAWGLGCMTYTISTGIGTWGLNKTVGWAWDITNFVWWVGIGHAGTLISAVLLL
                     FRQKWRMAINRSAEAMTIFSVMQAGLFPIIHMGRPWLAYWVLPIPNQFGSLWVNFNSP
                     LLWDVFAISTYLSVSLVFWWTGLLPDFAMIRDRAVTPFTKQIYSVLSFGWSGRAKDWQ
                     RFEEVSLVLAGLATPLVLSVHTIVSFDFATSVIPGWHTTIFPPYFVAGAIFSGFAMVN
                     TLLIIMRKVCNLENYITLQHIELMNIVIMLTGSIVGVAYITELFVAWYSGVEYEQYAF
                     LNRATGPYWWAYWSMMTCNVFSPQFMWFPKLRRSIMFSFFISIVVNIGMWFERFVIIV
                     TSLHRDYLPSSWTMFSPTFVDIGIFIGTIGFFFVLFLLYSRTFPVIAQAEVKSILKSS
                     GEKYKKLREAGKPTYERAEGIVELLADSQDDHH"
     gene            75292..75819
                     /locus_tag="KQA_RS0201360"
     CDS             75292..75819
                     /locus_tag="KQA_RS0201360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_010177373.1"
                     /db_xref="GI:497863217"
                     /translation="MASKVVHAYYLDDEVLMDAVKALKIKHYHIEEVFTPFPVHGLDK
                     LMGLPHTRLAICSFLYGLVGLTVAVTMMNYIMIEDWPQDIGGKPSFSYIENLPSFIPI
                     MFELTVFFAAHLMVITFYMRSKLWPFKKAENPDERTTDDHFLVEVDASHTNVDELTAF
                     LKDTGAVEINLKDKE"
     gene            76642..78027
                     /locus_tag="KQA_RS0201370"
     CDS             76642..78027
                     /locus_tag="KQA_RS0201370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinol:cytochrome C oxidoreductase"
                     /protein_id="WP_010177375.1"
                     /db_xref="GI:497863219"
                     /translation="MYTLSKNLKLIPIILMVVGAIGLAIGFTTTPSTIEEVKEQLASH
                     HDAHGAAHAPAAAHGAHDKAEHGHGHDTHKAADTHGAHAAKSHDAHDSDKHYEHVLHQ
                     LQNKPWAALYVAAFFFFMIALGVLAFYAIQFAAQAGWSPLLLRVMEGITAYLLPGGII
                     LFVILALSGFHMNHLFVWMDPEVVAHDELIQGKSGWLNVPFFLIRAAIYIGVWSLYRH
                     FAVKYSRNQDESPEGNVWYKKSFKLAAVFLVFFIYSESMMSWDWIMSFDPHWFSTLFG
                     WYVFASLFVSGITVIALVTIYLKSKGYLEQVNDSHIHDLAKFMFGISVFWTYLWFSQF
                     MLIWYSNIPEEVTYFITRINDFKLPFFGMLIMNFLFPILLLINSDYKRINWLVVMGGI
                     VILLGHYIDVFNMVMPATVGKSWFIGISEISAVLLFLGIFIYVVFNALTKAPLVPKGN
                     PLLEESKHFHY"
     gene            78061..79119
                     /locus_tag="KQA_RS0201375"
     CDS             78061..79119
                     /locus_tag="KQA_RS0201375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase subunit II"
                     /protein_id="WP_010177376.1"
                     /db_xref="GI:497863220"
                     /translation="MTIFLILLVVALLGITFWQLSKILELSQGSADNSQVANDKDNSM
                     QGKLMLAFVGFLYFLTVWCFVKYDSYFLPEAASEHGTDYDRLMMISVVLIMFVQIITQ
                     GLLHFFAYKYRGKKENKATFFADSNLLEIIWTAIPIVTLAALIIYGLYTWVDIMSIDD
                     DEDALVVELYAYQFDWRARYAGADNELGKANVRFIEGVNILGVDASDNYAQDDIIVNE
                     LHLPVGKKVIFKMRSQDVLHSAYMPFFRAQMNVVPGMITEFSYTPTKTTEEMRTSEFM
                     VEKVETINTIRKAKSKDLLAKGEEALEPYEFDYYLLCNKICGASHFNMQMKIIVESEE
                     DYNNWIAEQKTFRQVVSK"
     gene            79229..81016
                     /locus_tag="KQA_RS0201380"
     CDS             79229..81016
                     /locus_tag="KQA_RS0201380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase"
                     /protein_id="WP_010177377.1"
                     /db_xref="GI:497863221"
                     /translation="MSADGHGHHKETFITKYIFSEDHKMISKQYLITGLLMGIIGIAM
                     SILFRMQIAWPEQSFAIFEVLLGKWAPDGVMDPNVYLALVTIHGTIMVFFVLTAGLSG
                     TFSNLLIPLQIGARDMASGFLNMVSYWLFFLSSIIMVFSLFVEAGPAAAGWTIYPPLS
                     ALPQAMPGSGMGMTLWLVSMAIFIASSLLGSLNYVVTVINLRTKGMSMTRMPLTIWAF
                     FVTAIIGIVSFPVLLSAALLLIMDRGFGTSFYLSDIFIKGEVLHNQGGSPVLFEHLFW
                     FLGHPEVYIVLLPALGITSEIIATNSRKPIFGYRAMVGSIIAIAFLSTIVWGHHMFVS
                     GMNPFLGSVFTFTTLLIAIPSAVKSFNYITTLWKGNLQFNPGMLFSIGLVSTFITGGL
                     TGIILGDSTLDINVHDTYFVVAHFHLVMGISALYGLFAGVYHWFPKMYGRMMNKNLGY
                     VHFWVTAIGAYGVFFPMHFVGMAGLPRRYYTYTNFPYFDDLADTNVLITVFAIITAAA
                     QLVFLYNFISSIFYGKKATQNPWKSNTLEWTTPVEHVHGNWPGELPTVYRWAYDYSKT
                     NADGEYVIAGQDYAPQVVPLQENEEELHH"
     gene            81126..82148
                     /locus_tag="KQA_RS0201385"
     CDS             81126..82148
                     /locus_tag="KQA_RS0201385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvB"
                     /protein_id="WP_010177378.1"
                     /db_xref="GI:497863222"
                     /translation="MNSNLDATGENFTPQEHDIERALRPLSFGDFAGQSQVLENLEIF
                     VKAANMRGESLDHTLFHGPPGLGKTTLAHILANELGVGIKITSGPVLDKPGDLAGLLT
                     NLEPRDVLFIDEIHRLSPVVEEYLYSAMEDFKIDIMIESGPNARTVQIHLDEFTLIGA
                     TTRSGLLTSPMRARFGIQSRLQYYTTELLAGIVERSASILNVPIDERAAFEIAGRSRG
                     TPRIANALLRRVRDFAQIKGNGSIDIEISRFALKALNVDAHGLDEMDNKILTTLIDKF
                     KGGPVGITTLATAVSESAETIEEVYEPFLIQQGFIMRTPRGREVTELAYTHLGKTRGS
                     VQGGLF"
     gene            complement(85166..86449)
                     /locus_tag="KQA_RS0201395"
     CDS             complement(85166..86449)
                     /locus_tag="KQA_RS0201395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
                     /protein_id="WP_010177382.1"
                     /db_xref="GI:497863226"
                     /translation="MPGIKNYTPNKQLLKVMSINSIAVLVRLVTGFILSKAIAIFIGP
                     QGLGIIGNLRSFINSIQTIASLGFYNGVVKYVAEHKNNIKELSKILSTSYYLGFIAML
                     GTSMILYFFAPFWSSYVLNSSDYAHVIKILAAGISLMIVDYFCLAIINGFSRYKVYTI
                     LNITTTVFSLIVTVILLWQYRLEGMLYAIVITPALALFITLIIIFKQKSFVQLLKASN
                     ISWDYSKKLIEYSLMALLTAVIIPPTIIAIRNHIVDVEGLTQMGYWEAMNRISNYYLV
                     FVTSLLSLYLFPKLSAVKTTKQFKQEIFSFYKTLMPLVIIGLLILYFFRVFFIKLLLT
                     SEFLPMQRLFSWQLTGDFFRILSSVLAYQFMAKKMTKSYVFTEILSAVIWYFSSIYFI
                     NNYGYEGAAIGYLVCYSSYFFVLVIWFRKYFFTKE"
     gene            complement(86437..87555)
                     /locus_tag="KQA_RS0201400"
     CDS             complement(86437..87555)
                     /locus_tag="KQA_RS0201400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_010177384.1"
                     /db_xref="GI:497863228"
                     /translation="MRIPFLNLHKLNKRFENNFKSQFDTFLTSGHYILGTKLTEFENA
                     FASYCNVSFCIGTGNGLDALTLILKAYIELGKLNIGDQVIVPANTFIATLLSVKQAGL
                     IPVLIEPDEDSFIINVRNVQQKITPKIKAIITTHLYGQVYGMDELKEFCSNAQLLLIA
                     DAAQAHGAIDQNGNKAGSIAHAAAFSFYPSKNLGALGDGGAITTNNTELANCIKKLRN
                     YGTSEKYRNELIGINSRLDELQAAFLIEKLNLLDDDNNKRREIALRYSNEITNENIKL
                     PFWNGSKNHVFYVYVIRVKNRINFCNYLNENQIGHMIHYPIPPHKQKALTNEFKNQSF
                     PITEKISNEIVSIPLNPILEVSEIDYIIQVLNNYTCQE"
     gene            complement(87583..88692)
                     /locus_tag="KQA_RS0201405"
     CDS             complement(87583..88692)
                     /locus_tag="KQA_RS0201405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011389898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177385.1"
                     /db_xref="GI:497863229"
                     /translation="MKFKFSILHISLIVPISIFLGMIITQYKLFPYNQLRNINQNIKL
                     KILKKNAYDVTDLHVPNLDSILSVTKDNYTEIRAELRKTIFGNKTSSYKIKKNIFDKD
                     YNNLENLANIDKVYIEQSYHINSIAYIFYPKKSNGKSFIYHQGHRGNFLLGKKTIHFL
                     VKQGFTVAALDLPLVGFNNTPSIYLKKFGNVVLNNHKFMEHLDDPISFFINPIINILD
                     ILESKGYNEINMIGISGGGWATTIAAAIDERIKNSFPVAGTYPMYIRFQDPYLNYGHF
                     EGAHSALFKKVNYLDMYILSCLGENRKQYQILNLYDPKCCSGYMYKSYASFVEEKVKK
                     LSPSSEFKVIIDSTHFEHKISEFSHQIIEKKLFKK"
     gene            complement(88682..89632)
                     /locus_tag="KQA_RS0201410"
     CDS             complement(88682..89632)
                     /locus_tag="KQA_RS0201410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177386.1"
                     /db_xref="GI:497863230"
                     /translation="MIQQYTVKKYNKTHYQSWNTFIENSKNSTFLFHRDFMEYHNDRF
                     EDHSLLVLRKQTIVALVPANKNDTTFYSHQGLTYGGLLLLKSIGVTKVETIFLTIIEY
                     LKRNQFSTIRIKTLPVFYHKAPSFELESLFLKLGAKIFRREQNFAIDYNLPFEIHKTK
                     LKNYKKNQHLNFKIIETDNFTDFWEEILKPRLKTKHNAKPVHTESEILFLKSKFPNNI
                     KQFNIFLENKLLAGITIFKTDTVVKSQYGATTNDGEKLRALEFLFIYLIKKYKSEGYK
                     FFDMGIIAGNISLLKQKEELGCNQYLQDFYQLSIDQTNEV"
     gene            89825..91123
                     /locus_tag="KQA_RS0201415"
     CDS             89825..91123
                     /locus_tag="KQA_RS0201415"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177387.1"
                     /db_xref="GI:497863231"
                     /translation="MFKVMIKKITFLFYILFFIFNVVVVIDKGYVFTYDTASYLYIRP
                     NVQPAYSIFLNIVKRIFGINYKEATIGIQLLMSYLTMLYFSEVLKKYFKFNSVVMILL
                     FMLLTYPIYGSYGMCNKLVTKSLSTTFFLFFMASSVKWFFTKKNKHIFFMITFLVLLQ
                     LTRAQFLSISIALVLFVFYMWSLKELKKKMILVVLILSIPLISGLLEKTIYGVFHGHY
                     TSRQLGNVSISTLPFYLSELQDYKLMPDEEVVQYFRCVHGSLEEKKLLLCQLPKNSSL
                     KEKHQFYHDNYPKIMNQTIEYEAKSMYRGKEMSYAASYKNVDRIVGKTLIPLFMARPL
                     AWSEMFYMNLAFPYYSIIPVIFLILLVSYLFFKKKSKILQFQGLIYFFSLLILGNLFL
                     ISISLHCIRRYFMYYDIVFALLALLLLCNFRPIKKYIMQV"
     gene            complement(91197..91787)
                     /locus_tag="KQA_RS0201420"
     CDS             complement(91197..91787)
                     /locus_tag="KQA_RS0201420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177388.1"
                     /db_xref="GI:497863232"
                     /translation="MKNLFFSSLLTLVTLFIVSCSGDDAGAPIKPVIDLVDENLVGKW
                     KLTNFEVSNGTVDLKVDETTIEIPFTTEGSEFNTTALFETTPNKVTFDGTFKANTNFV
                     TPLMINQPTTREDTFESSKILGGTSTLNDWSISEGDSVIAGSKAEIIKFTKNEIQYKL
                     DIAQTSFISIIEEGFDLNGFTTTNPKGQIIVTLEKI"
     gene            complement(91871..93673)
                     /locus_tag="KQA_RS0201425"
     CDS             complement(91871..93673)
                     /locus_tag="KQA_RS0201425"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein TypA"
                     /protein_id="WP_010177389.1"
                     /db_xref="GI:497863233"
                     /translation="MSNTIKNIAIIAHVDHGKTTLVDKIMYHCQLFRENENTGDLILD
                     NNDLERERGITITSKNVSVTYKGTKINIIDTPGHADFGGEVERVLNMADGVLLLVDAF
                     EGPMPQTRFVLQKAIDLGLKPCVVVNKVDKENCTPDEVHEKVFDLMFELGAEEWQLDF
                     PTVYGSAKNNWMSTDWKNQTENIEPLLDMVLEHIPAPKFDEGTTQLLITSLDFSSFTG
                     RIAIGRLQRGSLVEGQQVSLVKRDGSILKSKIKELHSFEGLGRKKVSEVQVGDICALV
                     GLEGFDIGDTVADIENPEALKTIAIDEPTMSMLFTINDSPFFGKDGKFVTSRHIKDRL
                     TKELEKNLALRVNETDSADKFLVFGRGVLHLSVLIETMRREGYELQIGQPQVIIKEID
                     GVKCEPVEELTIDLPENVSGKAVEMVTLRKGELLSMETKGDRMICEFIIPSRGIIGLR
                     NQLLTATAGEAIMAHRFTEYQPMRGGIPERQNGSLVSMELGKAIPYSIDKLQDRGRFF
                     VDPGEDIYEGQVIGENSRGDDMTVNITKTKKLSNVRSSGADDKAKIVPAIKFSLEEAL
                     EFIQKDEYVEVTPNYLRLRKIYLTENERKRNKIA"
     gene            93956..94774
                     /locus_tag="KQA_RS0201430"
     CDS             93956..94774
                     /locus_tag="KQA_RS0201430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxyphosphogluconate aldolase"
                     /protein_id="WP_010177390.1"
                     /db_xref="GI:497863234"
                     /translation="MQLNNIPKIKNLDSNNFFLLAGPCAIEGEEMALRIAEKVVQITS
                     DLNIPYVFKGSFKKANRSRVDSFTGIGDEKALKILRKVSETFDVPTVTDIHTNEDAAK
                     AAEYVDVLQIPAFLVRQTDLVVAAAKTGKTVNLKKGQFMSPEAMQHAIRKVHDSGNDN
                     AMITDRGTMFGYQDMVVDFRGIPTMKQYGTTVLDVTHSLQQPNQSSGVTGGRPDMIET
                     IARAGIATGVDGLFIETHFDPSKAKSDGANMLHLDYLKNLLTNLVAIRQTINSL"
     gene            complement(94782..95930)
                     /locus_tag="KQA_RS0201435"
     CDS             complement(94782..95930)
                     /locus_tag="KQA_RS0201435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_010177391.1"
                     /db_xref="GI:497863235"
                     /translation="MKILLVGEYSGFHNSLKKGLTNLGHEVTIIAHGDGFKNYPVDIN
                     LGIKYFKKNRLLNFIKNGFYTFFKIDLSMLELRNQFKKTVPLLEKYDAIQFINSIAFL
                     GTPKTEKVLFNSITAYNKNIYLHGGSMETPWVDYMLNKHISFSSLTPYIKDKSLKKEF
                     QYALKYLETNHVNHFNYLLNHIKGIIPSDIDYEIVYKGTPKALNMIPTPIDLSKLKFT
                     ALDLSNKINIFCGINTTNQLAKGIPYFLDALDIIKQKYPSKVTVKITRNLPYNEYMKV
                     YNESHILLDQCLSYDQGYNGREAMAKGKVVVSGANEDFKNYYNLTEATMPLVEARPNV
                     DYLVNKLSELIENPDKMLAISKRARKFIEQHHECTEVAKKYLKAWSLD"
     gene            complement(95930..96778)
                     /locus_tag="KQA_RS0201440"
     CDS             complement(95930..96778)
                     /locus_tag="KQA_RS0201440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytanoyl-CoA dioxygenase"
                     /protein_id="WP_010177392.1"
                     /db_xref="GI:497863236"
                     /translation="MDNSLEKHTCALLIDNEPFSFNVSGSFFKGKPEVLYQSQGNILE
                     NTEWESEGFKIISAFSDIEFKLLSNSIKKNILKGIKLAGITVTENDFNIGDYHKYITN
                     QENHLKVINHTKNLRNEDFDLDFEKLALKFSKHTNTKLTPYIKQLQSSHIQIRISRPN
                     SLDINPPHRDGYLDYWKNILNIWIPIAGCNEHSSLPVIEGSHLIPEDQIIRTKAKGAY
                     INGNQYYVPCIIKTTNGPFKMFRPNPKKNEALIFSPFLIHGAAINKNTDVTRIALELR
                     FDKKED"
     gene            96868..97974
                     /locus_tag="KQA_RS0201445"
     CDS             96868..97974
                     /locus_tag="KQA_RS0201445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_010177393.1"
                     /db_xref="GI:497863237"
                     /translation="MISSKMNKLNVAVIVISLSRGGAERSTGTISKILENLGHSVTLI
                     SIIDENEFEHGGEYYALGSTKNYKTVFGRKISKFLDAYQLFQKINFDVVIDGRTRPLF
                     LKELIFNNLIFKNIPVVRIMHNSYLPQSFPKLKWQARYLYKNDSLIAVSKKAQQIVED
                     TYGFDNVRTINYPVSQKKIVESAQAELNILETNYVLFYGRFDNESKNLLFLLEAYSMS
                     KLSELGIPLILVGKGPDKPTIENKIKELNLIYHVIFKNYTPNPMPYVKKALFTVMTSN
                     FEGFPMTLIESLTLGTPVVTLDFISGPSEIIETGVNGILVTTKTTKAFSLALNKMVED
                     VEFYNKCVQGTFESIKYFDNFYIAKKWETLLNEL"
     gene            97971..98399
                     /locus_tag="KQA_RS0201450"
     CDS             97971..98399
                     /locus_tag="KQA_RS0201450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WxcM-like domain-containing protein"
                     /protein_id="WP_010177394.1"
                     /db_xref="GI:497863238"
                     /translation="MKKTRINDCHIIELDKIEGDDSRGSLSVIEKDSIPFESKRIYYL
                     YDVPSDARRGGHAHKELHQFLIPVSGSFDIILNDGKKEQTFTMNKPNKGLYLCPGIWR
                     EIENFSSGAVCLVLASEVYLEEDYIRDFHTFLRLKLPKIQ"
     gene            99375..100502
                     /locus_tag="KQA_RS0201460"
     CDS             99375..100502
                     /locus_tag="KQA_RS0201460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010802563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannosyltransferase"
                     /protein_id="WP_010177396.1"
                     /db_xref="GI:497863240"
                     /translation="MASKKIQIIAFNNPYPVNYGGVIDVFYKIEALKEIGYQVYLHIF
                     YDDRVNISVLEKLCEEVYLYKRNKLFYNFFSLIPFSVKSRNSKELYARITNKTNIPVL
                     FESIQTTYILKKFHFNNETLVRTHNIEHEYYFGIAKSESCFFKKLIFYIEGWKLKRYQ
                     SVLKKADIILTLSERDTSYFNSIFKGKTLFLPVFHGNKKVKETMNSKSKFALYHGDLS
                     ISDNVESAIFICSLFYNLKQELVIASSVLPNRIKKIIKNYSNIKYINIREEEVLEDLL
                     AKAHVNILVSLQESGTKLKVFNALYKGKYCIVNANIVDDKNILKLCYVANTKSEFQKS
                     IQEIFGKDYQFSSERARVLKNYESLNLVKKLSYYLETNKIT"
     gene            complement(100681..101364)
                     /locus_tag="KQA_RS0201465"
     CDS             complement(100681..101364)
                     /locus_tag="KQA_RS0201465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter ATP-binding protein"
                     /protein_id="WP_010177397.1"
                     /db_xref="GI:497863241"
                     /translation="MSEAVLKLTNVTIFQREKAVLSNVSLQVLKGDFVYLIGKTGSGK
                     SSFLKTLYGDLALVQGEGEIVNFKLNGLQEKKIPFLRRKLGVVFQDFKLLNDRTVNNN
                     LAFVLKATGWKEKDKIENRIKEVLTKVGMESKGTIYPYQLSGGEQQRIAIARALLNNP
                     ELILADEPTGNLDPQTSLEVMALLKEINANGNTILMATHDYALLLKYPSKTLKCENQK
                     IFEVVQRKN"
     gene            101679..104684
                     /locus_tag="KQA_RS0201470"
     CDS             101679..104684
                     /locus_tag="KQA_RS0201470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177398.1"
                     /db_xref="GI:497863242"
                     /translation="MKKSSIITCFFVLISSLVLAQQTEIYNTTNGLYQRAVDLYNNKE
                     FAAAQSFFRKVQATTVDQNVKANTSYYIAQSAVQMQQRGADVLMTNFVTDYPTHPKRN
                     SAFFGVGSYYFSVGKYAQARKWYQDVDEQRLSAPALETFYFNKGYSLYHSKRYDDAKK
                     SLERVVGSEKYGEQAKYYLGYIAYKANDYDQADTYFNEVSDSENYNKSLSYYKADRNF
                     KKGEFQKAIDNAEPRLVNANTKDKSQLNKIIGESYFNLEDYEKAVPYLEAYKGNKGKW
                     SNTDYYLLGYSYYKQGEYSKAVSQFNKIIAGKNAVAQNAYYHLADAYLKSEQKQQALN
                     AFKNASEMNFEAIIKEDATYNYAKLSYEIGNSFESVPAVLKTFLLKYPDSSHKQEIAT
                     LLVDSYLSTKNYKEALVVLDSGKGTENKKVFQKVLFYRGLELFKEKDFKEAILLFDRA
                     ISTDALPDFTQRAQFWKGESYYALEDFVIAISNYKAVKESGDNTWEELKLTTYQLGYS
                     NFKIKAYDKAIDYFKKFIASNPEQFYLQDATLRLADSYFVTANYWPAMETYNKSIAQK
                     HKRADYAHFQKAISYGFVNKHDRKIQDLEAFLINFPDSGYRDDAYYALANAYVAKNNI
                     NKGLENYKQLRSELPKSAFVSKALLKEGLIFYNDNKSQKALDKFKLLVAEHSNTTEAL
                     QAVKTARLVYIDLGKTDEYAEWVKSLDFVDISNEELDNTTYEAAEKPYQENNISKAIV
                     GFEKYLKQFPKGLHKLNSHFYLGQLYTKKGDKQQALPHYLAVAEMDKNEYTETALYKI
                     SQTYLENKSYDKAISFLKRLEESADFTQNSIFAQSNLMKSYYEQKQFEETLVYSEKVL
                     VNSTIETSIKADAQIYKARAALALQKTGIAKKAYAEVAKIATGKLGAEAIYNLANFSN
                     QNGDYEISNNYVQRLAKDYSAYKEFGAKGLVLMAKNFYGLGDAYQATYLLESIVKEFT
                     SYPEVISEAKELLQKIKAEEAKTNSSIKE"
     gene            104696..106414
                     /locus_tag="KQA_RS0201475"
     CDS             104696..106414
                     /locus_tag="KQA_RS0201475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-denpendent receptor"
                     /protein_id="WP_010177399.1"
                     /db_xref="GI:497863243"
                     /translation="MSLFFNNRSVLFVVFFIGVLGYSQTKKEENDTLSTEKVVIVKTF
                     NPTINDAFKIHPEPNFDEKEASIKEPLKFQINSVPVASTFVPEKTKSIAVKKEAPEAS
                     FKNYALLGAGNFGNVLAEVFSSIDINKESQFTALLEHQSSQGGIKKVRLDDFFYDTGV
                     QLSFGKQQKRKQWTIDLEAQHQLYNWYGLSSNLEIPEEQFNAIDPSHSFIDVNLGGNL
                     QLDHEVFNTANVRFRHFRDDYESTENNLKLNPKFTAPLDDYPISIPIIFDYLSGEFAD
                     NNVFQGSKYSFLILGVQPTIALNFKGVDVKIGVSGFLSNDFENSELKLTIHPNLTANY
                     NFNAYNLSVFGGATGGLKQNTYHEAIEKNPFVAPGIGITPTNQVFNAFGGVQGQWQEK
                     FSYMLKGEAEFVKDYASFIKNPILNSATENLNYGFNNSFGYFYQDYVAAKITAEVGYE
                     EQGLFNVLLQTTFARYNETPRQPLNIPAFTTSARGNYIVNSAWSIGANIFYVGVREDR
                     DRLNSDLYTELDGYFDLNLRADYKITDQWSAFALGNNLTGQNYERWLDYPVQGIQLLV
                     GAKYKF"
     gene            complement(106486..107307)
                     /locus_tag="KQA_RS0201480"
     CDS             complement(106486..107307)
                     /locus_tag="KQA_RS0201480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177400.1"
                     /db_xref="GI:497863244"
                     /translation="MISIKTFFKVIALTIFIVACASDDDSNGNRNPRILNLQSTGNSA
                     NELLSSKTHNKLILELVAVKGFEPKKEAVENLVNFIEKRTFKSNGVQVIQRSIASTNK
                     KKLSIKQIDSIEQKNRTQLSTPNQHAIFIYFSDADANPENSEGEMNNDNDSMSSLVLG
                     SAYRNTSMVVYENTLKKIVNQSNSVIPDEVLARVETFTLQHEFCHLLGLVNLGTRMQT
                     PHEDTDENGKPNKHCNVRGCLMQANALFESNLMGNIKALELDPLCVKDLQANGGR"
     gene            107353..107886
                     /locus_tag="KQA_RS0201485"
     CDS             107353..107886
                     /locus_tag="KQA_RS0201485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177401.1"
                     /db_xref="GI:497863245"
                     /translation="MKFKCFSLVLFLILSLQSTAQQSTLTESITQYLNINGTTEQYEH
                     AVSSLLVMLKQQYVSKNVPETVWEELNQQKPTAINQIKAMLVSAYRTHFDQTEVNDMI
                     EFYKTPTGQQMITDQTKLTQDDRDKMSFFYNSPTGKKILEESDALNQSVSEISENWSR
                     ALYKSMTARLTEKGYDL"
     gene            complement(107881..108585)
                     /locus_tag="KQA_RS0201490"
     CDS             complement(107881..108585)
                     /locus_tag="KQA_RS0201490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_010177403.1"
                     /db_xref="GI:497863247"
                     /translation="MENDIFGAAITDYFETRIPNSIIVKSNEFDDDEIPIPYLFRTFN
                     EMPKVEQKALDLSFGKVLDVGCGAGSHSLHLQNEKKLTLTAIDTSAGAVEICKKRGVT
                     TVLNEDFYIHQGTYDTILLLMNGSGIVGTLTNFASFFNKLKSLLTSNGQILIDSSDLI
                     YLFEDENGEYWVDAAQGYYGEMQYQLEYKNKTSQKFDWLYVDYNTLQRAAAFNNFNCE
                     LIIEGAHYDYLARLTL"
     gene            108619..109137
                     /locus_tag="KQA_RS0201495"
     CDS             108619..109137
                     /locus_tag="KQA_RS0201495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S oxidoreductase"
                     /protein_id="WP_010177404.1"
                     /db_xref="GI:497863248"
                     /translation="MQEEIDRLPKEAKEQFKENKKFLERLRQKPPKKLDVIMQDLHNK
                     TFDQIDCLECANCCKTTAPIVTDRDTERIAKHLKMKAVDFEQKYVKVDSDGDQVFKTT
                     PCEFLAHDNYCLIYDVRPKACSEYPHTNRKRFHQLNKVTLANTSICPATYRMVEKLKA
                     QFGVLNKKEKQR"
     gene            complement(109134..109409)
                     /locus_tag="KQA_RS0201500"
     CDS             complement(109134..109409)
                     /locus_tag="KQA_RS0201500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_010177405.1"
                     /db_xref="GI:497863249"
                     /translation="MLQKFRILALLEGISFLIILFITMPLKYLFENPMPNKIIGMVHG
                     VLFLGYVVFAIFLKTELKWSNKQTAIILLCSIIPFGTFWADKKYLKN"
     gene            complement(109448..110683)
                     /locus_tag="KQA_RS0201505"
     CDS             complement(109448..110683)
                     /locus_tag="KQA_RS0201505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177406.1"
                     /db_xref="GI:497863250"
                     /translation="MTFFKNTFLILVFPLFSCGKPNPSIKTASKIDHTVISSVKEKKK
                     TTSILTGAQQITSYLKLLKEKKIAVVANPTSIIFNIKKQPIHLVDSLLSRGVNLKKVF
                     APEHGFRGTADAGEVIKNGKDIATGLPIVSLYGKHKKPNPEMLSDIDCIVFDIQDVGA
                     RFYTYISTLHYIMEAAAEANILVIVLDRPNPNGHYVDGPIRQPKFKSFVGLHPIPIVH
                     GMTIGEYAKMINGEQWLANKLTCELSVIPLKNYTHTTAYSLPIKPSPNLPNDQSINLY
                     PSLCLFEGTNVSVGRGTDLQFQLYGAPNFSKTDFSFTPTPKPGAKHPKFEAKLCYGEN
                     LQQHKKLDQLHLNWLLKAYKQSPNKNEFFTSFFKKLAGTDQLQEQIEAGMTAKQIKAT
                     WQKDLDQFNLIRKKYLLYP"
     gene            110731..111963
                     /locus_tag="KQA_RS0201510"
     CDS             110731..111963
                     /locus_tag="KQA_RS0201510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane permease"
                     /protein_id="WP_010177407.1"
                     /db_xref="GI:497863251"
                     /translation="MNFEYFIAQRLIKEKAFAKNISSPIVKIAIIAIALGIIMMLIAI
                     ATGVGLQRKIREKIALFNGHIEISNFDNNSSQVSIKPITTNQTFYPNFSEVPEVTHIQ
                     GVATKAGIVRTETDFEGVLVKGVGSDYKWDVFETYLEQGRLPNYNEKINEEVLISSYL
                     ANRLGYKLGDKVVTYFLKNDKARTNLRSFVVTGIYNSGYEEFDKAFVIADVRHIQRLN
                     KWKKDEVGAFEVFVTDFDAVNRINAAVYKNIPSNLDSTSISQKYGNIFQWLNMFDFNI
                     AGIIGIMILVAGINMITAILVLILERTQLIGMLKAMGSSNVSIRKIFMYNATYIILKG
                     LFWGNLIGLVLIGIQYFFKVITLNPSDYYVKYAPVHITIQQVLALNIGTLVLCVLVLW
                     IPSYVITKIAPIKAIKFQ"
     gene            111993..112541
                     /locus_tag="KQA_RS0201515"
     CDS             111993..112541
                     /locus_tag="KQA_RS0201515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_010177408.1"
                     /db_xref="GI:497863252"
                     /translation="MKARLVDNDADLHQILAIQKENHLDNVSISNKKERGFVTVKHDF
                     EVLKKLNSKARQIIVSDKNEVIGYALVMLKEFKDLIPVLIPMFTLFESIQYRGKKLSE
                     LNYYVMGQICIADGYKRKGLFEKLYLKHKEVYSEQFEYCITEVSSSNIPSMKAHEKVG
                     FKTISTFCDTTDEWNVLLWDWH"
     gene            112629..114536
                     /locus_tag="KQA_RS0201520"
     CDS             112629..114536
                     /locus_tag="KQA_RS0201520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001559594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_010177409.1"
                     /db_xref="GI:497863253"
                     /translation="MSKKHFYRPDIDGLRAIAVMLVILFHAGFTSISGGFVGVDIFFV
                     ISGFLITSSINKQMSQGTFSFQNFYLKRIRRIIPVLVFIMFIVTIPAYFILFSDDFEN
                     YSRTIIHTILSTNNFHLWIKSNDYFAESTELIPLLHTWSLSVEEQFYIIWPPLLLLLH
                     KKFNLKNRLLGVIVLLFLSFMLSVFLTHINMQMAYFLLPARLFEMLMGGVLAIFWYKL
                     PEFSKIQNHIISSVGFFMMLLPALLLTQNDSFPGINALWPCLGASLFIISGKEASKMG
                     VFNTILKIRVLVFIGLISYSMYLWHWPLLVYVKYLGFELTKPIALGVIILTILLSYLS
                     WKFIEQPFRYRYIYDFKNTLLKVLLPSVIICVSLYGVIDHFNGFPNRFTALSEFDKDA
                     NFPSKLRRNCYRKLRIGNIEECGLGTPKDQLDGMLIGDSFANHSAAFLEVLANDAHMY
                     FHDSAAGGYPVLADVDDITGEYRYDPEFGEKRLALAKKYEYVILAANWERFLDKKSKN
                     YQLVLKTVGELVETGKKVIVIDPLRKTTPMDLHKMKMFKVRNIAKIKKEDLLVPFYKR
                     PDDYIVYEFKRKFPTIKIVNLNTVMCNGNYCDYEINDNIVYRNSNHLNTSGARLLGER
                     YLKQYGNPLKK"
     gene            114752..116224
                     /locus_tag="KQA_RS0201525"
     CDS             114752..116224
                     /locus_tag="KQA_RS0201525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522124.1"
                     /note="catalyzes the synthesis of xanthosine monophosphate
                     by the NAD+ dependent oxidation of inosine monophosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inosine 5'-monophosphate dehydrogenase"
                     /protein_id="WP_010177410.1"
                     /db_xref="GI:497863254"
                     /translation="MIAHESKIVGEGLTYDDVLLVPAFSEILPREVSIQTKFTKNITI
                     NVPIISAAMDTVTESSMAIAMAREGGIGVLHKNMTIQQQASEVRKVKRAESGMIIDPV
                     TLPLTAVVGDAKANMREHRIGGIPIVDEQGKLAGIVTNRDLRFEKDVDRPLIEVMTSE
                     NLVTVSEGTSLKDAEVILQKNKIEKLPVVNEDHILVGLITFRDITKLTQKPNANKDQF
                     GRLRVAAALGVTADVVERATALVNVGVDAVIIDTAHGHTKGVVDVLKKVKAAFPDLEV
                     IVGNIATGEAAKYLVEAGADAIKVGIGPGSICTTRVVAGVGFPQFSAVLEVAAAIKGT
                     GVPVIADGGIRYTGDIPKAIAAGADCVMLGSLLAGTKESPGETIIFEGRKFKSYRGMG
                     SVEAMKKGSKDRYFQDVEDDIKKLVPEGIVGRVAYKGELNESIHQFVGGLRAGMGYCG
                     AATIEDLKENGRFVKITASGINESHPHDVTITKEAPNYSR"
     gene            complement(116293..116943)
                     /locus_tag="KQA_RS0201530"
     CDS             complement(116293..116943)
                     /locus_tag="KQA_RS0201530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177411.1"
                     /db_xref="GI:497863255"
                     /translation="MKKQLINILAVTVLTASFISCKKNKEVETTNAKTVEQVVTAEKF
                     KAVPAQTMIKWNAHKIVGGHQGTINASAGLIEVKGNDLVGGNFIFDINTIKCSDLPAG
                     ENYDKLIGHLKNEDFFDVAKHPSAAFQITSVTPKNGKSVIAGNLSIKGIKKNIEFPAT
                     VSVNGNTVTITSDEFEIDRTEWGVKYNSGKFADPAKLGDYLIKDNVGIQIAVTASK"
     gene            117301..117855
                     /locus_tag="KQA_RS0201535"
     CDS             117301..117855
                     /locus_tag="KQA_RS0201535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GrpE"
                     /protein_id="WP_010177412.1"
                     /db_xref="GI:497863256"
                     /translation="MSTKDKAKETVDEIIQDSTKDAKVEEKETQPVEEKDELTLAKEA
                     AAVEKDKFLRLFAEFENYKKRTSKERVELFKTAGQEVLQALLPVLDDFDRASKEIEKS
                     EDEALKQGVTLIHNKLKDILKLKGLEQVEVNTADTFDADIHEAITQIPAPSDDLKGKI
                     IDVVEKGYKLGDKIIRYPKVVTGN"
     gene            117870..118982
                     /locus_tag="KQA_RS0201540"
     CDS             117870..118982
                     /locus_tag="KQA_RS0201540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_010177413.1"
                     /db_xref="GI:497863257"
                     /translation="MKEDFYDILGISKGASASEIKKAYRKKAVQYHPDKNPGDAEAEE
                     NFKKAAEAYEILSDPDKKARYDQYGHQAFENGGGGGGFGGMNMDDIFSQFGDIFGGGG
                     GFGGFGGGGGGQRRSKGSNLRIRVKLTLEEIANGVEKKVKVKRKVQADGTTYKTCGTC
                     NGSGQVVRITNTILGRMQTAAPCNACGGSGQQIDKKPNGADAQGLIVNEETVSIKIPA
                     GVQDGMQLKVSGKGNEAPGNGFAGDLLVAIEELAHESLQREGDNLHYDLYISFSDAVL
                     GGSKEIDTVSGKVRIKIDEGVQSGKILRLRGKGIPNLNGYGKGDLLVHVNVWTPKTVT
                     KEQKTFFEKMKDDDHFSPSPEKSEKSFFEKVKDMFS"
     gene            119357..120256
                     /locus_tag="KQA_RS0201545"
     CDS             119357..120256
                     /locus_tag="KQA_RS0201545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="small mechanosensitive ion channel protein MscS"
                     /protein_id="WP_010177414.1"
                     /db_xref="GI:497863258"
                     /translation="MIILFLQQKIAEKVVDTLDKNVWQKIREILTLKLELGAFKISIL
                     SLIIVIVTFIVTKYALYFITKLITKRLDKENVPKFESLFSFIKYFIYALVGVMVFQAL
                     GINLTPILAASAALLVGVGLALQTLFQDILSGVFILIDRTVIVGDIIELDGKVGRVEE
                     IKLRTTRAVTIDNKVLVIPNHKYLTKSLFNWTQNGKKTRDTVAVGVAYDSDVNLVKKL
                     LLKAVHENKKILSEPEPIVLFEDFGDSSLQFKVVYTISDSFMGAIPRSELRFEITRLF
                     REHNIQIPFPQREIRVLSDHRNN"
     gene            120268..121431
                     /locus_tag="KQA_RS0201550"
     CDS             120268..121431
                     /locus_tag="KQA_RS0201550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_010177415.1"
                     /db_xref="GI:497863259"
                     /translation="MSKILIIEDEAAIRRVLVKILSEENEAYKVSEAGNGLEGVELIK
                     KEDFDLVLCDIKMPKMDGIEVLEAINKVKPEIPVVMISGHGDLETAVNTMRLGAFDYI
                     SKPPDLNRLLNTVRNALDRKELVVENKRLKKKVSKSYEMIGNSKAISEIKEIIEKVAP
                     TEARVLVTGPNGTGKELVAHWLHEKSERSKGPFIEVNCAAIPSELIESELFGHVKGAF
                     TSANKDRAGKFEAANGGTIFLDEIGDMSLSAQAKVLRALQESKVQRVGSDKDIKVNVR
                     VVAATNKDLKKEIEDKKFREDLYHRLAVILIKVPALNDRRDDIPELINHFSKKIAESQ
                     GTIPKDFSDEAVKLLQKYDWTGNIRELRNVVERLLILGEKEISENDVKLFASK"
     gene            121431..121940
                     /locus_tag="KQA_RS0201555"
     CDS             121431..121940
                     /locus_tag="KQA_RS0201555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177416.1"
                     /db_xref="GI:497863260"
                     /translation="MKLFNTLFLFFIVNSILAQHEPGAWVVGVQGAAKVDRISDVGGS
                     FQVHYAPNCYSTYIAEVGVLNTKDGIVPELGITINSIMFNFQSWMITGGMGFIMNSAE
                     LSKKEQDDAIFAFSDGKNSFGALLKIRTLVPINKWWQLSSAFNFKSVGGKFSTVTLGI
                     IYEFPLKGY"
     gene            121942..122808
                     /locus_tag="KQA_RS0201560"
     CDS             121942..122808
                     /locus_tag="KQA_RS0201560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase"
                     /protein_id="WP_010177417.1"
                     /db_xref="GI:497863261"
                     /translation="MKAEKANSSFKISDAKTTIDIGLSEDELKDELKSVRKKLGKLQD
                     TLYAHGKYAVLVCLQGMDTAGKDSLIREVFKDFNTSGIIVHSFKVPSTIERNHDYLWR
                     HYIALPARGKFGIFNRTHYENVLVTRVHPEYILGENIPHISSVNDVDDKFWKQRFEQI
                     NDFEKHLTQNGTLIFKFFLHLSKREQKNRLLRRLEKKDKNWKFSPADLKERKLWDAYQ
                     DCYEDAIRNTSTLQAPWYVIPADHKPVARYLVAKTLYDSLSAYTDIQEPELEEDVVFE
                     LRNYLHQLKSEK"
     gene            123205..129738
                     /locus_tag="KQA_RS0201565"
     CDS             123205..129738
                     /locus_tag="KQA_RS0201565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calcium-binding protein"
                     /protein_id="WP_010177418.1"
                     /db_xref="GI:497863262"
                     /translation="MILKKLSLYALAFFGTSGFAQSSFNYAEALQKSLFFYEVQQSGE
                     LPSWNRVTWRGDSALNDGSDVGVDLTGGWYDAGDHVKFNFPMAFSVTALSWGAIEYEE
                     AYKNAGQLDIIKRNIKFVTDYLLKCHTGPTELYGQVGNGGLDHAYWGSSEVMVMDRPA
                     YKISASAPGSDLAAETAAAMAAASILFKDSDPAYSKTLLDHAKQLYKFADDYRGVYSE
                     AITDAAGFYRSFSGFQDELVWGAAWLYRATNDATYLAKAESEYDNLGNEGQSSNKAYK
                     WGLAWDDKSYGSYVLMSQLTGKDKYKADAERHLDYWTDGFNGDRVPYSPGGQAHLTQW
                     GSLRHSSNTSLLAFIYSDKVETSATNKKKYHDFAVRQINYALGDNPINRSFMVGFGNN
                     PANNTHHRAAHGAWANSLQNRPDKPSHTLFGALAGGPSSPNDQFEDDRGDFIANEVAC
                     DYNACFTGALARMYSEFGGSTLANFPVKETPSRTEIRSYSKFNSNNAFGSTVKILLQN
                     RSAWPARVMDKLSYRYYFDIAEGVAAGKTIDDYDIQLNGVGGSATMSIKSAGGTLYYA
                     EISNIPSISPIGDPAFRNETQINFRVSNGVPYDTSNDPSASGLTGSSEIESVNIPVYD
                     NGVLVFGQEPDGTTTPVDPVNTAPVASINADKFSGEAPLTVTFDASGSSDAENDALTY
                     VWTFGNGETSTDENPSTIYTTAGSYLVSLVVNDGLLNSTEETITINVNDPAVNPVVVT
                     GGTLSGGPFTFTVGDGVADNVSGVTVSGNTGATSQWVVTDETGKILGLPPAPEAVNFD
                     EAPPGTCFIYNVSYNGTLNGLTVDANISGLSGDFQLSSNRVEVVRNAPIVVTPITVAG
                     GTLNGGPFTFTVGDGIADNVSGVSVSGNSGATSQWVVTDEVGKILGLPPTPEAVNFDE
                     APAGSCFIYNVSFNGALNGLAVDSNISGLSGDFQLSSNSIEVVRNAVVVVTPPTGDCT
                     FGAPIATPLETTYGYYTNMYAFGSSAPSMGNLSGFSFNWDLANNGLWSIAIQTTDGNP
                     SYYVDLRDKTTHNLGASQPSITFAGTGIPGLDGTYYTARDGENLALVSTTADYTLYFS
                     NSSTAPDCGDVIDTPIVVNGGTLTGGPFAFTVNDGIADNVSGVSVTGNTGSNFGWIVT
                     DEDLNILGLPGTPEAVNFDEAGAGVCLIWHIAYEDGLTGLTAGENAGNLVGNFDLSNS
                     IRVDRTAAIPSTVDGGTIVGGPFTFTVGDGIADNVSGVSVSGNTGSNFGWVVTDEDLN
                     ILGLPGTPEAVNFDEAPAGVCLIWHIAYEDGLTGLTVGENAGNLAGDFDLSNSIRVDR
                     TGTNVPTPTVDGATVATSTGAVAVETITGDGIADLINFTTTSTATLNYSYLITDAAGN
                     ILVVEADSHDFEGVSVGVCLVYGISYEGTLSVTGKSITDTDLASGAFDVSDNSISVDR
                     KDIPVVVDPTDPTTGGPDVNNKYIERFTEMRNEIYDPANGYFSKDGSPHHSVETLIVE
                     APDHGHESTSELYSYWLMMEAMQGRITKDWQPLAKVWSEMERMIIPTKADQPTNAAYD
                     ASSPAAYAAEFPLPSGYPAPLDFGAAVGQDPVSAELTAAYGPEVYQMHWLLDNDNFYG
                     YGNRGDGTSTPSYINTFQRGEQESVYETIPHPSWESFEFGNSENGFLPLFILDTNYAK
                     QWRYTSAPDADARAVQAMYWAVQYAKEQSGAIDPTLLDNTKKMGDYLRLAMFDKYFKK
                     IGSQDEQGSAGTGYDSAHYLMSWYMSWGGSADPASAWAFRISSSHCHFGYQNPVAAYA
                     LTTLDELDLQTPNGERDWTTSLGRQMEFYRYLQSADGAIAGGATNSWNGDYSTYPAGK
                     STFYDMAYDDNPVYHDPGSGTWFGWQAWSVERVAEYYYITNDPLAKEIMDKWVAWVKP
                     NVKLIGSDDFDIPATLEWSGEPDTWNAANPGDNANLRVTVTNFSKDLGIASSLAKTLT
                     YYAAATRKHATLDEEAKNLAKEILDRMWVTYRDDKGVSAPESRGDYKRMFEEVVHVPT
                     GYTGTMANGDEIKTGVTFLDIRSGLKDDPEYPAVKAAYDAGEDYTTRYHRTWAQMETA
                     LANAEYGFFFGEDDEAAGAKALDVELTVYPNPASELVTVTYPTEEDVALKVTLVDFAG
                     RVITTQELLNEKSTTIDVSNLASGMYIVRLETKGNVIRTEKLIIK"
     gene            129877..131211
                     /locus_tag="KQA_RS0201570"
     CDS             129877..131211
                     /locus_tag="KQA_RS0201570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug transporter"
                     /protein_id="WP_029209406.1"
                     /db_xref="GI:656263452"
                     /translation="MLSKYIKEFPVNLRLAYPIMIGQLGNVMVGFIDNVMVGKLGASS
                     LAAVSLGNGLFFLALSLAIGFSLSITPLVAEADGQKDYLKISLLLKNGIALSTLLGGA
                     LFVVIKLLQPFLTLLDQPEEVVVLANPYINILAFSIIPLAMFQAMKQFSDGLSVTRYA
                     MIATIIGNVLNVFFNYVLIYGKWGFPKLLLEGAAIGTLIARFSMVFFMLLIFYKQQNF
                     KVYVSNIFSNILQLNIVKNLLKLGFPAALQMLFEFGIFISSIFLSGLLSTEDQAANQI
                     ALNVASITFMIAVGLGVTATIRTGNQLGKKDFKALIRIVRSILLLVFLIEFVFAIVLV
                     FLKDYLPVFYISDVNVIALAAKLLLVVACFQISDGFQVVLLGTLRGLQDVNIPTLCLF
                     IAYWCVGFPISYYLGNPSYLGSVGIWIGLFAGLTVSSGLLYIRYLYLSKKFN"
     gene            complement(131280..132257)
                     /locus_tag="KQA_RS0201575"
     CDS             complement(131280..132257)
                     /locus_tag="KQA_RS0201575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008269431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase subunit beta"
                     /protein_id="WP_010177420.1"
                     /db_xref="GI:497863264"
                     /translation="MKTIQFREAICEAMSEEMRRDESIYLMGEEVAEYNGAYKASKGM
                     LDEFGAKRVIDTPIAELGFAGIAVGSAMNGNRPIVEYMTFNFSLVGIDQIINNAAKIR
                     QMSGGQFPCPIVFRGPTASAGQLGATHSQAFENWFANTPGLKVIVPSNPYDAKGLLKA
                     AIRDNDPVIFMESEQMYGDKGEVPEGEYVLPIGVADLKREGNDVTIVSFGKIIKEAYI
                     AADTLAKEGISCEIIDLRTVRPLDLEAIYKSVKKTNRLIILEEAWPLANIASEITYQV
                     QQNCFDYLDAPVIKINTADTPAPYSPTLLAEWLPNNEDVIKAVKKVMYK"
     gene            132613..133359
                     /locus_tag="KQA_RS0201585"
     CDS             132613..133359
                     /locus_tag="KQA_RS0201585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit alpha"
                     /protein_id="WP_010177421.1"
                     /db_xref="GI:497863265"
                     /translation="MKILVCISHVPDTTSKINFTDDDTKFDTNGVSFVINPNDEFGLT
                     RAMWFKEKQGASVDVVNVGGPDTEPTIRKCLAIGADNAIRVNANPTDSLFVAQELASV
                     AKNGGYDLVIAGRESIDYNGGVVPGMLAALLDANFVNTCISLEVEGTSATAIREIDGG
                     KETIKATLPLVIGGQKGLVEESDLRIPNMRGIMMARKKPLSVVEPTGSASQSEPSSFS
                     KPAPKGSVTLVSADNLDELINLLHKEAKVI"
     gene            133474..134433
                     /locus_tag="KQA_RS0201590"
     CDS             133474..134433
                     /locus_tag="KQA_RS0201590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit alpha"
                     /protein_id="WP_010177422.1"
                     /db_xref="GI:497863266"
                     /translation="MSVLIYAESDNGSLRKGAFEVASYAKGVADALGTTVTALTVNVS
                     DVSELGNYGVSKVLQVSDNALTKFQAKAYSSIIEQAAKAEQSKVVVLSSSTNSKYAAP
                     LLGVALNAAVVSNVVSLPKSTSPFVVERTAFTNKAFQETQINSDVKVICVSNNSYGLK
                     ETSVSIEAEAFSPSVNGGSLEVVSIDKATDKVSIADAEVVVSGGRGLKGPENWHLIED
                     LATVLGAATACSKPVSDMGWRPHSEHVGQTGKPVATNLYIAVGISGAIQHLAGINASK
                     VKVVVNTDPEAPFFKAADYGVVGDAFEVVPQLIEKLKAFKSTN"
     gene            134611..135231
                     /locus_tag="KQA_RS0201595"
     CDS             134611..135231
                     /locus_tag="KQA_RS0201595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010520256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177423.1"
                     /db_xref="GI:497863267"
                     /translation="MSLVRLNIRGISYSQTQNGAYALILSEMEGERKLPIVIGAFEAQ
                     SIAIALEKEIRPPRPLTHDLFKNFADRFDVVVKQVIIHKLVDGVFYSSIICERDGIEE
                     IIDARTSDAIALALRFRAPIFTYKNILDQAGIYLKQQSDGEFLSENVDGPEEDSSDEK
                     SVELVSSSADFKNLTVDELYKLLDKAVTDEDYEKAARLRDEISNRN"
     gene            135383..136207
                     /locus_tag="KQA_RS0201600"
     CDS             135383..136207
                     /locus_tag="KQA_RS0201600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010520255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_010177424.1"
                     /db_xref="GI:497863268"
                     /translation="MKQYLDLVQHVMDNGAVKGDRTGTGTRSVFGYQMRFDLSKGFPM
                     VTTKKVHFKSVVYELLWFLKGDTNIKYLSDHGVRIWNDWANDNGDLGPVYGHQWRNWN
                     NEEIDQIKEIVETLKKNPNSRRMLVSAWNPSVMPDTSVSFEENVANGKAALPPCHAFF
                     QFYVANGKLSCQLYQRSADIFLGVPFNIASYALLTEMMAQVCGYEAGEFIHTFGDAHI
                     YNDHVEQLQLQLSRSPKPLPKIKMNPNKTDLFDFKFEDFELVDYEHHPHIKGKVSV"
     gene            complement(136363..137220)
                     /locus_tag="KQA_RS0201605"
     CDS             complement(136363..137220)
                     /locus_tag="KQA_RS0201605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012790977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177425.1"
                     /db_xref="GI:497863269"
                     /translation="MKKLKIVAIATTAILMVQCQDENTADIQPTEETSIENQEANLDL
                     PVVNFTPVSNEVSPEIVKGLQNMGYDTVLDKIENLGNHYLVGGDMIVDKESILEAAHT
                     DPKGKQRRFNSIMRCSEARDVTVRNLIPSINTQVRNALNDWNRIRGSFLRLRLVNGGN
                     ADMTIMRVKGVAGAADRPRNGKPGRTVYFDPDFYKGIPRRGERMRFVIRHEIGHNLGF
                     LHTNEIDNQEKGQHIPGTPNRDRNSIMNSAGNLPFNPAVWPFNNFTEADKRALRKMYG
                     GNAQNNICF"
     gene            137780..139345
                     /locus_tag="KQA_RS0201610"
     CDS             137780..139345
                     /locus_tag="KQA_RS0201610"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177426.1"
                     /db_xref="GI:497863270"
                     /translation="MFIIVSCDPTEDPENTPEKPPIEDPDDGGIMRPDEPMVPVVPTN
                     PEPEKPTNPEPEKPTNPEPEKPTNPEPEKPTNPEPEKPTNPEPEKPTNPEPEKPTNPE
                     PEKPTNPEPEKPTNPEPEKPTNPEPEKPTNPEPVIPTDPEPEKPTNPEPVIPTDPEPE
                     PEKPTNPVNEGQNTSYTDEVDRELFKQLKGHVDYYNKKEFFDDFLFEKYPMYLVQTDS
                     WSFSSAGNAKKAFVINPKKVTSAMKKLGSNESMGLNVYRFDDSMNNAMNRLANGNDFF
                     TFNYSLNNQEGYYLQVYARNITLGRNNETAVTTITHEAFHALHQKKGPLNPNWKFNFD
                     GIQDKSSFPYTRDLVELQILVTEVLIDFPNVTDKNVLKEKLKQYVAIRSKEMELDPTS
                     RKLIKNMSLNQERSEGAPHMIEFMGKRDYFKNNDKFFGTLYGIPMKAKDRADLKDMLN
                     SGNFYPVGASVLYAIAKLDKERMKDYNSKTPFQMASEMLNMSDSEKEEAIEAAKLSVD
                     WGAIQKKAADFTP"
     gene            complement(139846..140145)
                     /locus_tag="KQA_RS0201615"
     CDS             complement(139846..140145)
                     /locus_tag="KQA_RS0201615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase"
                     /protein_id="WP_010177427.1"
                     /db_xref="GI:497863271"
                     /translation="MSISKQFLKSKPECKVTFVWNAKEAKSVTVAGDFNNWETTQLPL
                     KKLKNGTFKGSINLPIENSFQFKYLVDNNSWVNDDSADNYIWNDFAGGENGVLEL"
     gene            complement(140360..141727)
                     /locus_tag="KQA_RS0201620"
     CDS             complement(140360..141727)
                     /locus_tag="KQA_RS0201620"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-tubulin suppressor and related RCC1
                     domain-containing protein"
                     /protein_id="WP_010177428.1"
                     /db_xref="GI:497863272"
                     /translation="MKINLLSKAKNCLYIGFSLSVSVALSQEHIIKVNSNNTFASLQL
                     SEKEYDSWIQNDDFTTSKEVVSNLTKELYNNFEDNYDFIVFVLNEKEVPTTGKIDYFG
                     INNVINSKIEGISFTNDKSDDSKFYGSDGVLKSIMHFPEKEGMLFGPFLHEIMHNWGN
                     FDVIAGEAPSEENEDGSFTFSKIPGHWGLTGGSTPGQLGGFKQSDLIKNKDGSFTTPG
                     FSFNANGGNQVPYNEFELYLMGMIPLEEVAPFDSFSNVTDFSFEEDKDTGDFTSYTFK
                     AGEVIRYTPEKILNDLGPRNPSYKNSQKEFNMLTVIITKTALTEKEWEEYDAIIKVTT
                     QKADHDDKRLYNFWQATRGIGSLNPTIHKKTNTLSIDDITDHDEEFKIYPIPVTATLS
                     IENLKNSPVKNVILCDALGKEINSYPLATTTTIDVSTVASGIYYLIFKNDHKKLVETK
                     RLVIY"
     gene            142180..142626
                     /locus_tag="KQA_RS0201625"
     CDS             142180..142626
                     /locus_tag="KQA_RS0201625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177429.1"
                     /db_xref="GI:497863273"
                     /translation="MFSRSKSKESTIDLEQKELFEHAQARIKEKKGLYRHFIVFLVSC
                     IFMIVLNLGLNFGKEYKFLELDWFVFGVLGWSFFFLIHFFRVVLFSKFMGKEWKAKQL
                     ERLVAKQKAKIAKMEQKLNLEIPKDIVSEKSILLDNTDLNDTEKLQ"
     gene            142630..143112
                     /locus_tag="KQA_RS0201630"
     CDS             142630..143112
                     /locus_tag="KQA_RS0201630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="WP_010177430.1"
                     /db_xref="GI:497863274"
                     /translation="MIILIAAAAENNALGKDNDLLWHLPDDFKRFKKLTSGHPIIMGR
                     KTFESLPGMLPKRTHIIITRQDDYFKEGCLIANSLEQAVELAGTSAKIFIIGGGEIYT
                     QSLKIADSIELTRVHANFEADTFFPEIDTEQWELVDNEQHEADEKHTYSFSYLTYVKK
                     "
     assembly_gap    144272..144318
                     /estimated_length=47
                     /gap_type="within scaffold"
                     /linkage_evidence="unspecified"
     gene            144355..145236
                     /locus_tag="KQA_RS0201640"
     CDS             144355..145236
                     /locus_tag="KQA_RS0201640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010520249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ACP S-malonyltransferase"
                     /protein_id="WP_029209407.1"
                     /db_xref="GI:656263453"
                     /translation="MKAYVFPGQGAQFVGMGKDLYDNAPIAKQLFDKANEILGFSITD
                     IMFEGTPEQLKETKVTQPAIFLHSVILSKVLGDDFKPDMVAGHSLGEFSALVANGVLS
                     FEDGLKLVSQRALAMQKACEASASTMAAVLGLDDEVVETVCNEIGAEVVPANYNCPGQ
                     LVISGGVDAIAKACEILKEKGARRALVLPVGGGFHSPYMEPARAELAAAIEATTFNEP
                     ACPIYQNVTTTAVNSAEAIKENLIAQLTAPVKWTQSIQQMIADGATSFTEVGPGKVLQ
                     GLVKKIDRSAETFGATL"
     gene            complement(145317..145616)
                     /locus_tag="KQA_RS0201645"
     CDS             complement(145317..145616)
                     /locus_tag="KQA_RS0201645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177433.1"
                     /db_xref="GI:497863277"
                     /translation="MKIMSLIISLLVITGIVWFLKINTADNKARKDAIQVEASIEKVN
                     CKQRLKGDKSLVAVAYKGQVYYIFFKNEKDCNKYKENQKVTAYFSKTYNKLYLDL"
     gene            complement(145623..146777)
                     /locus_tag="KQA_RS0201650"
     CDS             complement(145623..146777)
                     /locus_tag="KQA_RS0201650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DegT/DnrJ/EryC1/StrS aminotransferase"
                     /protein_id="WP_010177434.1"
                     /db_xref="GI:497863278"
                     /translation="MKKIQMVDLKGQYEGIKNTVNNSIQEVLDNTAYINGPQVHKFQE
                     ELEKYLNVKHVIPCANGTDALQIAMMGLGLQPGDEVITADFTFAATVEVIALLQLTPV
                     LVDVDPNTFNIDPKAIEKAITPKTKAIVPVHLFGQAANMEAITTIAKKHDLFIIEDNA
                     QGIGASYTFANGTKKKTGNLGHVASTSFFPSKNLGCYGDGGAIFTNNDELAHSIRGIV
                     NHGMYQRYHHDVVGVNSRLDSIQAAVLLAKLPNLDTYNNARRASARKYNDAFKNIPQI
                     ITPVTHTKCEGICDTCDCHVFHQYTLKVKDADRDALVAHLNKNNIPCGVYYPIPLHAQ
                     KAYTDKRYLESDFPVTNQLVKEVISLPMHTELDDEQIAFITKTVIDFVTK"
     gene            147247..148371
                     /locus_tag="KQA_RS0201655"
     CDS             147247..148371
                     /locus_tag="KQA_RS0201655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-fructose oxidoreductase"
                     /protein_id="WP_010177435.1"
                     /db_xref="GI:497863279"
                     /translation="MKNEKRREFIKQLGLVAGSTALLPSLLSFDSIINTYKKEGSQKK
                     INVALCGLGRYAKILAKGLEQTKQCKLTGLVTGTPEKEITWGQKYNIPKKNIYNYDNF
                     DSIIDNKDIDLVYVVLPNSMHKEFTIRAANAGKHVIVEKPMGLNALECVEMIDACKKN
                     GVQLAVGYRLHYEPHHKEIKRMGQEKVFGNIRYIDASLGYRIKGWKKDAWHLKKAMSG
                     GGPLTNIGIYCVQSNRYILGEEPIAVTAQFGPVQRPDYFKEVEESITWQLEFPSGAVT
                     TSASSYSYNVDRLYASGDDGFFELEPALSYGPFKGKSSLGTFNFPVINQQQVQLDEIS
                     KCILNKEPLPMHIRGEEGHKDMLVIDAIYKSAATGKKVVI"
     gene            148384..148956
                     /locus_tag="KQA_RS0201660"
     CDS             148384..148956
                     /locus_tag="KQA_RS0201660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catabolite gene activator protein"
                     /protein_id="WP_010177436.1"
                     /db_xref="GI:497863280"
                     /translation="MINDLLIQNIKKNVSLPDTDLKRICNYFKPKTIPKKEFLLTQGS
                     ICKFEGFVLEGCFRIFIIDKKGHENTLYFAAKDWWVMDIDSFMNQKPSDLNIQAIEDS
                     KVLLITREDKTDLYNSVPSAEKLFRIMSQKSIVAWQQRLIRNHCQTAKDRYNYYISTY
                     PDIASKLTDKQIAGYLGITHEFLSKIKKKS"
     gene            149046..149534
                     /locus_tag="KQA_RS0201665"
     CDS             149046..149534
                     /locus_tag="KQA_RS0201665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177437.1"
                     /db_xref="GI:497863281"
                     /translation="MNLLRSARSCAIAFILTLACNGGYAQITNDITHDEAFKVLLAAK
                     KKAEHSNVLVNIAIVDAGTNLKAFIRMDNSFIGSIDVAIKKAKTARYFNIDTGKLGEL
                     TQPGGIIYNIEHSNGGLITFPGGIPIKNKNGEIIGAIGVSGGTIEQDRAIASAGIKAV
                     ID"
     gene            149556..151079
                     /locus_tag="KQA_RS0201670"
     CDS             149556..151079
                     /locus_tag="KQA_RS0201670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stress protein"
                     /protein_id="WP_010177438.1"
                     /db_xref="GI:497863282"
                     /translation="MKKILKKIIFGTVLLVLQICSAQVSNELMLYRKDFKDISGNNTV
                     SVTSYQKGDAHFVFAGGIGNIDVYSLNKNGELTPISNHELYKGKGPARGMVADSINGN
                     DFLFVANKHGNAIETFKILNNGALERVSLVADTNKTHLGTAITLQVIHMKESSYLFIG
                     GLEETPGLSSFQIHDDGKLTHVQSMEDNEIIHTDGVIGMYTHKINGRTFLYTGGFQDN
                     GVSSFRVYENGTFKNINNISDNTNDRYLTGTYPVTGVTLGNNNYVIVGHRHHKYYKRA
                     GFIKKTDFVYHGDAVSVFKINKKGALIPHFVLKDDETTKLQGQTRIEVVSVANNEAIL
                     AVGTRDDASIQLCRLNKEGILSPINYLETGFSIYYGLRSHKIGKENFLIAGSFRFDLK
                     KIVTYKIAPKINREGKVLRHMVNLKYKDGIEESKVNEAVKNFMNLKNEIPEIASIEWG
                     INDSTEGHSKGLTHCFTLTFADEHAREIYLFHKAHLQMVSKISPIIADVLVLDYWTK"
     gene            complement(151115..152038)
                     /locus_tag="KQA_RS0201675"
     CDS             complement(151115..152038)
                     /locus_tag="KQA_RS0201675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="WP_010177439.1"
                     /db_xref="GI:497863283"
                     /translation="MRALVISGGGSKGAFAGGVAQYLMQVQQRKYDLFLGTSTGSLLI
                     PHLSINKIDKVHDIYTNVNQNTIFSLNPFVVKHKGDREYVSINYLNTVLQFVKRKRTF
                     GESKNLRKNIRKNFTREEFEFARKNVTDVVVTVSNLSKSCTEYKSIHEFSYEDFCEWI
                     WISCNYIPFMSIAKKNGYEYADGGFGAIVPIREAIKRGATEIDAVILESENLDRNKIL
                     GKNPFSLMVNLFGYLLDQVEQHNVTAGKLAAKNKNATLNLYYTPTKLTENSLVFNKKL
                     MTEWWQQGFDYAREKFEQKELNELRDLDMRG"
     gene            complement(152101..154203)
                     /locus_tag="KQA_RS0201680"
     CDS             complement(152101..154203)
                     /locus_tag="KQA_RS0201680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_010177440.1"
                     /db_xref="GI:497863284"
                     /translation="MSQFIKITSLIFSFCASIIYSRAQQKDLVDFKTIEAHIQLDTIN
                     QKVFGKIDVLFTPLKNTNQVYLDAQKMETVTPIKDAKVEYKDNKIWLKGDFKANTAYS
                     FSFNYSTTPKKALYFWGWDAKNIDPNSPNHKQIWTQGQGKYTSNWLPSIDDMNDKIIF
                     TLKIDFNTDYQVISNGSLIHKTTTNTTTTWVYQMQQPMSSYLVALAIGKYLKKEEKSA
                     SGVPLENYIYSDRITDYESTFNYHKKVFDFLETEIGIPYPWKIYRQVPVRDFLYAGME
                     NTACTLFSDDFIVDTNTFDDQNFVNVSAHELAHQWFGNIITETDSNHHWLHEGFATYF
                     ALLAEKELFGEDHFYYKLYESAEQLNHQSDLQKGKALVTPKGSSLTYYQHGAWAIVAL
                     RNNIGDAHFKKVVQQFLTTHQYKNVTTYDFLSIVFEVTGKDTSEFAKKWLHNTTFPAG
                     EALKIITQSEVMKRYLQLAGERTQPLIGKYQLLSDALDFPVNPYLGQEVVAQLQGDFS
                     KEALLLLEKAFESNQPQVLQALANSLTTIPKAFEPKMALLLKADSYATVEGALYNLWN
                     NFEAKKMNYLQATKNLIGFNDKNIRTLWLVLALNTPGFSTTDRTRFFNELNSYTAPNH
                     HYRLRSKAFEYLKLLQSYSDQSLQNLALGATHPNWRFKKNCSTTLKALYANEKYTQRI
                     NRLSATFPNKVKQLLTTD"
     gene            154283..156388
                     /locus_tag="KQA_RS0201685"
     CDS             154283..156388
                     /locus_tag="KQA_RS0201685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="WP_010177441.1"
                     /db_xref="GI:497863285"
                     /translation="MSADILQSPVAYVKGVGPTRATVLEKELGIRVCQDLLHFFPHRY
                     IDRTRYYTISELQQNDAEVQIVGMVTQLKNVKQKKGGSRLVATFQDKTGKMELVWFRG
                     AKWIQESIKINVPYVIFGKTKYYNGFSMPHPEMELLDAHKSSMSSIMQPIYSSTEMLQ
                     RRNITNKVVSKMVQNLFLTKGVFFDETLPKNILEHMKLIGKSEALLNIHFPKSQELLT
                     KASYRLKFEELFYIQLQLIRKNILQKQKIKGYAFEKVGELFTNFYENYLPFSLTGAQK
                     RVVKEIRRDMGSEAQMNRLLQGDVGSGKTIVALMSMLLAIDNGYQATLMAPTAILAKQ
                     HFDGISALVKDLPIHVSLLMGSTKTKARREIHADLENGQIHIIIGTHALLEDKVKFNN
                     LGLAIIDEQHRFGVAQRAKLWRKNELPPHVLVMTATPIPRTLAMSLYGDLDVSVIDEL
                     PPGRKSIKTMHKYDGQRLNVFHFVKQEIAKGRQIYIVYPLIQESEAMDYKDLMDGFES
                     ISRDFPKPEYQISIVHGQMKPADKDHEMERFVKGETQIMIATTVIEVGVNVPNASVMI
                     IESAERFGLSQLHQLRGRVGRGAEQSYCILMSGFKLSEDSKTRLQTMVQTNDGFEIAE
                     VDLKLRGPGDIMGTQQSGVLNLKIADIVKDNQILQVARAYAQQILKEDPNLVLPKNSM
                     IKQAYAQLIQHKNIWNYIS"
     gene            156476..157096
                     /locus_tag="KQA_RS0201690"
     CDS             156476..157096
                     /locus_tag="KQA_RS0201690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation factor Sua5"
                     /protein_id="WP_010177442.1"
                     /db_xref="GI:497863286"
                     /translation="MAAFIKLYEENPNPKQIAEAVKVLKNGGLIIYPTDTVYGLGCDI
                     TSVKALNRIAKIKGIKLEKANWSFICKDLSNLSDYVRQIDSSTFKLLKRCLPGPFTFI
                     LPGNNQLPSVFKKKKTVGIRVPDNKICHDLVEALGNPIVSTSIHDEDEILEYTTDPEL
                     ILEKWGNLVDLVIDGGYGDNIPSSIVDVTDNIPVIVREGKGDTSLI"
     gene            157336..157920
                     /locus_tag="KQA_RS0201695"
     CDS             157336..157920
                     /locus_tag="KQA_RS0201695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177444.1"
                     /db_xref="GI:497863288"
                     /translation="MKKLLKLGLLSVALASSVIANASNKVKVEVLASNELSITMSEVV
                     EGEVLSITNKKGKLVFSEILSATSSYTKTLDFSKLTQGVYYVKAETESAVKVTPFIIV
                     PDQVKIIKGATKTYNAPVFKVENGIAEVSIDNKDLHDVSITVYAKNSSIPLEEVRLNT
                     PKITKTYNFESLPVSEYKIVIYQGDYSYVKTVKR"
     gene            158419..159003
                     /locus_tag="KQA_RS0201700"
     CDS             158419..159003
                     /locus_tag="KQA_RS0201700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177446.1"
                     /db_xref="GI:497863290"
                     /translation="MKKILKLGLLSVALLTTVVVNASNKVKVEVLASNELSITMSEVI
                     EGEVLSVSDKKGEVVFSEILSASSSYTKTLDFSKLTQGVYYVKAETAKAIKVTPFIIV
                     PDQVKIVKGATKTYNTPVFETENDIIKLDIDNKDQHEVSITVYAKNSSIPLEEVRLNA
                     PKITKNYNFKSLPVSEYKIIVYQGDYSYVKTIKR"
     gene            complement(159079..159966)
                     /locus_tag="KQA_RS0201705"
     CDS             complement(159079..159966)
                     /locus_tag="KQA_RS0201705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_010177448.1"
                     /db_xref="GI:497863292"
                     /translation="MTEQKINYNKPSFEHLAPDIGNSLIYKRFNIENKNKQPIWHYHP
                     EIEIVYVNEGSGKRQIGSHVSYYQNGDLICIGANLPHCGFTDGFSKTRNETVIQMLPE
                     YLGKDFFNVSEMNPINALLDRAKQGLVFFGETKKEVGAIIENMYSKSPFERILDSLLI
                     LHKLEASKEFEILNAEGFVLKAQAQDNSRINNTFNYVQKNFKKQISIEEISDFVNMTP
                     PAFCRNFKKVTGKTFTQFVNEYRLVHATKLLTEKQESIQGICFECGFNNFSHFNKVFK
                     KYTGKTPTDYRKEMNFTIS"
     gene            160131..160718
                     /locus_tag="KQA_RS0201710"
     CDS             160131..160718
                     /locus_tag="KQA_RS0201710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177449.1"
                     /db_xref="GI:497863293"
                     /translation="MKKLFKGGLLSVALLAAVVVNAAEKMNVKVLGSKALNVSLSGVA
                     KGESLSIVDKSGITLFSETLSQADVFEKTFDLTYLPEGVYFLESNEEKRINVSPILIA
                     NNKVSLIAGGSKVYNEPRVVVNGSIAKVVLDNSSKTDVVITVRDADDSELLRSEVLTA
                     ENIYKKFDFSALPKGETYTITVKEDDYYFIKEINL"
     gene            160877..161944
                     /locus_tag="KQA_RS0201715"
     CDS             160877..161944
                     /locus_tag="KQA_RS0201715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate synthase"
                     /protein_id="WP_010177450.1"
                     /db_xref="GI:497863294"
                     /translation="MAGNSFGKVFKLTTFGESHGVAIGGVIDGCPAGVTIDFDAIQAE
                     LDRRKPGQSAIVTQRKEPDTVEFLSGIFEGVTTGTSIGFVIRNANQKSKDYSHIKDSF
                     RPSHADYTYYKKYGDVRDYRGGGRSSARETASRVVAGAVAKQVLKGVSFNAYVTGVGH
                     LKLTTPYNELDLSATESNIVRCPDQNMASEMESYIKQIRKEGDTVGGVVSCVISGVPV
                     GLGEPVFDRLHAELGKAMLSINAVKGFQYGSGFEGSALKGSQHNDLFNADGTTKTNLS
                     GGIQGGISNGMDIYFDVAFKPVATIMQDQHTIDKEGNIVEMQGKGRHDPCVVPRAVPI
                     VEAMAALVVVDYMLQNRASQV"
     gene            complement(162022..162732)
                     /locus_tag="KQA_RS0201720"
     CDS             complement(162022..162732)
                     /locus_tag="KQA_RS0201720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_010177451.1"
                     /db_xref="GI:497863295"
                     /translation="MQDNSILKCAIVDDSKLQRLAIVKLIEEHSSLELVAEWNNAIET
                     KNGLLDIPVDLLFLDIEMPILTGFDLLDDLENKPKTIFVTGKTKYAFKAFDYDAIDYL
                     RKPLKRDRFNAAVEKALSQTKMAATSKSAENEDYIFVKSNLKKRKIFLNNLKYVEALG
                     DYVKLIMDNSDPVVVLATMKSFESQLPSERFLRVHKSYIVNLKKVERYNNRNIEIDQE
                     QIPVSRHKKAALSEALSS"
     gene            162910..163248
                     /locus_tag="KQA_RS0201725"
     CDS             162910..163248
                     /locus_tag="KQA_RS0201725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019388304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="WP_010177452.1"
                     /db_xref="GI:497863296"
                     /translation="MNHYETVFILNPVLSEEQIKETVKKYEDLLTENGAKMVAKEDWG
                     LKKLAYPIQHKKSGFYHLFEYTVSGEVINKLEILFRRDERIMRYLTVSLDKHAISWAE
                     RRRVKLKQKA"
     gene            163251..163547
                     /locus_tag="KQA_RS0201730"
     CDS             163251..163547
                     /locus_tag="KQA_RS0201730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="WP_010177455.1"
                     /db_xref="GI:497863299"
                     /translation="MASIEQQAKGKKDGEIRYLTPLNIDTNKEKKYCRFQKSGIKYVD
                     YKDPDWLLGFLNEQGKILPRRLTGTSLKYQRKVSVAVKRARHLALLPYVADLMK"
     gene            163560..164012
                     /locus_tag="KQA_RS0201735"
     CDS             163560..164012
                     /locus_tag="KQA_RS0201735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="WP_010177456.1"
                     /db_xref="GI:497863300"
                     /translation="MELILKKDVENLGFADDIVEVKNGYGRNFLIPQGYGVLATVSAK
                     KVLAENLKQRAYKEQKLVDDAQALANKLNGLEIKISSKSGAGGKLFGSITNADVADAL
                     AKEGISIEKKFISVPGGSIKRLGSYEAPVRFHRNVIANAAFEVVAEKA"
     gene            164095..164577
                     /locus_tag="KQA_RS0201740"
     CDS             164095..164577
                     /locus_tag="KQA_RS0201740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidyl-tRNA synthetase"
                     /protein_id="WP_010177457.1"
                     /db_xref="GI:497863301"
                     /translation="MKYARLSKEQLEALHQEFINFLATQSITGDEWAEIKANKPEVAE
                     EEIDVFSDMIWEGVLNKVEFLEHFSKDQIHLFFLTEEKMHLIAIKVKNKAIDLLTDEG
                     YKWLQQNLMDDSVAFFNATKEYTEDKNVDKFKIIEQGANITKGDLYAYFAKLLDNKKD
                     "
     gene            complement(164861..165721)
                     /locus_tag="KQA_RS0201745"
     CDS             complement(164861..165721)
                     /locus_tag="KQA_RS0201745"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein"
                     /protein_id="WP_010177458.1"
                     /db_xref="GI:497863302"
                     /translation="MQESITQNVTKTSSDVMNSLSGLFNSLQEGVAQYGLKIVGGIVA
                     LIIGLWIIKVILKAVRKAFDTSKIDSTLKPFLLTLVGFLLKVLLFISIAGIVGIPTAT
                     FAALLAAVGLAIGGAFNGSLGHMAAGVMLLIFRPFKVGDLIETNGKLGFVKEISVFVT
                     ILETFQNKTEIIPNGSITAAAITNLTTIGHLRVDMPFAIQYGTDIKKAKEVVMNVLKA
                     DDKVMKDPAPRVAVNNLGPNGVELLALPYSTSDDYWDVYWDTRQKIVEALGEANYDAP
                     LPQRIVTMKS"
     gene            complement(165837..166262)
                     /locus_tag="KQA_RS0201750"
     CDS             complement(165837..166262)
                     /locus_tag="KQA_RS0201750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide oxidoreductase"
                     /protein_id="WP_029209408.1"
                     /db_xref="GI:656263454"
                     /translation="MDYNNLPKDIKIILFDGVCNLCSGAIQFMIKHDKKRNFRYASLQ
                     SELGKELLAERNIDPKIIDSIILIDPKKAYYFKSTAALEISKELSGLYPLLRIFLFFP
                     EKMRDPIYDFIAKNRYKWFGKKESCMIPNDEIKSLFLDF"
     gene            complement(166249..167136)
                     /locus_tag="KQA_RS0201755"
     CDS             complement(166249..167136)
                     /locus_tag="KQA_RS0201755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation inhibitor Maf"
                     /protein_id="WP_029209409.1"
                     /db_xref="GI:656263455"
                     /translation="MKKSLTPIAISLLLSIHLVNCQESSKNRPNPIELTSDFKSYWYQ
                     GEAEISTYELSQNRYGELRNGTATLIYVTEDFLPIKQVKADISAPKNIPVLKLNSVKK
                     FTTGIYPYSIMQSSFSPLKGEKKHALKTTASIQEWCGQTFMQLNNKKNFEIDIKSYFA
                     SEGDQKLSLQKSILENELWNLIRIHGDKLLPKGEINCIPSFEFLRLNHKKTQSYKAIA
                     SIQKNNNLNTFSLTYPELKRSLKITFQQQFPYIIESWSEEISPHLPTTAKRITTKLLP
                     YWNQNSNKFTPLRKELGLQ"
     gene            complement(167217..167807)
                     /locus_tag="KQA_RS0201760"
     CDS             complement(167217..167807)
                     /locus_tag="KQA_RS0201760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation protein Maf"
                     /protein_id="WP_010177461.1"
                     /db_xref="GI:497863305"
                     /translation="MLQEKLKNHQIILASGSPRRQQFLKDLEIDFEIQLQPVDEVYPD
                     HLKAEEITNYLSELKAAAFKQRLQHNDILITSDTIVWHNHHALGKPQSAEHAKLMIAS
                     LSNDWHDVISSVSFTTKNKQITKHFTTKVHFKELTIEEIDYYVTNYNPIDKAGAYGIQ
                     EWIGLIGIDKIKGSYFNVVGLPTHIVYETLIALTKP"
     gene            complement(167828..168301)
                     /locus_tag="KQA_RS0201765"
     CDS             complement(167828..168301)
                     /locus_tag="KQA_RS0201765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S rRNA methyltransferase"
                     /protein_id="WP_010177462.1"
                     /db_xref="GI:497863306"
                     /translation="MTITLLAIGKTDSLQLTQLIEDYKKRLSFYIKFNFEIIPDLKKV
                     KNLSETQQKEKEGELILKKINTSDTLILLDENGKQFNSVDFSNYLQKHMNSGIKNLFF
                     VIGGPYGFSETIYKRANGKISLSKMTFSHQMVRLFIIEQLYRGFTILKNEPYHHR"
     gene            168351..169208
                     /locus_tag="KQA_RS0201770"
     CDS             168351..169208
                     /locus_tag="KQA_RS0201770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177463.1"
                     /note="catalyzes the formation of
                     pyridine-2,3-dicarboxylate and 5-phospho-alpha-D-ribose
                     1-diphosphate from nictinate D-ribonucleotide; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide pyrophosphorylase"
                     /protein_id="WP_010177463.1"
                     /db_xref="GI:497863307"
                     /translation="MISKEQFNHEIELIIANAIREDVGDGDHSSLACIPKDTQGKAKL
                     LVKDEGILAGVAFAKQVCAYVDPNLEIEVLIPDGSAVKYGDIAFYISGSSLAILKAER
                     LVLNAMQRMSAIATKTKFFVDLLAGTGTKILDTRKTTPGIRALEKWAVTIGGGENHRF
                     ALYDMIMLKDNHIDFAGGITQAINQTKSYLKETGRDLKIIVEARDLNEIKEILKSDGV
                     YRILIDNFNYEDTREAVRLIGDTCLTESSGGIDEHTIRKYAECGVNYISSGALTHSVY
                     NLDLSLKAV"
     gene            169210..170133
                     /locus_tag="KQA_RS0201775"
     CDS             169210..170133
                     /locus_tag="KQA_RS0201775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ribonuclease BN"
                     /protein_id="WP_010177464.1"
                     /db_xref="GI:497863308"
                     /translation="MSFKLTKIGLKIPGVLLLTKVLKKIVIPGFEGLSIYDLVKMYVN
                     GIVEGAFSTRASAISFSVFTAIFPFLLFLLNLISVIPIDGFQEEFIVFINSLLPPRTS
                     DFFDSIIYDIANKPRPGLLSSTFVLSMVFMTNGINAVFSGFQNSFHTKISRNFLKQYG
                     VAFWVAIIVALFLISTVYIILYFTYLVTAYEQFLIGDTIFWLKFGRVGIFILMIFTTM
                     ATLFYFGTKEGRITRFFSPGAVLTTVLIIVTTYLFGFYIDNFSRYNELYGSIGALLIL
                     MFYIWINANLVLLGYELNASLRNLKMQTVNK"
     gene            170147..170710
                     /locus_tag="KQA_RS0201780"
     CDS             170147..170710
                     /locus_tag="KQA_RS0201780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chalcone isomerase"
                     /protein_id="WP_010177465.1"
                     /db_xref="GI:497863309"
                     /translation="MKKVLLALVALMMLNSAVAQTVIGDATLPNNKTYESHELILNGA
                     GLREKLWFDLYAAGLFLKEKNTDADAVVAADQPMAIHLVILSGMLSKKKMIGAFRDGF
                     ENTNDKATVQKLQSKIDKYVSFISEEISVSDRYDIIYTTEKGNELYKNGKLLGAIEGL
                     EFKKALFNIWLSKEPVDDDLKDSMLGN"
     gene            170759..171325
                     /locus_tag="KQA_RS0201785"
     CDS             170759..171325
                     /locus_tag="KQA_RS0201785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_029209410.1"
                     /db_xref="GI:656263456"
                     /translation="MKQLLITLALLCSVVATGYAQIPVGRTVMEYEVEYDDTTLKMNG
                     AGTCSMLFIELYSGGLYLQEKSSDPIAIAYDDETMAIRIKITSKLIKRETMLSAIEEG
                     FEKATEGKTGPLKDRIAKVREYYAKPISKGDLLELVYVKGKGVFCYLNSKELGVIEGQ
                     DFKFALFKIWLGENPASESLKKGMLGDF"
     gene            171507..171764
                     /locus_tag="KQA_RS0201790"
     CDS             171507..171764
                     /locus_tag="KQA_RS0201790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177467.1"
                     /db_xref="GI:497863311"
                     /translation="MITEKVAGANTTYAQDASSEKPIRSVVKAVSWRVVGTLDTLVVS
                     YLVLGEGRLGEASAIAGVDFVTKMILYFAHERVWNKVKWGK"
     gene            171843..172472
                     /locus_tag="KQA_RS0201795"
     CDS             171843..172472
                     /locus_tag="KQA_RS0201795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoadenylylsulfate reductase"
                     /protein_id="WP_010177468.1"
                     /db_xref="GI:497863312"
                     /translation="MSFTQEEIVKYNEELKGKTPLEIVQWAVSKAKKPVVTTNFRPYE
                     ASILEVCVAAKADIPVIWCDSGYNTPNTYRHAEAVIAQLNLNVDLYVPQQTVAHRDVV
                     MGVPGVDDPKHAEFTKRVKLEPFGRAMEAHKPDVWFTNLRKGQTTLRDSLDILSLGAN
                     GVLKVSPFYNYSDAELDVYLSEKGLPNEHKYFDPTKVLGNRECGLHTSN"
     gene            172660..173562
                     /locus_tag="KQA_RS0201805"
     CDS             172660..173562
                     /locus_tag="KQA_RS0201805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase subunit 2"
                     /protein_id="WP_010177469.1"
                     /db_xref="GI:497863313"
                     /translation="MSKELSINPLETEAIHIFREVVSQFEKPVLLFSGGKDSITLVRL
                     AQKAFWPAKIPFPLLHVDTGHNFPETIEFRDRLAKELGVELIVRNVQDAIDAGKVKEE
                     TGKYASRNSLQTVTLLDALEEFKFDAAIGGARRDEEKARAKERIFSVRDDFGQWDEKN
                     QRPELFDMLNGKIDLGQNVRVFPISNWTELDVWSYIEQEEIEIPSIYFAHKRKTFVRD
                     GMIWSAEDDVVYREEDEIVEERLVRFRTVGDMSCTAAVLSDAVSIEKVVGEIRESTIS
                     ERGARIDDKRSEAAMETRKQQGYF"
     gene            173708..174955
                     /locus_tag="KQA_RS0201810"
     CDS             173708..174955
                     /locus_tag="KQA_RS0201810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase"
                     /protein_id="WP_010177470.1"
                     /db_xref="GI:497863314"
                     /translation="MEVLKIATAGSVDDGKSTLIGRILYDTKSLTTDKLEAIETRSKA
                     NGFDYLDFSLATDGLVAEREQGITIDVAHIYFSTAKKSYIIADTPGHIEYTRNMVTGA
                     STSQASIILVDARNGVIEQTYRHFFINNLLRIKDIVVAVNKMDLVDFSEEKFNAIKAE
                     FEKMIAQSDYKDQNITFVPISALKGDNVVSTSENTPWYKGESILDHLEKLEAQDVFEK
                     GQARFPVQTVIRPKKDEFHDFRGYAGKLYGGDLAVGDQVTVLPSLTKSKIKEIYFFDK
                     KFDKAGRGSSINVTLEDNINVSRGDMIVKTGEEPGVHKTLKAKVCWMDSKNLVGGTKY
                     LLQHGVNRVQAMVTGIDNVLAPDFSGEDASADALALNQIGEVNIKLAKPVFYDKYAEN
                     KTNGSFILIDPQTNHTAGVGFIQ"
     gene            175075..177165
                     /locus_tag="KQA_RS0201815"
     CDS             175075..177165
                     /locus_tag="KQA_RS0201815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite reductase"
                     /protein_id="WP_010177471.1"
                     /db_xref="GI:497863315"
                     /translation="MQSFRTEIENPIVEKDIIELADKIQMFHNGKIDEEKFRSLRLAR
                     GVYGQRQEGVQMIRIKLPYGKVRSNQLRRICAVSDEYSRGRLHITTRQDIQIHYVDLN
                     RTPELWAELEKDEVTLREACGNVVRNVTASETAGFDVNEPFDVQPYAHAIFEEFLRNP
                     ICQEMGRKFKVSFSSTDEDTGLSYLHDIGFIAKIENGVRGFKVMVAGGLGSQPHLAET
                     LYEFLAAEEIIPAMNAILRVFDRFGERKSRAKARMKFLMAKIGLDAFKELVEEQRIAV
                     PYTSVAIDADAYPQPVIAEVSEIPSVEIKDQKAFTQWKATNLIPQKQAGYIAIGVKVL
                     LGDFYTDKARLLADLVDKYAAGEIRLTLRQNIVIPHVKEELIEVVYAELEKLGFVDAG
                     YNKAVDITACPGTDTCNLGIASSTGIAEELEKVIASEFPQYLNNEDVVIKISGCMNAC
                     GQHNMANIGFQGMTIRTKDKKVAPALQVLLGGGNFGNGEARFADKVVKIPSRRGPEAL
                     RRILNDFDANGNGKKFEEYYAEKGERYFYDFLTELSEADSLPAEYFIDWGTNEEYVKA
                     IGVGECAGVVIDLIETLFLESEEKIANAKISFDNGVYSDAIYHAYSSQINSAKAILLA
                     ENKKTNTQADIVAGFDKEFVETGVIKLEGTFADSVYAINKNAPTKDFATDYIADAEAF
                     LVAVRKFRAASQNA"
     gene            177169..177942
                     /locus_tag="KQA_RS0201820"
     CDS             177169..177942
                     /locus_tag="KQA_RS0201820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrin-III C-methyltransferase"
                     /protein_id="WP_010177473.1"
                     /db_xref="GI:497863317"
                     /translation="MSNYNENTSKGKLTVVGAGPGDVELITLKAIKALKSADAVLYDA
                     LVNPELLDYCTNADLLYVGKRKGCYAFQQEQINELIVQYGKSHGHVVRLKGGDPFIFG
                     RGAEEMEYAAKQGMEVAMVPGLSSSVSVPAMQNIPVTKRGSAESFWVITATTKEHKLS
                     KDVLTAAKSNATVVILMGMHKLGQITEVFANEGKSETPVAIIQNGTRDTEKVVVATIA
                     TIEKEVKKQELSSPAIIVIGEVVNHRTSLLEMQQKLNEV"
     gene            178034..178618
                     /locus_tag="KQA_RS0201825"
     CDS             178034..178618
                     /locus_tag="KQA_RS0201825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="siroheme synthase"
                     /protein_id="WP_010177475.1"
                     /db_xref="GI:497863319"
                     /translation="MERNNLYPVFLKVKNLNVLIVGGGNVAEEKLHFLTKSSPDAKVL
                     LVAPMFREGTIALANKFCATMVTDVYHEKYLEGRHIVIATTEKPEVNVQVWKDCRAQA
                     KLVNVADNPPYCDFYMGGIVTKGNVKVAISTNGKSPTTAKRLRQFFEEVIPENVDDLV
                     QNLNEYRKTIKGDFEEKVETLNEFTKGLIAKKEK"
     gene            178618..179673
                     /locus_tag="KQA_RS0201830"
     CDS             178618..179673
                     /locus_tag="KQA_RS0201830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin--NADP reductase"
                     /protein_id="WP_010177477.1"
                     /db_xref="GI:497863321"
                     /translation="MIKTDILIIGAGPTGLFCVFEAGLLKLKTHLIDALPQPGGQCSE
                     IYPKKPIYDIPGFPEVLAGDLVDNLMEQIKPFEPGFTLGDRAETIETLDDGTFVVTTK
                     RGVKHNAPVVAIAGGLGSFEPRKPPIPGIEGFEDKGVSYIIRDPEVYRDKKVVIAGGG
                     DSALDWSIFLADVAAEVTLVHRRKEFRGALDSVEKVEELSKAGKINLITDAEVKELFG
                     EGELSGVGIKHKEKGDIKLEVDNFIPLFGLSPKLGPIGNWGLEIEKNAIKVDNSYDYQ
                     TNIPGIYAIGDVNTYKGKLKLILSGFHEAAIMCQSAYQRIFPDKKYVMKYTTVGGVTG
                     FDGSKKEAKKEVVKAIG"
     gene            179822..180139
                     /locus_tag="KQA_RS0201835"
     CDS             179822..180139
                     /locus_tag="KQA_RS0201835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_010177478.1"
                     /db_xref="GI:497863322"
                     /translation="MSDVTIKITDREGKVHEVQAPTDMAMNLMEVCKAYELPVEGTCG
                     GMAMCASCQCYVTSDTPLPEMGYDEDMMLAEAFHVEDNSRLGCQIPITPELDGLEVTL
                     APE"
     gene            180342..181694
                     /locus_tag="KQA_RS0201840"
     CDS             180342..181694
                     /locus_tag="KQA_RS0201840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="kynurenine 3-monooxygenase"
                     /protein_id="WP_010177480.1"
                     /db_xref="GI:497863324"
                     /translation="MKQKKIAIVGSGLVGSLLAIYLRKRNYQITVFDRRPDIRKIKFS
                     GRSINLAMSVRGWNALEAIGIKEEVEGLGIPMYHRYIHVNTKDDYTQKYGKDGEAIYS
                     ISRGVLNRKMIDLAEKEGVVFKFEEKVWDVNLPEAKLYTGETEKGKWEEHEFDLIFGC
                     DGAFSRIRHKMQRRSRFNYSQDFLNTGYKELSIPADANGKHVIDKNALHIWPRGKFML
                     IALPNLDGSFTCTLFMPHEGENSFESLTTPQEVRVFWQTYFPDTLQIMPTLLEDYMSN
                     PTSALVTMKCYPWTYWNKVALVGDSAHAVVPFYGQGMNAGFEDVFELDQIIERLGDTD
                     WQNIFETYQEQRKPNADAIAELSYRNFMEMSQKTADPNFILRKKIEKKFSEHYPELWQ
                     PLYSRVTFSNRPYSEAISYGEVQAEIMDQVMQMENIKQDWDTDVVMEFIKEKSSKSMI
                     "
     gene            181733..182173
                     /locus_tag="KQA_RS0201845"
     CDS             181733..182173
                     /locus_tag="KQA_RS0201845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017105997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177483.1"
                     /db_xref="GI:497863327"
                     /translation="METHFVSIGSSLYKEACQLRKELFFKDLENAELLLNDNYEKNSM
                     HLVIESKGAVIGTGRLTITDNNTIGIISQMAIDPDFQRLGLGKFILQSLLKRGRELNV
                     NRITLNARLTAITFYAKNEFIPIGEVFASTKTGVLHQQMELQLG"
     gene            complement(182223..182588)
                     /locus_tag="KQA_RS0201850"
     CDS             complement(182223..182588)
                     /locus_tag="KQA_RS0201850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019941539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AIG2 family protein"
                     /protein_id="WP_010177485.1"
                     /db_xref="GI:497863329"
                     /translation="MNNEIFLFVYGTLLNKHKNPFAQLLKKNSTKIAKGYIYAKKYHL
                     GEFPGIKLDSNKTYKTYGELLKITSNNTFVLSELDFYEGFFPKKPEESLFIRTTTKVF
                     TKGNIVDAFVYEYTKEINP"
     gene            complement(182581..183225)
                     /locus_tag="KQA_RS0201855"
     CDS             complement(182581..183225)
                     /locus_tag="KQA_RS0201855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-methionine-S-oxide reductase"
                     /protein_id="WP_010177486.1"
                     /db_xref="GI:497863330"
                     /translation="MKSLVILSLFILGINACINNPKNPISKINSEPIQTQRNDGLQNA
                     YFASGCFWCVEAIFESVKGVQEVVSGYSGGITDNPTYKQVGSGNSGHAETIEVQYDPK
                     IINFKTLVKVYYGSQNPTTYGQAPDFGSAYRSIIFFQNENERLIAVEARKEVQNTISK
                     KVRTEIIPFEKFYKAEAYHQDYEKRNPEYPYIVRVSIPRLNRFKAKFPELLKNE"
     gene            complement(183343..185010)
                     /locus_tag="KQA_RS0201860"
     CDS             complement(183343..185010)
                     /locus_tag="KQA_RS0201860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016988442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="WP_010177488.1"
                     /db_xref="GI:497863332"
                     /translation="MLEISDLKSKKLPELQEMAKALKVPKFRTLKKLDLVYQILDHQA
                     DDPTKVAKVASVLKEEPTETKVNESKPEAPTKTAKETTTPAPSKPKRERKERVVPKKE
                     NNNTPELAKPKRKAPEKDAAPVKEVVKNEKREPNKPRFEKNDRGNNANNNHKNKNHKN
                     NNGNTRDNKGNRDPRNRYKEPDFEFDAIIESEGVLDIMQDGYGFLRSSDYNYLSSPDD
                     IYVSQSQIRLFGLKTGDTVLGQVRPPKEGEKYFPLIKVNQINGLSPQVVRDRVSFEHL
                     TPLFPQEKFNIADRQSTISTRIMDLFSPIGKGQRGMIVAQPKTGKTMLLKDVANAIAA
                     NHPEVYQMILLIDERPEEVTDMQRNVQGEVIASTFDKEAHEHVKVANIVLEKAKRLVE
                     CGHDVVILLDSITRLARAYNTVQPASGKILSGGVDANALHKPKRFFGAARNIEGGGSL
                     TIIATALTETGSKMDEVIFEEFKGTGNMELQLDRKISNRRIFPAIDLVSSSTRRDDIL
                     LDDTTMQRMWVLRKFLADMNPVEAMESINQRVKQTKNNEEFLISMNG"
     gene            185302..185700
                     /locus_tag="KQA_RS0201865"
     CDS             185302..185700
                     /locus_tag="KQA_RS0201865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177491.1"
                     /db_xref="GI:497863335"
                     /translation="MIQRIQSVYLLLAALVSGVLSYFFPTGFDKVGEISAPFYYEMLL
                     ISALLSFIIIFVFKNRKLQFVLGRLNILLNVILLGVFVYLTLTVSGEVFASEKGIGRF
                     IPVLSIVLIVLANKAIKKDEQLVKSVDRLR"
     gene            complement(185789..186016)
                     /locus_tag="KQA_RS0201870"
     CDS             complement(185789..186016)
                     /locus_tag="KQA_RS0201870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-binding protein"
                     /protein_id="WP_029209411.1"
                     /db_xref="GI:656263457"
                     /translation="MSDKKTPIKVSLEPGKKYAWCTCSHSENQPFCDGSHRKHNATPS
                     LAFEVTEAKEASLCTCKLTNNPPYCDGSHRK"
     assembly_gap    187632..187681
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="unspecified"
     gene            complement(189197..190444)
                     /locus_tag="KQA_RS0201880"
     CDS             complement(189197..190444)
                     /locus_tag="KQA_RS0201880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotB"
                     /protein_id="WP_010177496.1"
                     /db_xref="GI:497863340"
                     /translation="MKKTLLIIITTLTIGALHSQENTYNKWSIELDAGALKTFNLASP
                     GHFSPVPEFVAGNFGVRYSLNTKFGIKADFGYQDINNDDNSIEFETKYYRGSIQGVIN
                     LGNIMGFRTTAFKNIGLLFHGGGGLSSFDYNTLGNTGDELAVNFILGLTPQLKLSKRV
                     SFQVDLSYLRHLGQNFNWDGAQNVSGFGSMLTATAGFAINLGKNENHADWTIEDGASS
                     KQLEELSTKIANIEADMIDTDQDGVADYLDREPNTTSGVTVNTKGVTIDNNRNGIPDE
                     FETALDRKYANDTPTATTAPEVSYDEAIKKLLGEGYVNVYFNTASATPSIYSLDAINY
                     LIEYMKEHPEAKAELIGFADQRGSDSFNSSLSARRAKKVYDILIESGIAAERLSHTGN
                     GETASGTSKESLQLRRKVTFKLK"
     gene            190800..191051
                     /locus_tag="KQA_RS0201885"
     CDS             190800..191051
                     /locus_tag="KQA_RS0201885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="WP_010177497.1"
                     /db_xref="GI:497863341"
                     /translation="MKQGIHPENYRLVAFKDMSNDDVFITKSAANTKETIEIDGVEYP
                     VIKLEISRTSHPFYTGKSKLIDTAGRIDKFKNKYAKFKK"
     gene            191190..192365
                     /locus_tag="KQA_RS0201890"
     CDS             191190..192365
                     /locus_tag="KQA_RS0201890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase"
                     /protein_id="WP_010177499.1"
                     /db_xref="GI:497863343"
                     /translation="MNYILFDGPQRQALLPFTYTRPVADIRIGILTIREKWERYLGST
                     TSTVTEDYLAEKWPMVELESNTFICGGILPTKKLVKAIKALQLKEVLYSENEELIAFC
                     VPEGEDPDLDSYKAIQFNDAFAEVKNTWDIFSLNEQAIEADFELLTVDETSQKLSETN
                     KVIGDGRVFIEEGASVECAIFNTTKGSIYIGKEATVMEGAIIRGPFALCEYATIKMGA
                     KIYEGTTVGPHSKVGGEVGNSVIFGYSNKGHDGYLGNSVLGEWCNLGADTNTSNLKNN
                     YAEVRLWSYETSGFAKTGLQFCGLMMGDHSKSGINTMFNTGTVIGVSANIFGGGFPRN
                     FIPSFSWGGSAGFVTYKTNKAFEVAEKVMQRRKIDFTAQEQAVLEHVFEETVRWRKE"
     gene            192513..193076
                     /locus_tag="KQA_RS0201895"
     CDS             192513..193076
                     /locus_tag="KQA_RS0201895"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-70 factor"
                     /protein_id="WP_029209412.1"
                     /db_xref="GI:656263458"
                     /translation="MKVIALYKNEEALLKGLLKNNRSAQRKLYELHAPKMLSVCRYYI
                     KDLHHAEEVMLNGFFKVFQNVNKFKNEGSFEGWIRKIMVREAISYLRSQKKIEFITET
                     IVLESEYENNIHSTIEVDQIQHCIDLLPEGYKIVFVMYAIEGYKHSEISKMLKITEGT
                     SKSQLFKARKLLQKKVNELNRTGYATK"
     gene            193063..193857
                     /locus_tag="KQA_RS0201900"
     CDS             193063..193857
                     /locus_tag="KQA_RS0201900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012023864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177503.1"
                     /db_xref="GI:497863347"
                     /translation="MLQNEFEKVNKEMLEARSIQPSVDAWDRLSKRLDDDQQNKHKQY
                     KRKYWWLGIAASLIGALFITQQFLYSDFITRSTDVDIVVTENKDIDHLNRKKILKTTT
                     LVTEKQEFNIDSNKSVKHKTALVNREEKSSKKEAKKLVVLNVVPKEKVMMPSQVAHLE
                     KKDTVLKGVTFQDQKIKELLVEVDALEETEVVLSNEIIEDLLLKAQIEIDIENSQIEN
                     KETVNASSLLKSVENDLDMSFRNKVLKALKENYSKVKTGIVQRRDD"
     gene            194012..195076
                     /locus_tag="KQA_RS0201905"
     CDS             194012..195076
                     /locus_tag="KQA_RS0201905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177505.1"
                     /db_xref="GI:497863349"
                     /translation="MNVITKYMVLVLGFVMNIQVANAQDTIQKDVNQFKIKKLETLKA
                     DIKKQEREFLKQEVAAIDELYSKKEITKEQAASQKMEAAKKRALNIDNRIAIINNKIL
                     ILNRNQKDANYKGVIIGDSLKEVFNSIDCESDVPDEKEYDKRIKSGLVLAFGFNNALF
                     DGMDLEDSPYKFAGSRFFEIGWAWNARVFEHTNFMRLRYGLSMQINRLKPDDNKFFVQ
                     EGNKTMLANFPSNLKKSKLTMTNLVLPLHFEFGPSKKEEKETYTKYSTKHKFKIGVGG
                     YGGLNIGTKQKLKFKEDGERVKEKQKRDFNRTKLIYGVSSYIGFGASTLYVKYDLSPI
                     FKNQDVDQNNISIGIRFDVD"
     gene            complement(202547..203161)
                     /locus_tag="KQA_RS0201915"
     CDS             complement(202547..203161)
                     /locus_tag="KQA_RS0201915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177509.1"
                     /db_xref="GI:497863353"
                     /translation="MIKNLFLTISILFFLNTYSQKNGVNIIEEVGKKRTLIFAKNTTN
                     KPRSVFFKVHANGYRRSGDRPVIKQLPPNSKTLLITLIPLVDVPSRYTYTFVANKTLE
                     NIQLKGKEESEADVAELMKQEIVVFTNSSCSKCDNLKKQLNNKHIKYREIDIDLRERF
                     YKYTWKLLEKKGYRTDTLKLPLASVKGKIFHPINSIATFLNEIE"
     gene            203311..204078
                     /locus_tag="KQA_RS0201920"
     CDS             203311..204078
                     /locus_tag="KQA_RS0201920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="WP_010177510.1"
                     /db_xref="GI:497863354"
                     /translation="MELKLSRPICFFDLETTGVNISKDRIVEISILKVFPNGNKESKT
                     WLVNPEMPIPTETTAVHGVTNEKVANEPTFKQLAKVISDMIKGCDLGGYNSNKFDIPL
                     LAEEMLRADMDFDMSNNVAVDVQNIFHKMEQRTLVAAYKFYCDKDLTNAHSAEADTTA
                     TYEVLCSQLDKYPDLENDMEFLSEFSTRRKTADFAGFIAFNEKEQEVFTFGKHKGKLV
                     EEVLDKEPGYFGWIQNADFPLYTKKILTAIRLRKFNA"
     gene            204085..204696
                     /locus_tag="KQA_RS0201925"
     CDS             204085..204696
                     /locus_tag="KQA_RS0201925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
                     /protein_id="WP_010177513.1"
                     /db_xref="GI:497863357"
                     /translation="MKIICIGRNYAAHIEELKNEKPSDPVVFLKPDTSVLLKKQPFFM
                     PDFSNDVHHEIEFIIKINRIGKHINPKFAHKYYDEVSVGIDFTARDVQNELRAKGLPW
                     ECSKAFDGATVLGKWVSKSKFPDISNVNFKLYKNDVVVQDGFTKLMLYSVDELIAYVS
                     KYFTLKIGDIIFTGTPAGVSPVAVNDQLKGYLEEEEMFHIKVK"
     gene            204697..205038
                     /locus_tag="KQA_RS0201930"
     CDS             204697..205038
                     /locus_tag="KQA_RS0201930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177515.1"
                     /db_xref="GI:497863359"
                     /translation="MSISYDLEKVKELAGGDESFVEILLQTFLEEIPEDLKNMSDAVA
                     VNDAKVAYQYAHKMKPNFQLFGIDVIDHIKRIESWANEEITFDEAKVALLVVEEKAEK
                     AIVSLRELLNK"
     gene            205045..206307
                     /locus_tag="KQA_RS0201935"
     CDS             205045..206307
                     /locus_tag="KQA_RS0201935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence damage-inducible protein A"
                     /protein_id="WP_010177517.1"
                     /db_xref="GI:497863361"
                     /translation="MLAEIITIGDEILIGQIVDTNSVFIATELNKIGVDVHQISSIRD
                     DREHILKALAEAQSRVDLVLVTGGLGPTKDDITKHTFCEFFNDTLIENKDVLEHVKGL
                     FDKYIKSPISEVNKKQALVPSKAEVLTNEFGTAPGMWLVDKNTVFVSMPGVPFEMKAI
                     VKDQLIPRLQERFNRPYILHKTILTYGMGESRVAERIEDFENNLPTYIKLAYLPSLGR
                     VRLRLSARGDNEKQLKLGIAKAVEQLKDLIGDIIVGFDENESLEHVIANLLTTHNFTL
                     ALAESCTGGKIARGFTKIGGASAYFKGGLVPYDTALKTTILGVPKALIEAHSVVSTQV
                     AASMAEQSLKLFQSDFAIATTGNAGPTKGDSDAEVGTVCIAIASPKGVVSEQFVFSNH
                     RERTIGKAVNKSLELLQEQILAVLGTAE"
     gene            206444..206683
                     /locus_tag="KQA_RS0201940"
     CDS             206444..206683
                     /locus_tag="KQA_RS0201940"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A0M3L4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_010177519.1"
                     /db_xref="GI:497863363"
                     /translation="MSRVCELTGKKAMVGNNVSHAMNKTKRRFNANLIKKRFFIPEEN
                     SWVTLKVSTAALKTINKIGISAAIKESVEKGIYKK"
     gene            206711..206893
                     /locus_tag="KQA_RS0201945"
     CDS             206711..206893
                     /locus_tag="KQA_RS0201945"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A6GZI5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_010177521.1"
                     /db_xref="GI:497863365"
                     /translation="MAKKGNRIQVILECTEHKATGQPGTSRYITTKNKKNTPDRIEIK
                     KFNPILKRMTVHKEIK"
     gene            207166..208119
                     /locus_tag="KQA_RS0201955"
     CDS             207166..208119
                     /locus_tag="KQA_RS0201955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsY"
                     /protein_id="WP_010177525.1"
                     /db_xref="GI:497863369"
                     /translation="MGFFKKIFSKDKKESLDKGLEKSKTSFFSKLGKAVAGKSKVDDE
                     VLDNLEEVLVSSDVGIKTTVKIIDRIEARVAKDKYLGTAELDQILREEIAGLLSETNL
                     GEAEEFVIPKDKKPYVLMVVGVNGAGKTTTIGKLANQFKKQGLSVVLGAADTFRAAAI
                     DQLQVWADRVDVPIVKQSMGSDPASVAFDSLKSGVAQNADVIIIDTAGRLHNKINLMN
                     ELTKVKNVMKKVIPDAPHDVLLVLDGSTGQNAFEQAKQFTAATEVSSLAITKLDGTAK
                     GGVVIGISDQFQIPVKYIGVGEGIDDLQVFNKFEFVDSFFK"
     gene            complement(208251..209444)
                     /locus_tag="KQA_RS0201960"
     CDS             complement(208251..209444)
                     /locus_tag="KQA_RS0201960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyhydrolase"
                     /protein_id="WP_010177527.1"
                     /db_xref="GI:497863371"
                     /translation="MSTQKETNLREEYQLTDEIIDKFGITNPDKLSAATKRALKWPRD
                     LGKDWFFEYEVYDLKGDLAYEEGVVRRDPSALIKVDGLYYVWYTRSTGPSQGFGGDIE
                     NDKVFPWDRCDIWYATSEDGITWKEQGPAVERGPKGAYDDRSVFTVEIMVHEGVYYLS
                     YQTVKSPYTVRVKNQIGLAWSNSPNGPWTKSEEPILSPADNGVWEGTEQNRFRVEKKG
                     DFDSHKVHDPCIIPFNGKFYLYYKGEQMGEEITFGGRQIRHGVAIADNPKGPYIKSEY
                     NPISNSGHEICVWPYNNGVAALITTDGPEKNTVQWSPDGINFDIKSVIKGAPHAIGLN
                     RTLDSEKGPVEILQWGVTHKYMNYDYQYIRGFKTWTIENHTAPGEATKDGTTSNEGSV
                     ITDKF"
     gene            complement(209528..212083)
                     /locus_tag="KQA_RS0201965"
     CDS             complement(209528..212083)
                     /locus_tag="KQA_RS0201965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="WP_010177529.1"
                     /db_xref="GI:497863373"
                     /translation="MKLFFLISSLALFFISCNQPKSQDTVTPKITDFNFGWKFYLDKG
                     TTDASSENFDDSKWNAVLLPHDWVIEESIDTTNASNQLYMGSGYRKGEGIGWYRKSFA
                     SPSKDKKVYILFDGVYNNSEVFLNGKSLGIHPYGYSPFYFDISNKLKTDATQNILAVK
                     VDHRTYADSRWYSGAGIYRNVSLITTNKLHIPVWGTFITTPKVSKESADVSIKTTLKN
                     NTQATQNFTLKTVIIDPTTDNIITSSASEQTVETNTTIEATHILNITSPKLWDIKHPN
                     LYKIETTITQNDKIIDRDQSSFGVRSIRFDSNTGFFLNGENHKIKGVCLHHDGGLVGA
                     AVPKGVWKRRLLKLKEGGVNAIRISHNPASNEFLDLCDEMGFLVQDEFFDEWDYPKDK
                     RFNQKEKKALPETEGYPRFFQEWAEKDLKNTILSHRNHPSIFQWSIGNEIEWTYPRNA
                     AATGFFNNMNWDGNYFWSEPPYAPEEIKKQLETLPKGKYDIATTAQKLSKWTKELDKT
                     RPVTANCILPSASHLSGYADALDVVGYSYRRVLYDYGHKNYPNKPIMGTENLAQWHEW
                     KSIMERPHISGTFLWTGIDYQGEIREPWPTVVQPSGLLDIAGFEGGSFGMMRSLWNNK
                     PNMFVTTQHIEKSLYKLDNKGKIIAKDPEAWKHALWQWHPINRHWNYENGKMIAVESY
                     SNCTEIELFLNGKSFGKKFLIDNDDHIYKWAVPFNAGTIKLVGIKDGKTITENITTAG
                     APTKIKLSVDNSQLTNNNYDVSHIVAQLVDKDGNPVKTEEQKITFNVPASLRVLGVDN
                     GDKQNNQDFNSNSLTTSKGRALLIVQSTETITEATINATSNTLKSNEILIKVN"
     gene            complement(212298..212957)
                     /locus_tag="KQA_RS0201970"
     CDS             complement(212298..212957)
                     /locus_tag="KQA_RS0201970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="WP_010177530.1"
                     /db_xref="GI:497863374"
                     /translation="MGITKIAPSVLAADFANLQRDIEMINNSQADWFHIDIMDGVFVP
                     NISFGMPVLKAIQKHATKPLDVHLMIVDPDRYIKTFVELGAEIITVHYEACTHLHRTL
                     QLIKSYGVKAGIALNPHTNIELLKNVLTETDLVCLMSVNPGFGGQSFIENTYSKITAL
                     RQMATEQQTDLLIEIDGGVSNKNANQLIDAGANVLVAGSYIFGASNPVETVKNLKEQL
                     L"
     gene            complement(213145..214008)
                     /locus_tag="KQA_RS0201975"
     CDS             complement(213145..214008)
                     /locus_tag="KQA_RS0201975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015482077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor rpoD"
                     /protein_id="WP_010177533.1"
                     /db_xref="GI:497863377"
                     /translation="MRQLKITKQVTNRETASLDKYLQEIGKVDLITADEEVELAQRIK
                     AGDERALDKLTKANLRFVVSVAKQYQNQGLTLPDLINEGNLGLIKAAKRFDETRGFKF
                     ISYAVWWIRQSILQALAEQSRIVRLPLNKIGSINKINKTYAFLEQSHERPPSAEEIAN
                     ELDMTISDVKESMKNSGRHVSMDAPLVEGEDSNLYDVLRSGESPNPDRELMHESLRTE
                     IERALETLTPREADVIRLYFGLGNQHPMTLEEIGETFDLTRERVRQIKEKAIRRLKHT
                     SRSKILKTYLG"
     gene            complement(214183..214641)
                     /locus_tag="KQA_RS0201980"
     CDS             complement(214183..214641)
                     /locus_tag="KQA_RS0201980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010522271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_010177534.1"
                     /db_xref="GI:497863378"
                     /translation="MENFELDNYDRSIIKELELDGRKAYSAIAQKLDISNTMVNQRVN
                     KMIENGILTGIGPIINEKKAGYDWGAFTGLTLKKDHDSEKIIKKLKEIPEITECYFVT
                     GSFTLFVRINAKSHEHMREILYNKLDHIKGIQKTDSIVDLGCAFKRNITL"
     gene            214797..217391
                     /locus_tag="KQA_RS0201985"
     CDS             214797..217391
                     /locus_tag="KQA_RS0201985"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-denpendent receptor"
                     /protein_id="WP_010177537.1"
                     /db_xref="GI:497863381"
                     /translation="MIKINFLLGLLLLSTFGMLGQIEVTGSVTDNIGNFLPNADIIEK
                     GTTNGTTTDFNGNFKLEVNKGATIVISYVGFESQEIEITTQTSFQITLNPDNSLKEIV
                     LVGSRSPKRTVVDSPVAVDIIDIAEVTSKTGKVEITELLQFAAPSFNAQKQSGADGAD
                     HITPATLRGLGPDQTLVLINGKRRHQSSLVNLFGTRGRGNTGTDLNAIPASSIKRIEV
                     LRDGASAQYGSDAIAGVINIVLKTSVNKLTGEVFYGASDVNDNGGFGIPAKEGLDGNT
                     YKATANYGVALNEKGGYVNVTGEFLKKEKTFRPGADFRSKFGEASIDAFHGFFNSEIP
                     INDLSTFYAFGGASIKDTDAFAFDRGANDNRNVTTIYPNGFTPRISSIIRDRSISAGI
                     KSKFRDWDVDFNTTYGINEFHYFIKGSLNASLLEASPTEFDAGGHSLSQNTTGIDLTR
                     NFDVLSGLNIAFGGEYRIENFNIFTGEEASYTQYDLKGVPLSSATPVEDRPTAAQSRP
                     GGSQGFPGYSPANEVDQFRTNLSAYIDGELDVNDNFLIALAGRFEHYSDFGSTFTGKL
                     SSRLKLIPNLNMRGSLSTGFRAPSLVQLFYNLKFSDFEAGELTETLLSQNASPVTQSF
                     GIGKLKEEKAKSASVGFSYSGNGFSASIDGYYTKVDDRIVLTGSFNESSGLNPNLGVA
                     AARFFANGVDTEVLGLDFVFTYTTRFDEHKLGANLIGNLNKLNITEINTGDISEANID
                     TFFGEGEQAFLKFSSPEYKISLGVDYAYSKYSANIVTTFFGNVGPFVSNDDSSLKNTY
                     GSTSTTDISVAYSITDNIKITIGSNNVFNQYPDEQDPNGTESFGIYDAVQQGFGGAFY
                     YTRLSYSF"
     gene            217476..218744
                     /gene="rocD"
                     /locus_tag="KQA_RS0201990"
     CDS             217476..218744
                     /gene="rocD"
                     /locus_tag="KQA_RS0201990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine aminotransferase"
                     /protein_id="WP_010177539.1"
                     /db_xref="GI:497863383"
                     /translation="MNLEKTFIDQEEMYGAHNYHPLPVVLKKGEGVYVYDVDDKRYYD
                     FLSAYSAVNQGHCHPKIIEALTSQANKLTLTSRAFFNDQLGPFEEFISKMFGYDKVLL
                     MNSGAEAVETAMKLARKWGYQKKGVAQNKATLVFVTGNFHGRTLSIISASQDPVSKNG
                     FGPYMEGISIVPYNDIEALEVCLSTNKNIVGFIVEPIQGEAGVILPDATYLKRVRALC
                     TEYNVLYIADEIQTGIARTGNLLASCGDCKCTDRCNLTKEIKPDIVILGKALSGGVYP
                     VSAVLANNEVMLCIQPGEHGSTYGGNPLACVVSRAALDVIIEEKLTIQAKEKGAYLRD
                     KLEMLKDKYPLIISVRGKGLLNAIEIDSSEQSELAWQICLEFRDNGLLAKPTHGNKIR
                     LAPPLIITYDQIDECVCIINKSLQKFSCHE"
     gene            218737..219735
                     /locus_tag="KQA_RS0201995"
     CDS             218737..219735
                     /locus_tag="KQA_RS0201995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidinotransferase"
                     /protein_id="WP_010177541.1"
                     /db_xref="GI:497863385"
                     /translation="MNKGNSMVQDKVNTEGTKVFSQRPALTSNVMMVRPANFGFNDET
                     AENNAFQINNTEISTAEIAAKAVQEFDRFVTMLKKNDVNVEVIQDPQFPVNPDAVFPN
                     NWISFHHPDFVVTYPMFALKRRNERRKEIIDDLKLAYSIKAQFEFEHFEKEKMFLEGT
                     GSIVFDRTHKIAYACKSIRTNEYLFNKFCEDLHFTPILFDAVDKKGQPIYHTNVMMTV
                     GVDFVIICMESIASVVDRKKLEALFKETGKAIIPISIPQMEQFAGNMIQLKNKNEESL
                     LVMSSKAFNSLTQVQLIEMENYAKIIHADLDVIETYGGGGARCMIAEIFLKPLHGK"
     gene            219760..221013
                     /locus_tag="KQA_RS0202000"
     CDS             219760..221013
                     /locus_tag="KQA_RS0202000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidinotransferase"
                     /protein_id="WP_010177543.1"
                     /db_xref="GI:497863387"
                     /translation="MEETKILIDSQPKYSVQAEFNRAQAVIMHEPSSELYYGVLHPHA
                     ALFDSYFNAAKAAKEHKQFQQLLKNRGIEVFTVKEALLKNVVDELGEPIEGKELEEFR
                     DFARSCVRLNTPSLTGLSYDEIVEQHIYLDKVFKKMHPVDLVRTILLQPNLILKRTLT
                     NTFVTADYNANPVMNLYFSRDQIITTGKGVVLTNLNSPQREIETRILCMCLKKIGIKP
                     LLDLSKVNKSAHIEGGDFFMLNNIALIGEGMRSNRLAIEILMKADVIGTEQVALIKDN
                     YHYQPQMHLDTYFNIIDKDLVAISHNRYNAGPGTKQELLVDIYVKGAASYQLTEVSIP
                     FKKYLEDYLKVEVIVISDEDQKNYGLNFLCISPRNIIAVKGQSEDYKNKMALHNVAVE
                     WVDFENLKQGWGAAHCTTQVINRKI"
     gene            221017..222645
                     /locus_tag="KQA_RS0202005"
     CDS             221017..222645
                     /locus_tag="KQA_RS0202005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="WP_010177545.1"
                     /db_xref="GI:497863389"
                     /translation="MSNAFYTIPEPSNELVKSYAKGSLERKLLFEAYDEMYKRRIVVP
                     LYINGEAIFTENKEAIRPPHDFNHVVGDYVKASPSHVKSAIDSCLKAKADWEQMPWQD
                     RAAIFLKAAALISGPYRYKINAATMIGQSKNVYQAEIDSACELIDFFNFNAKFLEEIY
                     SSQPISSVGIWNRTEYRPLEGFVYAITPFNFTAIAGNLPAAPVLMGNVCVWKPSESQM
                     YSANIIMEVLIEAGLPKGVINMVSGDPVMISDSVLNHKEFSGLHFTGSTKVFKTLWKQ
                     IALNLDHYKTYPKIVGETGGKDFVWAHPSADAAIVGTALIRGAFEYQGQKCSAASRAY
                     IPKSMWAELKVFLEAELKTIRVGSPRKVSNFINAVIHEASFKKLVEIIEFVKASNDAS
                     ILFGGGYDNNIGYFVDPTIIVAKNPNFRTMTEELFGPILSIYVYEDTQWEKVLKTVDQ
                     TSEYALTGAIFAQERSVITKATAILRNSAGNFYINDKPTGAVVGQQPFGGARGSGTND
                     KAGSIYNLLRWVSPRTIKENFVPPTNYSYPFLEE"
     gene            222687..223262
                     /locus_tag="KQA_RS0202010"
     CDS             222687..223262
                     /locus_tag="KQA_RS0202010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_010177547.1"
                     /db_xref="GI:497863391"
                     /translation="MVFDIKEIITATMILFAVIDIVGSIPIIIDLRKKVGHIQSGKAT
                     IVSAILMVTFLFVGKQMLELIGIDVNSFAVAGSFIIFFIALEMILGVQLYKAESLQTA
                     AIVPLAFPLIAGAGTLTSILSLRSEYQPVNIIIAILINCLVVYIVLKSSVKIEKVLGN
                     QGIDVVRKIFGVILLAIAVKLFTTNIKGLLA"
     gene            223304..224140
                     /locus_tag="KQA_RS0202015"
     CDS             223304..224140
                     /locus_tag="KQA_RS0202015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177550.1"
                     /db_xref="GI:497863394"
                     /translation="MLLSLSACKKEVPQIAEADTEFISRSHLSNEEEISKVPILNFGT
                     FHMGNTNDARKTEFDEKNEENKRKVHKIANALAKFKPTVIIVERLPKYDKKLLASYNE
                     YIKNPKESFKNPSEIELLAFEVGRLSNTKRMYGIDHHMDYNYMIGDEIKNQIDATMYN
                     QFDINPLLYYPKINVDEDKLSLLDKLKLTNQDDYLDFLIEANADILTHAGTDANFEGA
                     DEAAKYYKRNLRMYSNLNRIKLEPTDRVFMIMGASHTAFFRDFIKRSPKYKMVDTFDY
                     LK"
     gene            complement(224153..225493)
                     /locus_tag="KQA_RS0202020"
     CDS             complement(224153..225493)
                     /locus_tag="KQA_RS0202020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010177551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M28"
                     /protein_id="WP_010177551.1"
                     /db_xref="GI:497863395"
                     /translation="MKKGLLLVSFLFLIKFSFAQIESKIYDIIENVSAKQIEKDIRKL
                     AGFGTRNTFSDTLSETRGIGAARRWIKAEFEQISKNCNHCLEVSYQKDFVTKSMSKRV
                     PKDAWVVNVLAIQKGSKYPNRYVIMSGDIDSRASDTMDFTTDAPGANDNASGMAGTIE
                     AARVLSKYTFENSIIYVGLSGEEQGLFGGAGLAKYAKEQAWDIIGVLNNDMIGNIKGV
                     DGVIDNRSFRIFSEPTNITDTEDQIKRRRYYGGEVDGISRQLARYVHKSVQTYMPEMN
                     PMLIYRLDRFGRGGHHKPFNDLGYAGIRIMEAHENYTQQHQDIRTENGIDYGDTVEHV
                     NFGYAAKLTAVNAINLAQLAWASPPPTEVKIGGIVESSVKLKWKKISDSNIKGYKIYW
                     RSTTSPTWDYSRYVGNVDQFTLKGIVIDNYFFGVSSVSMEGIESPVVFPNAVFK"
     gene            complement(225667..227883)
                     /locus_tag="KQA_RS0202025"
     CDS             complement(225667..227883)
                     /locus_tag="KQA_RS0202025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010521877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polynucleotide phosphorylase"
                     /protein_id="WP_010177554.1"
                     /db_xref="GI:497863398"
                     /translation="MIPQVFKEVIDLGDGREITIETGKLAKQAHGSVVVTMGKTMLLC
                     TVVSNYKQSDVDFLPLTVDYREKYAAAGRYPGGFFKREARPSTEEILVMRIVDRVLRP
                     LFPKDYHAETQIMIQLMSHDPEVMPDALAGLAASTAIQLSDIPFEAPISEVRVSRING
                     EFIVNPTFAQLAESDIDMVIGASADSVMMVEGEMDEISEEEMIEAIKVAHEAIKVQCA
                     AQVRLAEAFGKKETREYTPEDTDEELAKVVNDFAYDKCYAIAKQASAKHDRGAAFGEI
                     KEELQAQYSEEELAEKGDLISKYFNKTQKEAVRNLTLEEGIRLDGRKTTDIRPIWCEV
                     DYLPTTHGSAIFTRGETQALATVTLGTSRDANIIDNASHEGEERFYLHYNFPPFSTGE
                     ARPLRGTSRREVGHGNLAQRALKGMVPEDCPYTVRVVSEILESNGSSSMATVCAGTMA
                     LMDAGVQIKKPVSGIAMGLISDGDRYAVLSDILGDEDHLGDMDFKVTGTEDGITACQM
                     DIKVKGLSYEILVNALKQARDGRLHILSKLTDTIATPAGDVKDHAPKMVTRVIPNEFI
                     GALIGPGGKNIQELQKTTDTTIVINEDPVTEEGIVEILGTGAEGIDAVLARIEAMLFK
                     PQVGSVYEVKVIKILDFGAVVEYKEAPGNEVLLHVSEFAWERVENVTDVLNLGDELDV
                     KYFGIDSRTRKEKVSRKALLPKPEGYVARPPRDDKGKGRDNRGRDNRDRKPREKRD"
     gene            complement(228156..228425)
                     /locus_tag="KQA_RS0202030"
     CDS             complement(228156..228425)
                     /locus_tag="KQA_RS0202030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019387903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_010177556.1"
                     /db_xref="GI:497863400"
                     /translation="MYLTKEVKEEIFAKHGKGKNDSGTAEAQIALFTHRITHLTEHLK
                     QNRKDYNTERSLVKLVGKRRSLLDYLIKKDILRYRAIVKELGLRK"
CONTIG      join(AHHE02000004.1:1..37365,gap(68),AHHE02000005.1:1..106838,
            gap(47),AHHE02000006.1:1..43313,gap(50),AHHE02000007.1:1..41434)
//



spacer
spacer