Dbfetch

LOCUS       NZ_JH621247           229115 bp    DNA     linear   CON 18-MAY-2017
DEFINITION  Aquimarina agarilytica ZC1 Scaffold2, whole genome shotgun
            sequence.
ACCESSION   NZ_JH621247 NZ_AHHE02000000
VERSION     NZ_JH621247.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02470972
            Assembly: GCF_000255455.1
KEYWORDS    WGS; RefSeq.
SOURCE      Aquimarina agarilytica ZC1
  ORGANISM  Aquimarina agarilytica ZC1
            Bacteria; Bacteroidetes; Flavobacteriia; Flavobacteriales;
            Flavobacteriaceae; Aquimarina.
REFERENCE   1  (bases 1 to 229115)
  AUTHORS   Lin,B., Lu,G., Li,S., Hu,Z. and Chen,H.
  TITLE     Draft Genome Sequence of the Novel Agarolytic Bacterium Aquimarina
            agarilytica ZC1
  JOURNAL   J. Bacteriol. 194 (10), 2769 (2012)
   PUBMED   22535944
REFERENCE   2  (bases 1 to 229115)
  AUTHORS   Lin,B., Lu,G. and Hu,Z.
  TITLE     Draft Genome Sequence of the Novel Agarolytic Bacterium Aquimarina
            agarilytica ZC1
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 229115)
  AUTHORS   Lin,B., Lu,G. and Hu,Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-FEB-2012) Department of Biology, Shantou University,
            Da Xue Road No. 243, Shantou, Guangdong 515063, China
REFERENCE   4  (bases 1 to 229115)
  AUTHORS   Lin,B., Lu,G. and Hu,Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-DEC-2011) Department of Biology, Shantou University,
            Da Xue Road No. 243, Shantou, Guangdong 515063, China
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            JH621247.
            Bacteria are available from China Center for Type Culture
            Collection (CCTCC) or Biological Resource Center (NBRC, Japan) with
            the following accession numbers, CCTCC AB 2010229 and NBRC 107695.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/

            ##Genome-Assembly-Data-START##
            Assembly Method       :: SOAPdenovo v. 1.04
            Genome Coverage       :: 50x
            Sequencing Technology :: Illumina HiSeq 2000
            ##Genome-Assembly-Data-END##

            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 05/16/2017 08:25:01
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.2
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 3,540
            CDS (total)                       :: 3,498
            Genes (coding)                    :: 3,388
            CDS (coding)                      :: 3,388
            Genes (RNA)                       :: 42
            rRNAs                             :: 1, 1, 1 (5S, 16S, 23S)
            complete rRNAs                    :: 1, 1, 1 (5S, 16S, 23S)
            tRNAs                             :: 35
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 110
            Pseudo Genes (ambiguous residues) :: 12 of 110
            Pseudo Genes (frameshifted)       :: 24 of 110
            Pseudo Genes (incomplete)         :: 73 of 110
            Pseudo Genes (internal stop)      :: 12 of 110
            Pseudo Genes (multiple problems)  :: 11 of 110
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..229115
                     /organism="Aquimarina agarilytica ZC1"
                     /mol_type="genomic DNA"
                     /strain="ZC1"
                     /db_xref="taxon:620914"
     gene            <1..2258
                     /locus_tag="KQA_RS0201050"
                     /pseudo
     CDS             <1..2258
                     /locus_tag="KQA_RS0201050"
                     /inference="COORDINATES: protein motif:HMM:PF13585.4"
                     /note="incomplete; too short partial abutting assembly
                     gap; missing start; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=3
                     /transl_table=11
                     /product="hypothetical protein"
     gene            2321..3271
                     /locus_tag="KQA_RS0201055"
     CDS             2321..3271
                     /locus_tag="KQA_RS0201055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IX secretion system membrane protein
                     PorP/SprF"
                     /protein_id="WP_010177309.1"
                     /translation="MEKKFFRSAMVILGIIISTVAQAQQDPQYTQYMYNPSVVNPAYA
                     GSRDVLSIVGLHRSQWVGVEGAPRTQTLGIHSPIGIGRVGLGGNIVHDEIGPSQETYL
                     TADFSYTIPTSEKGNLSFGIKAGAHILDVDFTKLNISDAGDIFDRNIDNKVSPNIGLG
                     LFYYTDKFYLGLSAPNLLQTRHFDNVNINTSTGSSFLSKERVHYYITTGRTFDLSSNV
                     KFKPAILSKIVFGAPLQLDLTANFLIWEKLTLGAAYRWSAAWSALAGFQISDSLMIGF
                     GYDRETTPLGDTSFNDGSYEVMMRFELFRKQNKIITPRFF"
     gene            3284..5269
                     /locus_tag="KQA_RS0201060"
     CDS             3284..5269
                     /locus_tag="KQA_RS0201060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010520421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope biogenesis protein OmpA"
                     /protein_id="WP_029209397.1"
                     /translation="MNTKNIKNVILYSFLGFSALVAQEQKIKKANKAFENYAYIDAQK
                     TYLSVVEQGYTSADVYEKLGDSYYFNADLESAAIWYGKLFYEYASNVKPEYLFRYSHA
                     LKNIGNYELSDKVMEQFGKVTGVKEQRVKFFNKDRNYLALIEKQSGKFKVYNVEGVNT
                     SGSDFGPSYYNDNTIYFASDRSNIAKKNIHTWTNAPFLNLFKADKDSNQLTNLNNSSK
                     VNGNINSKYHESSTVFTKDGKTMYFTRNNYTDKKKKSDTNGTTKLKLYRAVLKDGRWS
                     NELELPFNSDEYSVAHPALSKDEKRLYFASDMKGTKGLSDLFFVEILGVNKYSEPQNL
                     GSNINTEGRETFPFISNNGDLFFASDGHIGLGGLDIFIAKATPSKKNFEEAYNVGKPI
                     NSKYDDFSFILNSSKKEGYFTSNREGGLGNDDIYAFEQVEELITTCDQYLKGIITDAE
                     TRALLPGSKVTLLTEDLKPITSTVADGNAFYELPIECDNKYVIRAEEPNYKPTEVDFA
                     SSSVFEFNHNQPIQLRKGAPIINNVAAKVGDDLAKLLQLNPIYFDFDKDFIRPDAALE
                     LQKVIAVMKEYPNLEIDVRSHTDSRAPFAYNIDLSTRRNKNTIKYIVEKGGMSTSRLT
                     GRGYGEIELTNECADGVNCSEEKHQLNRRSEFIIVKQ"
     gene            5445..5855
                     /locus_tag="KQA_RS18225"
                     /pseudo
     CDS             5445..5855
                     /locus_tag="KQA_RS18225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006261444.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605 family transposase"
     gene            6225..6998
                     /locus_tag="KQA_RS0201070"
     CDS             6225..6998
                     /locus_tag="KQA_RS0201070"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177312.1"
                     /translation="MKTKLLYLFTFITTLSFSQTNLVPNGNVESWTNSTTLDNWITEN
                     NVSQNTTDSTEGNSSASLLIIGNSSVNPKIVTKVPLTSGITYTVSYKFKYTTSSFTGS
                     RSVCLKLVKDGSATTTTRCSTLNDNLWNFKEITFTPDQTGDYDLSISTSNFSGINTFE
                     VLIDDIKVFDPLNLSVDYFKNDDQNQNIYPTITNGKIYFDKIENVDELNISVFNCIGQ
                     KENFVVNNNTIDLSRLATGIYFISLKTDKLNTVKRILKK"
     gene            complement(7366..8525)
                     /locus_tag="KQA_RS19360"
                     /pseudo
     CDS             complement(7366..8525)
                     /locus_tag="KQA_RS19360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011708903.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS256 family transposase"
     gene            complement(8717..10228)
                     /locus_tag="KQA_RS19365"
     CDS             complement(8717..10228)
                     /locus_tag="KQA_RS19365"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family protein"
                     /protein_id="WP_010177313.1"
                     /translation="MFNVKSFFSGGHLRSVFWCLATTLSLHGQTKPTNPTFNLGQDPS
                     PDSKSWKLIDDLSDEFDSPKLDLTKWENTRADLWVGRPPGLFQEKSATVAAEHLRLEN
                     YLLDSPRVIDGETYTHGCGNIWSKRKASVGYYIEAKMKANKTFMSSTFWLINRPDDFT
                     GCDRRTTELDIVEVVGLVTSTDPNKKDYNKNMNSNSHSRNTSCPETPTGSRGTESPIN
                     EEAWANYHVYGCWWKSPKELIFFLDGQEVHSITPKADFNLDMYLRLVTETYKWNSVPN
                     DGQQGMGGTQEERTTYYDWVRTWELTPKNLVTNDIVTIDDVPDDVIKGQSFDVEVHYE
                     ATSSADIVVALYDPSGSTFFRNAKKKVDAGIGTVTITIQTEDTWPIANDYEVRAIIRE
                     VDGNFMTDRDIKKTTIDLTEDSLSISEFRNETEKRFSIFPNPVKDEIFNLMVNENIKG
                     AKLYIYDLKGDLVLQKKVENTSNKITIGKLTSGIYLIKINKNQHTLVTKLVVQ"
     gene            10715..11866
                     /locus_tag="KQA_RS19370"
     CDS             10715..11866
                     /locus_tag="KQA_RS19370"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177314.1"
                     /translation="MRNFLVLSICAIFSNVYSQWDTGWFPNPDNYVPKYNGKSWQRLG
                     WMSDGFNDGWLNETKWKRGYLNEWNDKGRTRWNSWPDYVKVSNTWGQGCAQIGHYWND
                     ASAGGWANTISCGIISSRNTVKYPVYLESRIRVANTELSSNFWLLDTGENRREIDVLE
                     CYGGNSWNGNRATSNFHFFTDSDRKDHFKRSDHWRGFPWRNNFHRFGVLWLNPWDVRF
                     FIDGKREGYNFYSINLKTKDGLQLNKDWWNYSTEMKIILDVEEHKGTAQDPIWKYKQG
                     LWNTDRKMLVDWIGVWKPNTGGKKLNTSSINTAELPKVYPNPVKQGQELVLSNIEKGQ
                     NFIFSSVDGKIISSFNIPHEDKLFLNTKDISPGLYILQVDTNVIKLIVK"
     gene            12366..15167
                     /locus_tag="KQA_RS0201100"
     CDS             12366..15167
                     /locus_tag="KQA_RS0201100"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-agarase"
                     /protein_id="WP_010177315.1"
                     /translation="MKNYLLFMLFSVQLLFAQSVKLPEGFTKDSSLSDDFNYGSDKKG
                     MSDKWDDFNSSGWKGPGPTEFRSENITFKDGKLIIKASHFEGGEKHFENGRTWTRQVH
                     TGYLVSKEDNPISPPVYFEASLKANAIGLASNFWAKRGNIDNSSEIDVVETYSDTDNG
                     SNNYHFFRDKKDYNDQRRPPVGNDVESNFNVYSCFWKSKTEVIFYVNGKQTRHIYPCA
                     PDPRDRLVDPAGRFFDENLRIILDCEVHTWRIKQKIANALPTKAALDKLTDDQQMQVD
                     YMHVYKPGSGYKVSDPCGSDSSDSTDSAADDKSFSSLSFNQSTEGANNNPLILSAPNT
                     VERNIKGYPLKASFSQDGYAIFHLKDRNNGWKSYGHVGKQVTSGKQYNFWLKTNEYIS
                     GNNLDLVWEIKVNNGAKGFAVKSTNVNNGGNNQDTFSNNSSPTIQNAPSSIVRNIKGY
                     NLQAYFPQGGYAIFHLKDKNNGWKSYGQVGKRVTSGSTHNFWLKTNQYISGNNLDLIW
                     EVKVDNGAKGFAVKSTSLNSGGGNQNTVSNNSNATIQNAPSSIVRNIKGYNLQAYFPQ
                     GGYAIFHLKDKNNSWKSYGQVGKRVTSGSTHNFWLKTNQYISGNNLDLIWEVKVDNGA
                     KGFAVKSTSVNSGGGNQNTVSNNNNPTIQNAPSSIVRNIKGYNLQAYFPQGGYAIFHL
                     KDKNNGWKSYGQVGKRVTSGSTHNFWLKTNEYISGNNLDLIWELKVDNGVKGFAVKST
                     GANSGGGNQNTVSNNSNPTIQNAPSSIDRNIKGYNLQAYFPQGGYAIFHLKDKNNGWK
                     SYGQVGKRVTSGSTHNFWLKTNEYISGNNLDLVWELKVDKGAKGFSVKSAYVNNGNKS
                     LIQKQSDDYIVKSNSIKFINYTNNSSFRVYNLLGELKDVDMIHSSDSVILDFSNMNHG
                     VYLVKTSKEKVIKFLNKRR"
     gene            15600..18077
                     /locus_tag="KQA_RS0201110"
     CDS             15600..18077
                     /locus_tag="KQA_RS0201110"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_029209400.1"
                     /translation="MREMKKNYGLLIMLFFRVFTYGQVILNIPDVNFKNALLNNDPVI
                     DTNGDGEIQNGEAFVFGGPLFLDNKGIVDMTGIEAFNNVRIIRASSNQIETIDLSKHT
                     SLQELYLSNNKLRQLDLSKNSRLLRLEVASNNLVSLDLSSNANMRNVNVSSNTIKILD
                     FSNSPFMERFIANGNDLRFINAQNGSNTGLTDFVVSNNPNLSCIMIDNVVSFIVPLTW
                     EKDATASYSENCVAPIVNIPDAAFKGILLNHSPAIDTNSDGEIQISEAEAVSNINTSR
                     NGDIEDLTGIEYFVNLRTLDCRASALKTLDVSKNVNLTTLYCSSGEITSLNISKNTEL
                     EDLRCGDNFIKSLNISKNPKLEILLADKNDMETFFVSDIENTVLHTLHVQENKLRILN
                     EAKFPALVSFRCEQNLITSLDISNNPNIRTFYAFSNALTSLNLKNGANTLFSPLLTNN
                     PDLYCIKVDDVDYSNTNWNGLSNKDDQAVYNETCSTRGILIPDDNFKEALLNYIPVID
                     INQDGQIQSFEATAFTGTMNVVNKDIADLTGIEHFTNITNLFCNNNSLTALDVSQNTK
                     LTTLHCGFNDLSALDISKNTELIDLFFSFNKIKTINIASNTKLQTLIGFNAELETLVS
                     ARDNYPSLTRLFLANNKLSTLITSPFSNLQILTCQDNEISALDFSLNTKITEILVQNN
                     QLTSVDLKNGNNGIFKSLDSDFSGNSDLECIQVDDLDFSNNRWIGLKRDSGVQFSEDC
                     GANLSVNEFELTANTNIFPVPVIDRLTINSIYDIVAVEVLNLAGNTVLLSNENTESID
                     MQDLPSGLYLLKITYNEGVVYKKIIKN"
     gene            complement(19150..20850)
                     /locus_tag="KQA_RS19375"
     CDS             complement(19150..20850)
                     /locus_tag="KQA_RS19375"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177317.1"
                     /translation="MKYFHVLLGLFFSFLTAASAQTTDILTGLTKPRGIAINGDELYF
                     TELTANRILKIDLTQTNPSPVEVVTGLDTPKELVFNGNTLYVSEANRISRVDVTSSLP
                     ATRQDFFVGIEQPQGMLIHNNYLYTKGANNNVFKFNLDNPTIDVSLVFGANLIYDFVK
                     IGNDAYVTQENAIRKFDLTANTPSLGNVINSSQEPLLAGINVGMTAINNTIYFLQNPT
                     GRLLSFNINDPVGTFGQLLNISAVGDVTSYKGDLYISDFDNGKIIKYELPDTTPTTDI
                     AHYYSLDSQTVVDEIGNEDPTVVLSTVVSSGAINRSHAFDNADNITLFNFAPTSFTIN
                     FWFKTNDINKTQRIFHRGGYGGSAYDRYSYSLVYIPNQGFRLGLGSDAGSNAALIYAN
                     TSADLTDWHMITCTYDLSTQTARIYIDGNLEASDTSLQGIYANPNYQLFLEFSRYPLP
                     GSPQAIDGNLDEIGLWTRAISDTEVTTLYNETATLSIDDFDLTGARVELFPNPAKNFI
                     KVSNLNTSGQFKIYNLLGQPVKQGSIDNNQTIDISNLIKGLYLLKFKNDAKTLRFAKE
                     "
     gene            21262..21693
                     /locus_tag="KQA_RS0201120"
     CDS             21262..21693
                     /locus_tag="KQA_RS0201120"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177318.1"
                     /translation="MGDFTSHPNIDTDGDGEIQIAEAKAVEVLNLRNKGILDLRGIEY
                     FVNLKELYIEHNRLTSLDISKNKQLKELYAQGTLLTTLNIASNEKLEVADIRGGELEM
                     LEVDNCGNPHLRELILTDCFFTNLDKSKFPNLKIQFCNYID"
     gene            21847..23646
                     /locus_tag="KQA_RS19380"
     CDS             21847..23646
                     /locus_tag="KQA_RS19380"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator of chromosome condensation RCC1"
                     /protein_id="WP_010177319.1"
                     /translation="MKNNYFLLITLFLSVTLFGQSVVNIPDVNFKNALINHSPTIDTN
                     SDGEIQLTEAEAFSGSLAVSNKNISDLTGIGAFINITRLGCSGNNLSTINISNNKKMQ
                     FLACLENHLKSLDITNNLDLKALWINSNEMETLDLSKNLALQELSCFKNNLSRLDVSK
                     NLDLQIFYCYENNLTTIDISKNVNLKVLWCSNNDIKSLDVSKNMYLRELSCSNINLTS
                     LDISKNLELDRLSCSNNKLTALDLSKHTKLERLNASNNQLTRLNLKNGVNTDFEHSFL
                     NFRNNPDLTCIQVDDANFSNTNWSSIKDDTADFSEACDYVIVFPDANFKTALLNHDPV
                     IDTNDDGEIQISEAESAITLNIARANINSLEGIAYFVNLEELFCAINNLDAIDISQNV
                     KLKKLYCASNNLRELDIAKNTVLEELSFGFNGVKSIALTSTKLKLITATNGILEELLV
                     LRGTTYPDLKEIYLTQNNLTQLFLPAFPNLEFLSCADNKLTSLDLSSNTKIKEVYAFN
                     NLLTEVNLKNGNNENIDVTRGLTSFALNIDLDCIEVDDVAYSNANWQGIKDSATQFSE
                     DCGAGLSITDFELASNTSVFPIPVIDDLTINSN"
     gene            23636..23812
                     /locus_tag="KQA_RS19770"
     CDS             23636..23812
                     /locus_tag="KQA_RS19770"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_081483222.1"
                     /translation="MVTNYDIVSCEVLNLVGKTVLVANENPDSIDMEHLPSGLYLLKV
                     TYNEGVVYKKIMKK"
     gene            24140..25162
                     /locus_tag="KQA_RS0201135"
     CDS             24140..25162
                     /locus_tag="KQA_RS0201135"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177321.1"
                     /translation="MKKNYLIFFAHLLVLAIHGQGIVNIPDANFKDALLNHNPVIDTN
                     GDSEIQVSEAEAFLGRINIFAKNVSDLTGVEAFVNISGLNCGFNNLTEIDVSKNTEIT
                     FLSFGLNPIKQINISSNLKLEELLGNFSDLETLLMPNVINENLTDIFLNDTEISQLDT
                     TPFPNLNIISCINAKLNSLDVSNNTKLRQLLVQNNRLVSLNLKNGNNPFLLGFDRTAS
                     NFTNNPDLDCIQVDDADFSNTNWGTIKDSGAQFSEDCQGSLGIEELELASHTSVFPIP
                     VIDDLTINSKYNIVSCEVLNLIGKTVLVVNENTDSIDMGHFPTGVYLVKITYDEGVVF
                     KKVCKK"
     gene            complement(25229..25906)
                     /locus_tag="KQA_RS19385"
     CDS             complement(25229..25906)
                     /locus_tag="KQA_RS19385"
                     /inference="COORDINATES: protein motif:HMM:PF00196.17"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_010177322.1"
                     /translation="MTKFKNAASTIAVLKEKISNQGTDSLEDFLGFYHENDINTIELL
                     YLEEKGCEIYGKTLEEIRALGPAFLAEIMHPEDIERCVNLLTEFAKKGSEEETLIYNQ
                     RLKMVGDEDYKTYFTCVKADFTKSVFQAVTTAMTQIDDFYLEVNTVLESSKYIEENVS
                     FYTSFSKREKEIIKWVCNGKNVNEIADILFLSHHTVIKHKKNIYKKAGFDSKIQLIEF
                     ALNFNLI"
     gene            complement(25903..26574)
                     /locus_tag="KQA_RS0201145"
     CDS             complement(25903..26574)
                     /locus_tag="KQA_RS0201145"
                     /inference="COORDINATES: protein motif:HMM:PF00196.17"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_010177323.1"
                     /translation="MQNFSITEISRQILSGEKTIQEISDYLPCHIHTNSLDDFRILEA
                     DSTVLNHIDRTADELLQHGPELMIEMVNPDDLRNAIDANFKYLENLETQNHVAFFQRV
                     KFPKEKEEHCFYTRGRVLDDNRIINLSVPTHELKLFNHTVLDLFQNSSFIKRNLAVFD
                     SLTKKEVMLCQYFCQENSLKDIADSLHLSIHTIKNHKINIYKKLNVNNFYDFYYFCTK
                     FKIDK"
     gene            complement(27361..28458)
                     /locus_tag="KQA_RS0201150"
     CDS             complement(27361..28458)
                     /locus_tag="KQA_RS0201150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkene reductase"
                     /protein_id="WP_010177324.1"
                     /translation="MKLLEKVQLGGVNLKNRMAMAAMTRGRVDRNGLVGDITVEYYTQ
                     RASAGLMLTESIRISKEATGSPLTPGIFTDKQIEAWKKVTTAVHEKGGVIIAQLWHTG
                     RMGHSVDRNGKLPLAPSPIPIWGMQHFTSQGKKEYEIPQEITIPEIKQTIKDFGQAAK
                     NAIAAGFDGVQLHAANGYLPSQFLAESANQRTDEYGGSIPNKCRFVLEVMQELISSVG
                     SEKVGIKISPFHPYGDIILDDPSATYSYLIKELNKLDFAYVEIQKRSTFFPSPKHYAT
                     DNEIELFGRMIRHTVIANAGYDKDSAEAELEKGIAKLISFGTLYIANPDLPERFEKNF
                     RLNKPDRATIFGGGKHGYIDYPFCNNTPPNK"
     gene            complement(28742..29734)
                     /locus_tag="KQA_RS0201155"
     CDS             complement(28742..29734)
                     /locus_tag="KQA_RS0201155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bile acid:sodium symporter"
                     /protein_id="WP_010177325.1"
                     /translation="MKKLLEVLNKVGLDGFILMIGSMILLAYFLPQPGMIKEPVSLGQ
                     IANIGVSFIFLFYGLKLSIEKLKVGLSNWKMHIIVQLTTFLFFPLLVLAFRPFFVKTD
                     LELLWLGIFFLAALPSTVSSSVVMISIAKGNVPAAIFNASISSLIGVVATPLWIGLFI
                     ASATGSFDVSDIVLKLVLQVLLPVIIGISLNSRFGNIAKKYKKQLKYFDQAIILTIIY
                     TSFCKSFSEHLFASFSALELAGLAVGMMALFFTVFFCVGLLSKWFGFSNEDRITVLFC
                     GSKKSLVHGTVMSKVLFQHSTITGIVLLPLMLYHALQLIAASVIAQRMARRKEV"
     gene            complement(29794..30822)
                     /locus_tag="KQA_RS0201160"
     CDS             complement(29794..30822)
                     /locus_tag="KQA_RS0201160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018944366.1"
                     /note="catalyzes the formation of
                     tetrahydropteroyl-L-glutamate and methionine from
                     L-homocysteine and
                     5-methyltetrahydropteroyltri-L-glutamate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase"
                     /protein_id="WP_010177326.1"
                     /translation="MKKILPTSIVGSLPKPAWLAPPKKLWSPWNLEEDQLLEGKQDAL
                     RIALQEQQLAGVDIISDGEQTRQHFVTTFIEHLSGVDFKNRKTVKIRDRYNASVPVVV
                     DEVTRQKAVFVDDAKFLRKQTDKPIKWALPGPMTMVDTLYDGHYKSREKLAWEFAKAL
                     NEEARELQDAGVDIIQFDEPAFNVFFEEVNDWGIATLERAIEGLHCETAVHICYGYGI
                     KANNDWKKTLGSEWRQYEEIFPKIQSSNIDIVSLECHGSRVPFNLIELVRGKKVMVGA
                     IDVATNTIETPEEVADTLRKALDFVNIENLYPCTNCGMAPLSRNVARGKLSALSAGAE
                     IIRKELGI"
     gene            complement(30852..31856)
                     /locus_tag="KQA_RS0201165"
     CDS             complement(30852..31856)
                     /locus_tag="KQA_RS0201165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1852 domain-containing protein"
                     /protein_id="WP_010177327.1"
                     /translation="MKNTQNTIKTDFSFTLMSRRLDENYHPESNTRLTTNFANLARGV
                     DRQQNLRNALNMINNRFNALAHLDNPKGDRYHVELEIMTVTLNIDHKKSIDNLPMMEV
                     LKTNILDRKTNQYVEGVAGNNFSSYVRDYDFSILLIEYNKDKPKFTVPEKFGDLHGKL
                     YQSFVRSETYKEHFKQSPIICLSVSGNKIYTRTEFQHPVLGFEYLQNEYSLTDQYFSK
                     MGMKVRFFMPANSVAPMAFYHTGDLLKEYTDLGLISSISTMETFQKIYRPEIYNANSV
                     AGKIFQPSLKHEDYSLTRVEYDRVERSQLAIEQGKYCEEYFIKPYQYILEQWAADFDL
                     "
     gene            32083..32520
                     /locus_tag="KQA_RS18260"
                     /pseudo
     CDS             32083..32520
                     /locus_tag="KQA_RS18260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010521484.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
     gene            complement(32981..34891)
                     /locus_tag="KQA_RS19390"
     CDS             complement(32981..34891)
                     /locus_tag="KQA_RS19390"
                     /inference="COORDINATES: protein motif:HMM:PF12708.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010181713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iota-carrageenase"
                     /protein_id="WP_010177328.1"
                     /translation="MKTYLKIPHLKSVLLLVLINLMITPFFGQIDNENRFYRETFNNG
                     VSKNVITDYGATVNDNTDDSPAVRRAINDVSKQPNGGKIYFPAGEYRIKFVHLESNVH
                     LVFSPNAVIKLPENDNPWGAIFWVGSRNAVENVSIRGDGGKFTVNMDGANTDEICIFV
                     KVENVKNFKFENARVIENLTEQSAFVLGRGFNNQAPEGGIIKNIDVLNASYGYGCVQA
                     GKADRVLFKNLSSEGGIALRLEPANFETVGATDIVGRNIIGTNGNAAVMLSPHSAVGG
                     TVNINGVTSNSCSFGVRVERGFGDRGIGSFANNSRITGIQVNYGTTAQIRPNHRVFVP
                     CPLKSLTSSRPGPDGYSYIGPAIAPVIYDSNSFGVFFGTIGYNGFSNQPKLPIVGIND
                     KFPDANCNNNGGGGNNGNNGNTFVLTKRNASGFSIDGGNGGANQQNVYLWNRSTSNVN
                     QQWEEINRGNGFFSYRKKNTNFCLDGGTGGANGQTVKLFTCGTNNQNQHWRKVNINGR
                     FRLEKRNAPGFSIDGGNGGARQQNVYLWASSNTNQNQQWSFDAVSGAKSLDDKSPETI
                     LYPNPAQHTVSVSNIEEFHTVTIFNIEGAKVLSTPLNNNNLDVSLLANGVYLLELTGD
                     TFKRVERIVINK"
     gene            complement(35176..35925)
                     /locus_tag="KQA_RS0201180"
     CDS             complement(35176..35925)
                     /locus_tag="KQA_RS0201180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177329.1"
                     /translation="MNKVHLEKKPPNKSKTGIMLAGHFTTALIAKQKFPKGSLLYFLI
                     IVQLQDFLWFIFHYLGLEPTTPSDAFDATLTNMAVDMLYSHDLLPQLVWFIIVFAIGK
                     FLFKSTQIGLVSILLVAVHFILDFFSGHMHHLFGADTMEAGLGLYASSPYLAIFIEAI
                     FSTGALWYFFTEETKKGIIRTRKNKLAIIAVFGYGIIFMLLIATRSFREILGIPEFDL
                     GFNTNMPTLIFTYGVMLYCLNYFVPKFKTIE"
     gene            36378..37034
                     /locus_tag="KQA_RS18270"
     CDS             36378..37034
                     /locus_tag="KQA_RS18270"
                     /inference="COORDINATES: protein motif:HMM:PF07685.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_081483223.1"
                     /translation="MYPLSSLRFLHLFYSKDAFEIEKADIIIIPGTKNTLNDLHFLRK
                     QNIVQVILSHYEKGKKVIGICGGYQMLGQLIKDPHHVESDMNELSGLGLLPITTTLTK
                     EKKTVQQEFLFKNKKAICTGYEIHMGVTKGVKSSPLLKTKDGRTEGYVLDNNCWGSYM
                     HGILDNAVVIDDLLGSVSKNSPISYQEFKEKNYDLLADLLRDSLDMEYMYSQSKKQDD
                     "
     assembly_gap    37366..37433
                     /estimated_length=68
                     /gap_type="within scaffold"
                     /linkage_evidence="unspecified"
     gene            37791..38522
                     /locus_tag="KQA_RS0201195"
     CDS             37791..38522
                     /locus_tag="KQA_RS0201195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-nitrogen hydrolase family protein"
                     /protein_id="WP_010177333.1"
                     /translation="MKICIAQTEPIKGDILKNIENHKKLIMLSVKKGADLIVFSELSL
                     TGYEPELAQKLATTKDDQRFNEFQEISDVHKITIVIGLPTKNDQGTCISLILFQPNKP
                     RMTYSKAYLHPGEEKYFITGENLAPIPIGNHKVAFAICYETSITEHIEKAFNNKADVY
                     VASVLNTVSGVDKDIHRISEIAKKYTMLALMSNLVGESGGYDCAGKSSVWNKEGKLIG
                     QLDDTNQGIIVFDTATHQVMKVKDE"
     gene            complement(38595..40367)
                     /locus_tag="KQA_RS0201200"
     CDS             complement(38595..40367)
                     /locus_tag="KQA_RS0201200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-porphyranase"
                     /protein_id="WP_010177334.1"
                     /translation="MKLKSLLLFAFAMYLSSAIYAQRNDRGLNFGNTPLPNNLQSFAS
                     WDLITGLSDDFNHNNKNSAKFQDVWAQSYLPDPGFRGPGSTVWQGGNLVEVRNGRMEV
                     RARPGSGGLVNCGIVSSKRTIRYPVYMEARIKVSNIRNSSNFWMLNKCDNEEIDVLEC
                     YGGDPDEFYSKQMSTNFHLWHRRGGQSHAGAQTATNCGGQDLTDFTYQTFFTTSNNDF
                     WRNAFHTFGVYWASPTELEFYIDGQPRFDGQHFVPGRAARNLTGKFSDARLQCPNAAV
                     LNCTTEALLRNVQGQSGGGVPYPNRQFNDPTHIIIDTEAHAGRPVESVANLNNNNRNV
                     MLVDWVRVYRPNINGGGGGSTPPPPPPTANNDGAPIGSIISLRKSGGDRRFVSAVTEL
                     NNDLYANKTSVESNRQRFRVDRHRSGVVALYSLSARKYIQTNNSNQNVIVRARGNSDL
                     SWERFEWRNVGNNKVALRSLQVNKWVQAAWNQNNAALFPRGNAPLGWETFDWRRESGG
                     KILSSTEATETVAYPNPVLGGNDVFLEGINQGDTIIVRNSTGSALVNMVATDTTEVIP
                     TSNLASGIYFIQVNTGTSLKLIID"
     gene            complement(40752..44111)
                     /gene="secA"
                     /locus_tag="KQA_RS0201205"
     CDS             complement(40752..44111)
                     /gene="secA"
                     /locus_tag="KQA_RS0201205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="WP_010177335.1"
                     /translation="MGILDSVLKVFVGDKSKKDVKAIQPILDKIKKAEATLVNITNDE
                     LRAKTTAFKQIIIDAKADIVAQIDDLKVKANNTADIDAREDIYTEIDSLETKALEITD
                     KKLSEILPDAFAVVKETARRFTNNETVEVTASEYDRELSATKEYVTINDTNANWATSW
                     NAAGTLVTWNMIHYDVQLIGGVALHNGNIAEMHTGEGKTLVATLPVYLNALTGNGVHL
                     VTVNDYLARRDSEWMAPLFQFHGLTIDCIDNHRPNSEARRNAYNSDIVYGTNNEFGFD
                     YLRDNMSHAPEDLVQRKHNYAIVDEVDSVLIDDARTPLIISGPVPKGDIHEYDMLKPG
                     IASIVSLQQKFLTGVLAEAKKLIKEGNTKDGGFKLLQAYRGIPKNKALIKYLSEEGVK
                     QLLQKTENQYMQDNNRDMHLIDVDLYYVIEEKNNQIDLTDKGIAHISKEEDSDFFILP
                     EIAVEISKIEKLGLNAEEEAAKKEELFREYSVKSERIHTITQLLKAYSLFEKDVEYVV
                     MDNKVKIVDEQTGRIMDGRRFSDGLHQALEAKENVKIEDATQTLATVTLQNYFRMYHK
                     LSGMTGTAVTEAGEFWEIYKLDVIEIPTNKPIARDDRQDLIYKTKREKYNAVIEDVVK
                     IAQAGRPVLIGTTSVEISELLSRMLNMRKVKHNVLNAKLHQKEADIVAEAGNPGVVTI
                     ATNMAGRGTDIKLSKEVLDAGGLAIIGTERHDSRRVDRQLRGRAGRQGDVGSSQFYVS
                     LEDNLMRLFGSERIAKLMDKMNIEEGEVLQAKMLSNSIERAQKKVEENNFGTRKHLLE
                     YDDVMNAQREVVYKRRRHALYGERLKVDIANMLYELSESIAQGNNISQDYKNFEFELI
                     RYFAMPSPVTEQEFNSLNAEKLTGKVYHAALKHYQSKMEHTSAEVYRVIKQIYEDPNN
                     QFERIGVPFSDGIKSLNVGTNLEKAYNSEGKQIISDFEKNITLALIDDAWKTHLRKMD
                     ELKQSVRLAVHEQKDPLLIYKFEAFELFKSMLQGLNKEVISFLFKAELPSANPDDVQA
                     AEQHQQQEMQTQKEEIQNLEERTNQNRAIADAQHQQQQAPVETIVREEPKIGRNDKIV
                     IKNLMNGETKTLKFKQAIPLLEKGWVVVQKA"
     gene            complement(44280..44501)
                     /locus_tag="KQA_RS0201210"
     CDS             complement(44280..44501)
                     /locus_tag="KQA_RS0201210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003441576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2795 domain-containing protein"
                     /protein_id="WP_010177336.1"
                     /translation="MYWTLELASYLSDAPWPATKDELIDYAIRTGAPLEVVENLQAIE
                     DEGDSYDSIEEIWSDYPTDEDYLWNEDEY"
     gene            complement(44602..45171)
                     /locus_tag="KQA_RS0201215"
     CDS             complement(44602..45171)
                     /locus_tag="KQA_RS0201215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP:cob(I)alamin adenosyltransferase"
                     /protein_id="WP_010177337.1"
                     /translation="MKIYTKTGDEGFTSLYGGKRVPKSNDRIDAYGTIDELNSFIGLL
                     RDQEISITHKNFLTQIQIELFSIGSILATPHNNQKKKLNIQKISIEEIEALENEIDHL
                     DTSLNPMTHFILPGGHVTVSYCHVARSICRRAERLAYALHHHEPLEKEVLIYLNRLSD
                     YLFVLARKLSKELTVEEIKWIPKKTNKEV"
     gene            complement(45295..45825)
                     /locus_tag="KQA_RS19395"
     CDS             complement(45295..45825)
                     /locus_tag="KQA_RS19395"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177338.1"
                     /translation="MSVLLKKSYWLFLLKSTNEHGVHSPFVYNLVTRCFYKPIKTSPL
                     PKNTIKNTPKQLKSKHILLLDRIICYFKINKIAGDFKNNHPITHLIKHQKKIDTTSSS
                     NADLIFISKNTHIARQIDELQPNALAIIELPHENKKKWNAIKTHKNAHVVIDTYFFGF
                     IFNRNQQAKEEFFIRL"
     gene            complement(45954..47834)
                     /locus_tag="KQA_RS0201225"
     CDS             complement(45954..47834)
                     /locus_tag="KQA_RS0201225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010177339.1"
                     /translation="MINFVSVENVSKAFGERVLFENISFGINEGQKIGFVAKNGTGKS
                     SLLNIITKSAPSDTGQVVYRKGLKVAFLPQEPNLDPQLSIEETIFTGDNESLQAIEAY
                     EKAVLNPEDADAFQAAFDRMDQAQAWDFETEYKQILSKLKLDNLSLKVASLSGGQKKR
                     LALTNVLLSKPELVFLDEPTNHLDLEMIEWLEEYFAKEKITLFMITHDRYFLENVCNE
                     IVELDHGKLYNYRGNYAYYLEKKEQRLTAEATELSKAKHLFKKELDWMRRQPKARTTK
                     SKSRIDDFFEIKKKAHQRRADHQVTLEINMERMGSKIIEFHKVSKSYGDLVITNKFDY
                     VFQRGERIGIIGKNGTGKSSFLNLLTGIELPDSGKVITGETIKIGYYTQKGIKVKEGQ
                     KVIDVIREFGDYIPLKKGRQISAGQLLEQFLFDRKKQHDFVEKLSGGERKRLYLCTVL
                     IQNPNFLILDEPTNDLDIVTLNVLESFLLDFPGCLAVVSHDRYFMDKIVDHLFVFEGK
                     GVIEDFPGNYSDYRAYENSPKTKKEPEATITPEVKQHKNSWKKEQKNTSLSFNEQKEY
                     NKIERELKKLELQKKEIEQQFATENFEGDALIEKSKELGKITNAIEEKEMRWMELAEK
                     MG"
     gene            complement(48109..49227)
                     /locus_tag="KQA_RS0201230"
     CDS             complement(48109..49227)
                     /locus_tag="KQA_RS0201230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177340.1"
                     /translation="MQKKQPLRNIFFFMLLTGTIISVKSQTRKYSNEFLNIGVDAAAF
                     GKSNAVVASTNDVNSGYWNPAGLINIKDKQLALMHASYFANIANYDYAAFATPIDDKS
                     AIGVSVIRFGVDDILDTRALITSGGDITPIEELPRFSTADYAFTLSYSRKPFNKNFSY
                     GVNAKVIRRVIGDFATAWGFGLDAGLLLTSKNKAWKFGIMVRDLTTTYNSWQIEDGIF
                     DNDLGDDPRGNGSINALNNQEAPETTEITLPSVRMGLNKTFTINRDIFIDFEADGNFR
                     FAQTNDVISNASFSISPAFGFEANFRKLIFLRGGVGNFQKVKQFDNTNELGFQPNFGV
                     GFHYKGVSVDYALTDIGDQSVSLYSNVFSLRIDWSLFR"
     gene            49319..50065
                     /locus_tag="KQA_RS0201235"
     CDS             49319..50065
                     /locus_tag="KQA_RS0201235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine synthase"
                     /protein_id="WP_010177341.1"
                     /translation="MSLKKQIPNIITLLNLFSGCIAVYFACMNQLFLAAVFTALGIFF
                     DFFDGFFARLFNANSELGLQLDSLADMVTSGVVPGVFMFQLLLESSAINDSFPIENIG
                     GNVIEWVPFLGFFVTLASCYRLANFNIDTRQTSSFIGLPTPANTLLIISIGLVSMYQS
                     SGIIEVLMDNVWVLLSIVALSCYLLNAEVRLFALKFKNWNIKDNWVRYLLIISSLVLI
                     LLFKYLGITLTILLYVLLSLIFSGEETNGV"
     gene            50150..50222
                     /locus_tag="KQA_RS0201240"
     tRNA            50150..50222
                     /locus_tag="KQA_RS0201240"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:50183..50185,aa:Gln,seq:ttg)
     gene            50318..50833
                     /locus_tag="KQA_RS0201245"
     CDS             50318..50833
                     /locus_tag="KQA_RS0201245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177342.1"
                     /translation="MSNTIVYEDRSKRFDENMIKGRIAETIVEQMFIRMGYDIYRYGM
                     ENTVPGIIQDLYNCKPKEVSDEIRKMPDFIIKNPNDNSVYYVEVKFRADGKFLLKELG
                     KNYPYKNAYILVVSKKHIRCVLYSELEESGELLMKKEYLLGYREDFKTNREIILYFCE
                     LAKKYFSCLES"
     gene            complement(51083..52114)
                     /locus_tag="KQA_RS19400"
     CDS             complement(51083..52114)
                     /locus_tag="KQA_RS19400"
                     /inference="COORDINATES: protein motif:HMM:PF01381.20"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_010177343.1"
                     /translation="MDTNKEYNSLLISKIRIKRLELGLTQSHLANKIGISPITFSHIE
                     SGRREIKVFEVVKLCKYLNIKIDEVLEICYNKIKISHNSEITSNKKLKNKVISFTSFK
                     GGMGVSTLSIILANEISKDYKLLFIDSHYQNSCYDKRALDLEVFPNIKPLYSIASIET
                     KELAKYIDQKKKDYDYIIIDLPRFFYIPDYIEEITNQSDFVISPFKGRGMLKKPFKNN
                     KDYLKHIAEGRLDLFIEYRNLFKNNDTVFSLIPFLVKIEDDEFDDYCSDQEIVLIPET
                     FKEFPEHDLFCDTLNPISNLENAYYNPFIVETLKVIFHLKSLVGADLIMEDLKHKSNA
                     KWQKILDKS"
     gene            complement(52362..53474)
                     /locus_tag="KQA_RS0201255"
     CDS             complement(52362..53474)
                     /locus_tag="KQA_RS0201255"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3872 domain-containing protein"
                     /protein_id="WP_010177344.1"
                     /translation="MNLLFKQFNILIKYHFNTLLIATLSIFLLACEDESTIIDSFPFQ
                     ISVTGTNEALLSETIQNELIILPENLVDSTVFSFSYNADDKGHYKIDGTKIQENTIYD
                     LSIKSLDYTLEFVPTEEGEIEIEIFVDDNKKHSATAKVIYSVTKELTDFKFSFTPLKE
                     EVLFGERTSLNLNIEQTSDELLTYTMNISSNSNGEINWIGYSNLPETISNLSKGNYVF
                     DYIPTEVIEKNNFTVTIVASNGVTKTKTFDGLTAEPVEFDFSLSKTVITINSGSINDF
                     INVTLNRPSFATGYFYDLDYYLRISTTTENILFNNGKIVFGENILLDNFSGIQNETFS
                     YSLNYSGNVVPGEVIFTVFNNTGFEVSKTVTVKTDF"
     gene            complement(53493..54197)
                     /locus_tag="KQA_RS0201260"
     CDS             complement(53493..54197)
                     /locus_tag="KQA_RS0201260"
                     /inference="COORDINATES: protein motif:HMM:PF10626.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177346.1"
                     /translation="MKKLFFSIAVIAMAQGAFAQNETELQKQSEETLHFQLNRLQMQN
                     KQIENELKLLQKSYSTRSFRLMKKEKSRKTTYASFETIIGITDNEGLGYQANFSIEID
                     TDKNKGLEMGLYYDNNDLLAKELEIPSEVFILNLGYTKQLSFLSNKTSTITTRFTIGG
                     AVGAELLNDGKDKLSNGAILETEDGLIYGGYTGIFSLFKINNNLSAVFRNSNFFTTSD
                     VSLHKFIIGAGIRYHF"
     gene            complement(54214..55617)
                     /locus_tag="KQA_RS0201265"
     CDS             complement(54214..55617)
                     /locus_tag="KQA_RS0201265"
                     /inference="COORDINATES: protein motif:HMM:PF02534.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraG"
                     /protein_id="WP_010177348.1"
                     /translation="MKLDFLKPKTPPFYLKSGRFSKHYRINNLNRGAIAVGGAGSGKT
                     YSYINPLLSYCVKHKGCITFDPKGELTPLINGIAKQNEKPIINFSLDNNFNTINVLSL
                     CEDKSDIIEFSSYFLSGIVGIPKNDAAKYFFNSAKSILTGTILFLRKKHPKFCSIPHI
                     IALFLTANPEQIIKLIFSDEEAKRSAQVLSSVSGDKKLLGSMMSTFTAFFASLDVPRI
                     FRNLLSDTDLPLPNDPNNPSIINLIFNLQKRDIYSPIYSSIIGLILKKMNIPDQHESA
                     VIIDEFTVLSIPNFSNIPETARSNKIATCIAIQDFSQLVLKYGKEEASSIIANMGSQF
                     LFRTTSPETLDHFQKTLGKREVEKTSISEKQGGLSLDGPTHSYSSIERDILRREKVIN
                     YKAGMCTAIIAEGNERLIEGKRLNGNHYLKKIKPIPIQPQKNIDEQRAYEKVYSDINF
                     LLKKSTTTPTLTKKFNL"
     gene            complement(55614..56273)
                     /locus_tag="KQA_RS0201270"
     CDS             complement(55614..56273)
                     /locus_tag="KQA_RS0201270"
                     /inference="COORDINATES: protein motif:HMM:PF01076.17"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177350.1"
                     /translation="MSYAILRLNKIKSLSGSLGNHIDRCTSDGELCYPSNIQDRAILN
                     NIHWDKNGQSYTQKEWANYCKKTPFQDRIQNEIKSRYKIQKNIRKDAVKAIDYIMTSD
                     NAKMAEIFSDENLVQSWMKDNKTFLSETYGEENVLSMHLHLDETTPHLHAVIVPITND
                     GRLSAKEFINGRKSLAEQQTRYAELMEKYGMQRGEAGSKTKHEQLWKKDKPQHTQIYE
                     R"
     gene            complement(56378..56950)
                     /locus_tag="KQA_RS0201275"
     CDS             complement(56378..56950)
                     /locus_tag="KQA_RS0201275"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177352.1"
                     /translation="MIVDFKKSETQLKKQNMIPSRMKLQLLQLLVRNVMILFFPIAII
                     SGLFFLFAESLTTESLQCLKETNLRGKKAFYFLLRNLDFNLKNLSISLCNIVLFSFLK
                     FQKKYNWKDAFYKTSLLGVLQLIIYSCYSIAMSNKKQGIVLGEHDLLRIYFETDKIFY
                     AWYIPLGWIAIYYFILYTKKGGQIIHNRYF"
     gene            complement(56934..57707)
                     /locus_tag="KQA_RS19405"
     CDS             complement(56934..57707)
                     /locus_tag="KQA_RS19405"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177354.1"
                     /translation="MKNSLGQQAKIQMGLETEEERKKRIELKKEETKKSNQYFDSLKE
                     KNKPRPLTPIPTQWIKKQIWVEGKKYFASKGRYFNVDSENKLFLDIISRYFSDDIEFE
                     KITNGELRKGLLIYGECGTGKSSIFDIIQSISLKYDLKQIYFKNTSVHTVITEFNKES
                     KAYGNGGESVIEKYSRGTIHFDDLGTENQVQAWGIKEELFDRILQIRYNNFKNLGKKT
                     FVTTNLSIEKLEKRYSPQVKSRLYEMFNIIPLTGNDRRF"
     gene            complement(57704..58135)
                     /locus_tag="KQA_RS18290"
     CDS             complement(57704..58135)
                     /locus_tag="KQA_RS18290"
                     /inference="COORDINATES: protein motif:HMM:PF13730.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain-containing protein"
                     /protein_id="WP_010177356.1"
                     /translation="MEKSKPNYYAILPAEIRYDKRLSPAAKILFAEITALTNNHRICW
                     STNKYFEELYQVSKQTINNWLLQLEECGYIERFIYRADGSKEILHRYITIFSHPSKIN
                     LNRPIQEILNDNNTSINNTSNNYLKKKNSKRKFINANPRKK"
     gene            complement(58236..58538)
                     /locus_tag="KQA_RS0201290"
     CDS             complement(58236..58538)
                     /locus_tag="KQA_RS0201290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_010177358.1"
                     /translation="MSNPILYGFSKKDLEHTIELVVNRLRKTELIDESSANPEEDRLT
                     QTEAADLLGVSVQCLIKWKKKELIPYYKIGRTVFYSKKELLTQARKNSKLVKASRK"
     gene            complement(58677..59789)
                     /locus_tag="KQA_RS0201295"
     CDS             complement(58677..59789)
                     /locus_tag="KQA_RS0201295"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177359.1"
                     /translation="MYNIEYIKKMVTSLEWLDTNSEKETPEFYLVKGMIANLPFLDRI
                     KLLGSILGMPEDNDLLSLPFTPGHFNLFFDLEYCRIHPHTNELLIYDKLMLDEANYNY
                     SQGDDSALEAFNWLHQPENIDHLEINNYHVRIQQKIVSKIYLTGNNFNNGETDPDSIL
                     EILYGITTGLQYRKFLLKKYKEPIVNHSSKYMHPTIANDFLTLENKKITNKSLLDLTE
                     STIWELLTQLQSNEDLKSNQDYLTQIINIDTSTISKQNLSKFIKRFFEEYCTLLPINS
                     NDFFDFLFVKQSFNHERLDLNRDQLEKIMEMFLFLSEKNALKKSKKIQIIRNLHSYFN
                     TKLSIPMLKKIYNKSTTHPKKNTLLNYSMSWKELSI"
     gene            complement(59792..61027)
                     /locus_tag="KQA_RS0201300"
     CDS             complement(59792..61027)
                     /locus_tag="KQA_RS0201300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_010177360.1"
                     /translation="MQVSFTLRKDKINKDGFIPVRMIITLNGERIRRNVKSVRTKQKD
                     WKNQRVKANLKNEDYNFHIEFNKELDELENKLKLIHRHALLNNIPLTKEYVIDKLEND
                     SINSNSIAPSFFESFQEFIDTNKSTKANGTIKKYISCKNFIKDFDVAKKYNLRFDNVD
                     VNFYEDFRDYAFEERNTLNNYYGRIISVLKTFMNWSYERKYHENLEFKKFKTVSNTIE
                     VIYLTMDELMKLYNYEFESKRLEHVKDFYCLGCFSGLRFSDIKQLKPSNIYEDYLKLN
                     VQKTKTIDHKIPLNAFSKAILNKYKDTLYEPIPKISGQKFNQYIKECCKIVGIDTPVN
                     TTRYIGQKRVDKVFPKHQLITSHTARKTFVTNSLILGMKEMVVRNITGHKDESSFKRY
                     VEIADDFKKNEMDNTWNKI"
     gene            complement(61082..61381)
                     /gene="higA"
                     /locus_tag="KQA_RS0201305"
     CDS             complement(61082..61381)
                     /gene="higA"
                     /locus_tag="KQA_RS0201305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module antidote protein, HigA family"
                     /protein_id="WP_010177361.1"
                     /translation="MEKQMNVHPGEMLREDFLKPMGITAYKLAKSIGVSDSRVGKIVR
                     EEMGISGEMALRLSKFFGNSPEFWSNLQSFYEIRKAQIEKEDDINKIQPYTKQAV"
     gene            complement(61394..61675)
                     /locus_tag="KQA_RS0201310"
     CDS             complement(61394..61675)
                     /locus_tag="KQA_RS0201310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007656040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid maintenance system killer protein"
                     /protein_id="WP_010177362.1"
                     /translation="MIKSFGDKETEKLFAGHSSKKIDASIQKKAFRKLVQIHSSKDLN
                     DLTIPPGNRLHQLQGNLKEYHSISINMQWRIIFKWNNHNAYDVEIIDYH"
     gene            complement(62063..62890)
                     /locus_tag="KQA_RS0201315"
     CDS             complement(62063..62890)
                     /locus_tag="KQA_RS0201315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_010177363.1"
                     /translation="MKNILVPTDFSSDAYNALSVAAQLARKNDSTIHLLHLLELPSHI
                     NDPILGSNGNFPEAILFMKNIHSKFKELIDSPLLEGLKTHEDVNTQPIPQGIIKSCND
                     NEIDFIVVGSHGKEAFSDLFVGSNTEKIVRTANTPVLVVKEPTNIKNVKNIVFACNFK
                     DEEVRSLNALHEFSEEVNAKIHLLYINTPRNFKTTHAIEEEMKAFLSKTPFKKDNLHI
                     YNDTTIERGVLNFSNDINANLICVDVHERKGLSHFINGSISEDLINHTQIPILTYKL"
     gene            63049..63513
                     /locus_tag="KQA_RS0201320"
     CDS             63049..63513
                     /locus_tag="KQA_RS0201320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177364.1"
                     /note="in Streptococcus pneumoniae this gene was found to
                     be essential; structure determination of the Streptococcus
                     protein shows that it is similar to a number of other
                     proteins; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome assembly cofactor RimP"
                     /protein_id="WP_010177364.1"
                     /translation="MFKQKVESLLEEALVERSNLFLISFQITGANIIQVILDGDEGVS
                     VDDCIEISRAIEHNLDREEEDFSLQVMSAGITEGLVHIRQYPKNIGRTLNVVTEKEEI
                     EGELIATTADDFTLQWKAREPKPVGKGKVTVQKTKVIPYGEVKKAHVVVKFN"
     gene            63522..64754
                     /locus_tag="KQA_RS0201325"
     CDS             63522..64754
                     /locus_tag="KQA_RS0201325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008638810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination
                     protein NusA"
                     /protein_id="WP_010177365.1"
                     /translation="MENIALIDSFSEFKDDKSIDRVTLMSILEETFRSALKKKYGSDD
                     NFDIIVNPDKGDLEIWRNRIVVDDGEVEDENQEISISEARKIEPDFEVGEDVSEEVKL
                     IDLGRRSILALRQNLIAKIHEHDNTNLYKQFKELEGEMYTAEVHHIRHRAVILLDDDG
                     NEVILPKEKQIPSDFFRKGENVRGVIEKVELKGNKPSIIMSRTAPSFLEKLFESEIPE
                     VFDGLITIKNVVRAPGEKAKVAVDTYDDRIDPVGACVGVKGSRIHGIVRELGNENIDV
                     INYTNNVQLYITRALSPAKVTSVKINEETKRAEVMLKPEEVSRAIGRGGHNIRLAGML
                     TGYEIDVFREGVEEDVELTEFSDEIDAWIIEEFSKIGLDTAKSVLEQDVADLVKRTDL
                     EEETVNEVMRILKSEFDD"
     gene            64811..67666
                     /locus_tag="KQA_RS0201330"
     CDS             64811..67666
                     /locus_tag="KQA_RS0201330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="WP_010177366.1"
                     /translation="MAGVNNMRLNKVLREFNISLDRAVDFLSAKGHEIDARPTTKISA
                     EIYQLLTDEFQGDKSKKVASKEKGEEKRKEKEAIRIQIETEQEEKRKKAQSNEVVKAK
                     AKLDGPKQVGKIELNKPNQEAAPKTSSKPEPVTETEKEAPVKKEVPVKKEVATPKKEV
                     EKAPEEPQVVSNRPKKQGIKITGQAPIAKPVKPKVAKVDEEKAKAAPAAKQAAASPAA
                     TSGPKHAEVGDAPSEKVKTQYKKLDGPNFTGQKIDLSQFKKPEKKKDDKSSSNDANKR
                     KRKRISKGPNQGQGGGRGGNNRGGGKFQPRGKRAPIVKAEPTEEEVQKQVRETLEKLQ
                     GKSGKGKGAKYRRDKRDQHRQKTEEDQAAQAAESKVIKVTEFVTASEVATMMDVSVTQ
                     IISACMSLGMMVTMNQRLDAETLTIVADEFGYTVDFVTADIEQAIEEVVDAPEDLLER
                     APIVTVMGHVDHGKTSLLDYIRKENVIAGESGGITQHIGAYGVQLDSGQKIAFLDTPG
                     HEAFTAMRARGAQVTDIAIIVIAADDDIMPQTKEAISHAQAAGVPIIFAINKVDKETA
                     NPDNIKTKLAAMNLLVEEWGGKIQSHDISAKTGLGVKELLEKVLLEAELLELKANPNR
                     IATGTVVEAFLDKGRGYVSTVLVQSGTLKVGDYLLAGKNSGKVKAMQDERGNRVLEAG
                     PSTPVSVLGLDGAPQAGDKFNVMDDEREAKDIASKRAQLHREQSVRTQRHITLDEIGR
                     RIALGDFKELNIILKGDVDGSVEALTDSFQKLSTDEIHVNIIHKAVGAITESDVLLAS
                     ASDAIIIGFNVRPAGNARMVADKEEIDIRMYSIIYDAINDLKDAMEGMLSPEMKEEIT
                     GTAEIRQTFKISKVGTIAGCMVLTGKIFRNNQIRLIRESVVIYTGELAALKRFKDDVK
                     EVAKGYDCGMQVKNYNDIKEGDIIEAFQEVAVKKKLK"
     gene            68080..68574
                     /locus_tag="KQA_RS0201335"
     CDS             68080..68574
                     /locus_tag="KQA_RS0201335"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177367.1"
                     /translation="MKKINLLPLVLLALLLSNCSNDDDNSNSKEMDFSGDWIGTKFLV
                     NEAYDFNNDGIPSRDYKIELPCLIQNITLNPDGTGLFKANIHGQAEGQTTPFPLTCVE
                     YEENPMTWSLNEEETKILLRFSETVVEEFPIVSEVVIERFSESLLDDTIGIPGKVVYE
                     KQTK"
     gene            complement(68682..69083)
                     /locus_tag="KQA_RS0201340"
     CDS             complement(68682..69083)
                     /locus_tag="KQA_RS0201340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SPOR domain-containing protein"
                     /protein_id="WP_010177368.1"
                     /translation="MKDRFNFFSFLFLLLSIASQAQNSSDNANSETNSPATININVDP
                     NIEKLVKTKFSENNKDNYKIQLYYGNLNKAHAVLSNFNTKFTDWPGKIEYETPNYKVW
                     VGNFQTRLEADRALMKISKNFPHAFIFKPEK"
     gene            69304..70596
                     /locus_tag="KQA_RS0201345"
     CDS             69304..70596
                     /locus_tag="KQA_RS0201345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c"
                     /protein_id="WP_010177369.1"
                     /translation="MRQVKHRNSVSKLLLLGLAFLLTFSTTTTAFAQADAGKGKELFN
                     SLCAACHKRYKKATGPALFGVTERHSTEWLYKWIKNSTALIASGDAEAIEIYEQYNKT
                     PMNSFPQLSNADIDNILAYVMEPKAAPAPGAVPVGGAQKATDDSGSGSVNSWVLGLLA
                     VVLLVLVGVLFMVNKTLRQFAKANNIDLPVKEERKPIWKAFIENQFLLLVSAVFLLLL
                     SGYFVYGYLMQVGVDQGYEPVQPIHYSHRIHAGDNKIDCKYCHSSARVSKHSGIPSLN
                     VCMNCHKSIGEVAEATQAEGLAEYGVDYNKQIQKLYKAVGWDADKQAYTGKTEPVKWV
                     RIHNLPDFAYFNHSQHVMVAGVACQKCHGPVEEMEIMYQHAPLTMGWCINCHRETNVK
                     VEGNAYYEKIHEELSKKYGVDKLTAAQMGGLECGKCHY"
     gene            70695..73790
                     /locus_tag="KQA_RS0201350"
     CDS             70695..73790
                     /locus_tag="KQA_RS0201350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinol:cytochrome C oxidoreductase"
                     /protein_id="WP_010177371.1"
                     /translation="MSSNKKYWKSVEELSDSSMVEALKQNEFSEDIPVEEFLGDKEML
                     DESSTSRRDFLKYVGFSTAAATLAACEGPVVKAIPYVVQPEQIVPGVANYYATTIADG
                     FDFANVLVKTREGRPIKIESNRLAGANGAANARVHASVLSMYDNTRLKTPQIGGKSTD
                     WAKFDKQLASKLSGVSGKIVLLTQTFASPSTDKLIGEFASKYPNVSHVIYDSVSNSEA
                     LAAYEQVYGVRGLADYDFEKASTIVSVGADFVGDWQGGGYDAGYAKGRVPQHGKMSRH
                     VQFEANMTLSGANADKRIPTTPSQQKQVLAALYGYVMGYAVNASLPAPINEAAKKAAQ
                     QLKAAGSKAVVVTGIQDKDAQVIALAINNKLGSKVFNAERPKLTSQGDAAKVNALVAD
                     MNAGKIGALLIAGVNPVYSLPNSKEFVSGLKKVGVTVSFASSNDETAALCEFVATTPH
                     YLESWGDVEINKGVYSLVQPTIRPLFKTRQFQDTLLQLIGSGLTYDAYMKNVWKSSIL
                     GGASFNKALHDGVFKTAVVSSVAAEGDVEEGAEAAAFTSSFATSVRSLTSAKAKGLEL
                     TLYTKTAMGSGNQAVNPWLQELPDPLTRASWDNYLTVSKADAASLGLENKNVANGALN
                     GSYATVTVGGATLENVPVIIQPGQAKGSVGLALGYGRKQGLKEEMQVGVNAFSLYQNF
                     NNVQSVKVDKAGGEHEFACVQLQKTLMGRGDIIKETTLEIFNTKDKPVYNPTPMVSLD
                     HEETPVTSPDVDLWDEFDRTIGHHFNLSIDLNACTGCGACVVACHAENNVPVVGKSEV
                     RRSRDMHWLRIDRYYSSEETFEGDNETKDGFDGLGDSLSGFGELEVASENPQVAFQPV
                     MCQHCNHAPCETVCPVAATSHGKQGQNHMAYNRCVGTRYCANNCPYKVRRFNWFLYNQ
                     NDEFDFHMNNDLGRMVVNPDVTVRSRGVMEKCSMCMQMTQKTILDAKRDGRVIKDGEF
                     QTACSNACVSGAITFGDINDKSSKVAKSLEGDRMYHLLEHVGTKPNVQYQVKVRNTKE
                     A"
     gene            73824..75272
                     /locus_tag="KQA_RS0201355"
     CDS             73824..75272
                     /locus_tag="KQA_RS0201355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_010177372.1"
                     /translation="MSHYEAPIRRPLVTGDKSYHDVTLDVVAPVEGKANKQWWIVFSI
                     AFVAFAWGLGCMTYTISTGIGTWGLNKTVGWAWDITNFVWWVGIGHAGTLISAVLLLF
                     RQKWRMAINRSAEAMTIFSVMQAGLFPIIHMGRPWLAYWVLPIPNQFGSLWVNFNSPL
                     LWDVFAISTYLSVSLVFWWTGLLPDFAMIRDRAVTPFTKQIYSVLSFGWSGRAKDWQR
                     FEEVSLVLAGLATPLVLSVHTIVSFDFATSVIPGWHTTIFPPYFVAGAIFSGFAMVNT
                     LLIIMRKVCNLENYITLQHIELMNIVIMLTGSIVGVAYITELFVAWYSGVEYEQYAFL
                     NRATGPYWWAYWSMMTCNVFSPQFMWFPKLRRSIMFSFFISIVVNIGMWFERFVIIVT
                     SLHRDYLPSSWTMFSPTFVDIGIFIGTIGFFFVLFLLYSRTFPVIAQAEVKSILKSSG
                     EKYKKLREAGKPTYERAEGIVELLADSQDDHH"
     gene            75292..75819
                     /locus_tag="KQA_RS0201360"
     CDS             75292..75819
                     /locus_tag="KQA_RS0201360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3341 domain-containing protein"
                     /protein_id="WP_010177373.1"
                     /translation="MASKVVHAYYLDDEVLMDAVKALKIKHYHIEEVFTPFPVHGLDK
                     LMGLPHTRLAICSFLYGLVGLTVAVTMMNYIMIEDWPQDIGGKPSFSYIENLPSFIPI
                     MFELTVFFAAHLMVITFYMRSKLWPFKKAENPDERTTDDHFLVEVDASHTNVDELTAF
                     LKDTGAVEINLKDKE"
     gene            75824..76612
                     /locus_tag="KQA_RS18295"
     CDS             75824..76612
                     /locus_tag="KQA_RS18295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177374.1"
                     /translation="MRTLINSLFAFAAVALVTSCNSKKKPNYQYFPNMYESVGYEAYS
                     SHEVFADNNTSEALLPVEGTVKRGWLPYDYTNSPAGYASAKAGLKNPLPYTKENAAKG
                     KALYDIYCAICHGGKGNGKGTLVKREKILGVPSYDDPGRNITAGSIYHVMYYGINSMG
                     SYAAQTSIEERWQIAQYVESLKASLEGKKPRIDKVSGSKSDVSIVDALLANTEGYYSS
                     DVEFEGEFDEHSEIKEDVKDKVSYSKKDLLGGKSHHSHKEAGKK"
     gene            76642..78027
                     /locus_tag="KQA_RS0201370"
     CDS             76642..78027
                     /locus_tag="KQA_RS0201370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinol:cytochrome C oxidoreductase"
                     /protein_id="WP_010177375.1"
                     /translation="MYTLSKNLKLIPIILMVVGAIGLAIGFTTTPSTIEEVKEQLASH
                     HDAHGAAHAPAAAHGAHDKAEHGHGHDTHKAADTHGAHAAKSHDAHDSDKHYEHVLHQ
                     LQNKPWAALYVAAFFFFMIALGVLAFYAIQFAAQAGWSPLLLRVMEGITAYLLPGGII
                     LFVILALSGFHMNHLFVWMDPEVVAHDELIQGKSGWLNVPFFLIRAAIYIGVWSLYRH
                     FAVKYSRNQDESPEGNVWYKKSFKLAAVFLVFFIYSESMMSWDWIMSFDPHWFSTLFG
                     WYVFASLFVSGITVIALVTIYLKSKGYLEQVNDSHIHDLAKFMFGISVFWTYLWFSQF
                     MLIWYSNIPEEVTYFITRINDFKLPFFGMLIMNFLFPILLLINSDYKRINWLVVMGGI
                     VILLGHYIDVFNMVMPATVGKSWFIGISEISAVLLFLGIFIYVVFNALTKAPLVPKGN
                     PLLEESKHFHY"
     gene            78061..79119
                     /locus_tag="KQA_RS0201375"
     CDS             78061..79119
                     /locus_tag="KQA_RS0201375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="WP_010177376.1"
                     /translation="MTIFLILLVVALLGITFWQLSKILELSQGSADNSQVANDKDNSM
                     QGKLMLAFVGFLYFLTVWCFVKYDSYFLPEAASEHGTDYDRLMMISVVLIMFVQIITQ
                     GLLHFFAYKYRGKKENKATFFADSNLLEIIWTAIPIVTLAALIIYGLYTWVDIMSIDD
                     DEDALVVELYAYQFDWRARYAGADNELGKANVRFIEGVNILGVDASDNYAQDDIIVNE
                     LHLPVGKKVIFKMRSQDVLHSAYMPFFRAQMNVVPGMITEFSYTPTKTTEEMRTSEFM
                     VEKVETINTIRKAKSKDLLAKGEEALEPYEFDYYLLCNKICGASHFNMQMKIIVESEE
                     DYNNWIAEQKTFRQVVSK"
     gene            79229..81016
                     /locus_tag="KQA_RS0201380"
     CDS             79229..81016
                     /locus_tag="KQA_RS0201380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome-c oxidase"
                     /protein_id="WP_010177377.1"
                     /translation="MSADGHGHHKETFITKYIFSEDHKMISKQYLITGLLMGIIGIAM
                     SILFRMQIAWPEQSFAIFEVLLGKWAPDGVMDPNVYLALVTIHGTIMVFFVLTAGLSG
                     TFSNLLIPLQIGARDMASGFLNMVSYWLFFLSSIIMVFSLFVEAGPAAAGWTIYPPLS
                     ALPQAMPGSGMGMTLWLVSMAIFIASSLLGSLNYVVTVINLRTKGMSMTRMPLTIWAF
                     FVTAIIGIVSFPVLLSAALLLIMDRGFGTSFYLSDIFIKGEVLHNQGGSPVLFEHLFW
                     FLGHPEVYIVLLPALGITSEIIATNSRKPIFGYRAMVGSIIAIAFLSTIVWGHHMFVS
                     GMNPFLGSVFTFTTLLIAIPSAVKSFNYITTLWKGNLQFNPGMLFSIGLVSTFITGGL
                     TGIILGDSTLDINVHDTYFVVAHFHLVMGISALYGLFAGVYHWFPKMYGRMMNKNLGY
                     VHFWVTAIGAYGVFFPMHFVGMAGLPRRYYTYTNFPYFDDLADTNVLITVFAIITAAA
                     QLVFLYNFISSIFYGKKATQNPWKSNTLEWTTPVEHVHGNWPGELPTVYRWAYDYSKT
                     NADGEYVIAGQDYAPQVVPLQENEEELHH"
     gene            81126..82148
                     /locus_tag="KQA_RS0201385"
     CDS             81126..82148
                     /locus_tag="KQA_RS0201385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013070095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction branch migration DNA helicase
                     RuvB"
                     /protein_id="WP_010177378.1"
                     /translation="MNSNLDATGENFTPQEHDIERALRPLSFGDFAGQSQVLENLEIF
                     VKAANMRGESLDHTLFHGPPGLGKTTLAHILANELGVGIKITSGPVLDKPGDLAGLLT
                     NLEPRDVLFIDEIHRLSPVVEEYLYSAMEDFKIDIMIESGPNARTVQIHLDEFTLIGA
                     TTRSGLLTSPMRARFGIQSRLQYYTTELLAGIVERSASILNVPIDERAAFEIAGRSRG
                     TPRIANALLRRVRDFAQIKGNGSIDIEISRFALKALNVDAHGLDEMDNKILTTLIDKF
                     KGGPVGITTLATAVSESAETIEEVYEPFLIQQGFIMRTPRGREVTELAYTHLGKTRGS
                     VQGGLF"
     gene            complement(82220..84760)
                     /locus_tag="KQA_RS19410"
     CDS             complement(82220..84760)
                     /locus_tag="KQA_RS19410"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177380.1"
                     /translation="MKNLLLFLSMTVCLFTTGNAQIIDFPDPNFKAALLEITYNDNGT
                     WYSLDRNNDGQIDSQEASYIKRINLNLKNLTSVKGIENFTKLEELSLFSNNIQEIDIS
                     NNKLLQKFNIGKNPITNLDVSQNINLKELIISITQISSIDITKNVKLEELAAHEANLS
                     VINLSKNILLKNLSLFSNNFSQIDVSNNSKLESLFLSNNIITELDVSQNPELKTLYVR
                     NNQLTNINITNNPKLERLNIGINQITELNVNNNTLLELISAGQNQISTINVTNNKELI
                     YLYLNNNKINTINLSENTKIQYLHLNSNLLETIDVRKCQLLNFHFDSNRNLKKVYMTG
                     QPFQFRANGEINIRLYNNRQNLEFICADQQYLSAIYELLKEANQTDVLLSNDCETPHN
                     RISGSVTYDNESDGCDNQDEAFTESVSFSLAGPAGFYTVFPDREGEYTFHVPDGNNYL
                     MFNNIANSAYFTFFPTIIFDPINDSFNIPEQIDSITTDFCIQPVGVFNDLEISIIPLT
                     RARPGFSAIYKVTYKNIGTTTQSGEVTLTYQNDVLTYSTASPTIDSNTNGLLTWSFTN
                     LAPMQSKDIIVTYRLNTPTDSPALNNGDILNYTAKVTASLDEETPENNIAKLTQTVVN
                     SYDPNDKTCLEGDILDPDDVGEYLHYLIRFENKGTAEAVNIRVQDDIDTTKLDIKSFS
                     PLNSSHLFTTTVTNNKVVNFHFNNINLPFDDANNDGYVLFKIKSKDNLVEGDQIVNGA
                     GIYFDFNPPVITEDEIVTVKREVIEVPTFSDYFSLTPNPTTGIINLELLDTNIKPTTI
                     TLYDINGNIVGFFPGIMRTMNISYLFPNTYFVKIQTNKGLFTTQLIKL"
     gene            complement(85166..86449)
                     /locus_tag="KQA_RS0201395"
     CDS             complement(85166..86449)
                     /locus_tag="KQA_RS0201395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen translocase"
                     /protein_id="WP_010177382.1"
                     /translation="MPGIKNYTPNKQLLKVMSINSIAVLVRLVTGFILSKAIAIFIGP
                     QGLGIIGNLRSFINSIQTIASLGFYNGVVKYVAEHKNNIKELSKILSTSYYLGFIAML
                     GTSMILYFFAPFWSSYVLNSSDYAHVIKILAAGISLMIVDYFCLAIINGFSRYKVYTI
                     LNITTTVFSLIVTVILLWQYRLEGMLYAIVITPALALFITLIIIFKQKSFVQLLKASN
                     ISWDYSKKLIEYSLMALLTAVIIPPTIIAIRNHIVDVEGLTQMGYWEAMNRISNYYLV
                     FVTSLLSLYLFPKLSAVKTTKQFKQEIFSFYKTLMPLVIIGLLILYFFRVFFIKLLLT
                     SEFLPMQRLFSWQLTGDFFRILSSVLAYQFMAKKMTKSYVFTEILSAVIWYFSSIYFI
                     NNYGYEGAAIGYLVCYSSYFFVLVIWFRKYFFTKE"
     gene            complement(86437..87555)
                     /locus_tag="KQA_RS0201400"
     CDS             complement(86437..87555)
                     /locus_tag="KQA_RS0201400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DegT/DnrJ/EryC1/StrS family aminotransferase"
                     /protein_id="WP_010177384.1"
                     /translation="MRIPFLNLHKLNKRFENNFKSQFDTFLTSGHYILGTKLTEFENA
                     FASYCNVSFCIGTGNGLDALTLILKAYIELGKLNIGDQVIVPANTFIATLLSVKQAGL
                     IPVLIEPDEDSFIINVRNVQQKITPKIKAIITTHLYGQVYGMDELKEFCSNAQLLLIA
                     DAAQAHGAIDQNGNKAGSIAHAAAFSFYPSKNLGALGDGGAITTNNTELANCIKKLRN
                     YGTSEKYRNELIGINSRLDELQAAFLIEKLNLLDDDNNKRREIALRYSNEITNENIKL
                     PFWNGSKNHVFYVYVIRVKNRINFCNYLNENQIGHMIHYPIPPHKQKALTNEFKNQSF
                     PITEKISNEIVSIPLNPILEVSEIDYIIQVLNNYTCQE"
     gene            complement(87583..88692)
                     /locus_tag="KQA_RS0201405"
     CDS             complement(87583..88692)
                     /locus_tag="KQA_RS0201405"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177385.1"
                     /translation="MKFKFSILHISLIVPISIFLGMIITQYKLFPYNQLRNINQNIKL
                     KILKKNAYDVTDLHVPNLDSILSVTKDNYTEIRAELRKTIFGNKTSSYKIKKNIFDKD
                     YNNLENLANIDKVYIEQSYHINSIAYIFYPKKSNGKSFIYHQGHRGNFLLGKKTIHFL
                     VKQGFTVAALDLPLVGFNNTPSIYLKKFGNVVLNNHKFMEHLDDPISFFINPIINILD
                     ILESKGYNEINMIGISGGGWATTIAAAIDERIKNSFPVAGTYPMYIRFQDPYLNYGHF
                     EGAHSALFKKVNYLDMYILSCLGENRKQYQILNLYDPKCCSGYMYKSYASFVEEKVKK
                     LSPSSEFKVIIDSTHFEHKISEFSHQIIEKKLFKK"
     gene            complement(88682..89632)
                     /locus_tag="KQA_RS0201410"
     CDS             complement(88682..89632)
                     /locus_tag="KQA_RS0201410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177386.1"
                     /translation="MIQQYTVKKYNKTHYQSWNTFIENSKNSTFLFHRDFMEYHNDRF
                     EDHSLLVLRKQTIVALVPANKNDTTFYSHQGLTYGGLLLLKSIGVTKVETIFLTIIEY
                     LKRNQFSTIRIKTLPVFYHKAPSFELESLFLKLGAKIFRREQNFAIDYNLPFEIHKTK
                     LKNYKKNQHLNFKIIETDNFTDFWEEILKPRLKTKHNAKPVHTESEILFLKSKFPNNI
                     KQFNIFLENKLLAGITIFKTDTVVKSQYGATTNDGEKLRALEFLFIYLIKKYKSEGYK
                     FFDMGIIAGNISLLKQKEELGCNQYLQDFYQLSIDQTNEV"
     gene            89825..91123
                     /locus_tag="KQA_RS0201415"
     CDS             89825..91123
                     /locus_tag="KQA_RS0201415"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177387.1"
                     /translation="MFKVMIKKITFLFYILFFIFNVVVVIDKGYVFTYDTASYLYIRP
                     NVQPAYSIFLNIVKRIFGINYKEATIGIQLLMSYLTMLYFSEVLKKYFKFNSVVMILL
                     FMLLTYPIYGSYGMCNKLVTKSLSTTFFLFFMASSVKWFFTKKNKHIFFMITFLVLLQ
                     LTRAQFLSISIALVLFVFYMWSLKELKKKMILVVLILSIPLISGLLEKTIYGVFHGHY
                     TSRQLGNVSISTLPFYLSELQDYKLMPDEEVVQYFRCVHGSLEEKKLLLCQLPKNSSL
                     KEKHQFYHDNYPKIMNQTIEYEAKSMYRGKEMSYAASYKNVDRIVGKTLIPLFMARPL
                     AWSEMFYMNLAFPYYSIIPVIFLILLVSYLFFKKKSKILQFQGLIYFFSLLILGNLFL
                     ISISLHCIRRYFMYYDIVFALLALLLLCNFRPIKKYIMQV"
     gene            complement(91197..91787)
                     /locus_tag="KQA_RS0201420"
     CDS             complement(91197..91787)
                     /locus_tag="KQA_RS0201420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177388.1"
                     /translation="MKNLFFSSLLTLVTLFIVSCSGDDAGAPIKPVIDLVDENLVGKW
                     KLTNFEVSNGTVDLKVDETTIEIPFTTEGSEFNTTALFETTPNKVTFDGTFKANTNFV
                     TPLMINQPTTREDTFESSKILGGTSTLNDWSISEGDSVIAGSKAEIIKFTKNEIQYKL
                     DIAQTSFISIIEEGFDLNGFTTTNPKGQIIVTLEKI"
     gene            complement(91871..93673)
                     /gene="typA"
                     /locus_tag="KQA_RS0201425"
     CDS             complement(91871..93673)
                     /gene="typA"
                     /locus_tag="KQA_RS0201425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translational GTPase TypA"
                     /protein_id="WP_010177389.1"
                     /translation="MSNTIKNIAIIAHVDHGKTTLVDKIMYHCQLFRENENTGDLILD
                     NNDLERERGITITSKNVSVTYKGTKINIIDTPGHADFGGEVERVLNMADGVLLLVDAF
                     EGPMPQTRFVLQKAIDLGLKPCVVVNKVDKENCTPDEVHEKVFDLMFELGAEEWQLDF
                     PTVYGSAKNNWMSTDWKNQTENIEPLLDMVLEHIPAPKFDEGTTQLLITSLDFSSFTG
                     RIAIGRLQRGSLVEGQQVSLVKRDGSILKSKIKELHSFEGLGRKKVSEVQVGDICALV
                     GLEGFDIGDTVADIENPEALKTIAIDEPTMSMLFTINDSPFFGKDGKFVTSRHIKDRL
                     TKELEKNLALRVNETDSADKFLVFGRGVLHLSVLIETMRREGYELQIGQPQVIIKEID
                     GVKCEPVEELTIDLPENVSGKAVEMVTLRKGELLSMETKGDRMICEFIIPSRGIIGLR
                     NQLLTATAGEAIMAHRFTEYQPMRGGIPERQNGSLVSMELGKAIPYSIDKLQDRGRFF
                     VDPGEDIYEGQVIGENSRGDDMTVNITKTKKLSNVRSSGADDKAKIVPAIKFSLEEAL
                     EFIQKDEYVEVTPNYLRLRKIYLTENERKRNKIA"
     gene            93956..94774
                     /locus_tag="KQA_RS0201430"
     CDS             93956..94774
                     /locus_tag="KQA_RS0201430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-8-phosphooctulonate synthase"
                     /protein_id="WP_010177390.1"
                     /translation="MQLNNIPKIKNLDSNNFFLLAGPCAIEGEEMALRIAEKVVQITS
                     DLNIPYVFKGSFKKANRSRVDSFTGIGDEKALKILRKVSETFDVPTVTDIHTNEDAAK
                     AAEYVDVLQIPAFLVRQTDLVVAAAKTGKTVNLKKGQFMSPEAMQHAIRKVHDSGNDN
                     AMITDRGTMFGYQDMVVDFRGIPTMKQYGTTVLDVTHSLQQPNQSSGVTGGRPDMIET
                     IARAGIATGVDGLFIETHFDPSKAKSDGANMLHLDYLKNLLTNLVAIRQTINSL"
     gene            complement(94782..95930)
                     /locus_tag="KQA_RS0201435"
     CDS             complement(94782..95930)
                     /locus_tag="KQA_RS0201435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_010177391.1"
                     /translation="MKILLVGEYSGFHNSLKKGLTNLGHEVTIIAHGDGFKNYPVDIN
                     LGIKYFKKNRLLNFIKNGFYTFFKIDLSMLELRNQFKKTVPLLEKYDAIQFINSIAFL
                     GTPKTEKVLFNSITAYNKNIYLHGGSMETPWVDYMLNKHISFSSLTPYIKDKSLKKEF
                     QYALKYLETNHVNHFNYLLNHIKGIIPSDIDYEIVYKGTPKALNMIPTPIDLSKLKFT
                     ALDLSNKINIFCGINTTNQLAKGIPYFLDALDIIKQKYPSKVTVKITRNLPYNEYMKV
                     YNESHILLDQCLSYDQGYNGREAMAKGKVVVSGANEDFKNYYNLTEATMPLVEARPNV
                     DYLVNKLSELIENPDKMLAISKRARKFIEQHHECTEVAKKYLKAWSLD"
     gene            complement(95930..96778)
                     /locus_tag="KQA_RS0201440"
     CDS             complement(95930..96778)
                     /locus_tag="KQA_RS0201440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phytanoyl-CoA dioxygenase"
                     /protein_id="WP_010177392.1"
                     /translation="MDNSLEKHTCALLIDNEPFSFNVSGSFFKGKPEVLYQSQGNILE
                     NTEWESEGFKIISAFSDIEFKLLSNSIKKNILKGIKLAGITVTENDFNIGDYHKYITN
                     QENHLKVINHTKNLRNEDFDLDFEKLALKFSKHTNTKLTPYIKQLQSSHIQIRISRPN
                     SLDINPPHRDGYLDYWKNILNIWIPIAGCNEHSSLPVIEGSHLIPEDQIIRTKAKGAY
                     INGNQYYVPCIIKTTNGPFKMFRPNPKKNEALIFSPFLIHGAAINKNTDVTRIALELR
                     FDKKED"
     gene            96868..97974
                     /locus_tag="KQA_RS0201445"
     CDS             96868..97974
                     /locus_tag="KQA_RS0201445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="WP_010177393.1"
                     /translation="MISSKMNKLNVAVIVISLSRGGAERSTGTISKILENLGHSVTLI
                     SIIDENEFEHGGEYYALGSTKNYKTVFGRKISKFLDAYQLFQKINFDVVIDGRTRPLF
                     LKELIFNNLIFKNIPVVRIMHNSYLPQSFPKLKWQARYLYKNDSLIAVSKKAQQIVED
                     TYGFDNVRTINYPVSQKKIVESAQAELNILETNYVLFYGRFDNESKNLLFLLEAYSMS
                     KLSELGIPLILVGKGPDKPTIENKIKELNLIYHVIFKNYTPNPMPYVKKALFTVMTSN
                     FEGFPMTLIESLTLGTPVVTLDFISGPSEIIETGVNGILVTTKTTKAFSLALNKMVED
                     VEFYNKCVQGTFESIKYFDNFYIAKKWETLLNEL"
     gene            97971..98399
                     /locus_tag="KQA_RS0201450"
     CDS             97971..98399
                     /locus_tag="KQA_RS0201450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WxcM-like domain-containing protein"
                     /protein_id="WP_010177394.1"
                     /translation="MKKTRINDCHIIELDKIEGDDSRGSLSVIEKDSIPFESKRIYYL
                     YDVPSDARRGGHAHKELHQFLIPVSGSFDIILNDGKKEQTFTMNKPNKGLYLCPGIWR
                     EIENFSSGAVCLVLASEVYLEEDYIRDFHTFLRLKLPKIQ"
     gene            complement(98382..99290)
                     /locus_tag="KQA_RS18305"
     CDS             complement(98382..99290)
                     /locus_tag="KQA_RS18305"
                     /inference="COORDINATES: protein motif:HMM:PF10111.7"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 2 protein"
                     /protein_id="WP_040395979.1"
                     /translation="MTPFFSVIIPLYNKEDFIKTTLDSALKQNFIDYEIIIINDGSTD
                     NSLSVVEKINDKKIKIYSQKNSGVSTARNNGIKFANGKYIAFLDADDYWFPNHLSELN
                     RAISAYPEYKIFCNNYKVETKKNTYKENRFSYLPKPEFEDLYIIQNYFKSSLIADIAW
                     TSAVCIEKKLILDNDFFFDPDIISIQDIDLWTRLGIKHSFIFNKRETTIYALFVFDSL
                     SDSKNIDNKALLISKNKNSEGNTPYLKSYLDQNRFAIANQYKILGKKRKFKEFKSQIN
                     LSNLSFKRLVLLHLPHWLIKLLLNFR"
     gene            99375..100502
                     /locus_tag="KQA_RS0201460"
     CDS             99375..100502
                     /locus_tag="KQA_RS0201460"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="mannosyltransferase"
                     /protein_id="WP_010177396.1"
                     /translation="MASKKIQIIAFNNPYPVNYGGVIDVFYKIEALKEIGYQVYLHIF
                     YDDRVNISVLEKLCEEVYLYKRNKLFYNFFSLIPFSVKSRNSKELYARITNKTNIPVL
                     FESIQTTYILKKFHFNNETLVRTHNIEHEYYFGIAKSESCFFKKLIFYIEGWKLKRYQ
                     SVLKKADIILTLSERDTSYFNSIFKGKTLFLPVFHGNKKVKETMNSKSKFALYHGDLS
                     ISDNVESAIFICSLFYNLKQELVIASSVLPNRIKKIIKNYSNIKYINIREEEVLEDLL
                     AKAHVNILVSLQESGTKLKVFNALYKGKYCIVNANIVDDKNILKLCYVANTKSEFQKS
                     IQEIFGKDYQFSSERARVLKNYESLNLVKKLSYYLETNKIT"
     gene            complement(100681..101364)
                     /locus_tag="KQA_RS0201465"
     CDS             complement(100681..101364)
                     /locus_tag="KQA_RS0201465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter ATP-binding protein"
                     /protein_id="WP_010177397.1"
                     /translation="MSEAVLKLTNVTIFQREKAVLSNVSLQVLKGDFVYLIGKTGSGK
                     SSFLKTLYGDLALVQGEGEIVNFKLNGLQEKKIPFLRRKLGVVFQDFKLLNDRTVNNN
                     LAFVLKATGWKEKDKIENRIKEVLTKVGMESKGTIYPYQLSGGEQQRIAIARALLNNP
                     ELILADEPTGNLDPQTSLEVMALLKEINANGNTILMATHDYALLLKYPSKTLKCENQK
                     IFEVVQRKN"
     gene            101679..104684
                     /locus_tag="KQA_RS0201470"
     CDS             101679..104684
                     /locus_tag="KQA_RS0201470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177398.1"
                     /translation="MKKSSIITCFFVLISSLVLAQQTEIYNTTNGLYQRAVDLYNNKE
                     FAAAQSFFRKVQATTVDQNVKANTSYYIAQSAVQMQQRGADVLMTNFVTDYPTHPKRN
                     SAFFGVGSYYFSVGKYAQARKWYQDVDEQRLSAPALETFYFNKGYSLYHSKRYDDAKK
                     SLERVVGSEKYGEQAKYYLGYIAYKANDYDQADTYFNEVSDSENYNKSLSYYKADRNF
                     KKGEFQKAIDNAEPRLVNANTKDKSQLNKIIGESYFNLEDYEKAVPYLEAYKGNKGKW
                     SNTDYYLLGYSYYKQGEYSKAVSQFNKIIAGKNAVAQNAYYHLADAYLKSEQKQQALN
                     AFKNASEMNFEAIIKEDATYNYAKLSYEIGNSFESVPAVLKTFLLKYPDSSHKQEIAT
                     LLVDSYLSTKNYKEALVVLDSGKGTENKKVFQKVLFYRGLELFKEKDFKEAILLFDRA
                     ISTDALPDFTQRAQFWKGESYYALEDFVIAISNYKAVKESGDNTWEELKLTTYQLGYS
                     NFKIKAYDKAIDYFKKFIASNPEQFYLQDATLRLADSYFVTANYWPAMETYNKSIAQK
                     HKRADYAHFQKAISYGFVNKHDRKIQDLEAFLINFPDSGYRDDAYYALANAYVAKNNI
                     NKGLENYKQLRSELPKSAFVSKALLKEGLIFYNDNKSQKALDKFKLLVAEHSNTTEAL
                     QAVKTARLVYIDLGKTDEYAEWVKSLDFVDISNEELDNTTYEAAEKPYQENNISKAIV
                     GFEKYLKQFPKGLHKLNSHFYLGQLYTKKGDKQQALPHYLAVAEMDKNEYTETALYKI
                     SQTYLENKSYDKAISFLKRLEESADFTQNSIFAQSNLMKSYYEQKQFEETLVYSEKVL
                     VNSTIETSIKADAQIYKARAALALQKTGIAKKAYAEVAKIATGKLGAEAIYNLANFSN
                     QNGDYEISNNYVQRLAKDYSAYKEFGAKGLVLMAKNFYGLGDAYQATYLLESIVKEFT
                     SYPEVISEAKELLQKIKAEEAKTNSSIKE"
     gene            104696..106414
                     /locus_tag="KQA_RS0201475"
     CDS             104696..106414
                     /locus_tag="KQA_RS0201475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_010177399.1"
                     /translation="MSLFFNNRSVLFVVFFIGVLGYSQTKKEENDTLSTEKVVIVKTF
                     NPTINDAFKIHPEPNFDEKEASIKEPLKFQINSVPVASTFVPEKTKSIAVKKEAPEAS
                     FKNYALLGAGNFGNVLAEVFSSIDINKESQFTALLEHQSSQGGIKKVRLDDFFYDTGV
                     QLSFGKQQKRKQWTIDLEAQHQLYNWYGLSSNLEIPEEQFNAIDPSHSFIDVNLGGNL
                     QLDHEVFNTANVRFRHFRDDYESTENNLKLNPKFTAPLDDYPISIPIIFDYLSGEFAD
                     NNVFQGSKYSFLILGVQPTIALNFKGVDVKIGVSGFLSNDFENSELKLTIHPNLTANY
                     NFNAYNLSVFGGATGGLKQNTYHEAIEKNPFVAPGIGITPTNQVFNAFGGVQGQWQEK
                     FSYMLKGEAEFVKDYASFIKNPILNSATENLNYGFNNSFGYFYQDYVAAKITAEVGYE
                     EQGLFNVLLQTTFARYNETPRQPLNIPAFTTSARGNYIVNSAWSIGANIFYVGVREDR
                     DRLNSDLYTELDGYFDLNLRADYKITDQWSAFALGNNLTGQNYERWLDYPVQGIQLLV
                     GAKYKF"
     gene            complement(106486..107307)
                     /locus_tag="KQA_RS0201480"
     CDS             complement(106486..107307)
                     /locus_tag="KQA_RS0201480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177400.1"
                     /translation="MISIKTFFKVIALTIFIVACASDDDSNGNRNPRILNLQSTGNSA
                     NELLSSKTHNKLILELVAVKGFEPKKEAVENLVNFIEKRTFKSNGVQVIQRSIASTNK
                     KKLSIKQIDSIEQKNRTQLSTPNQHAIFIYFSDADANPENSEGEMNNDNDSMSSLVLG
                     SAYRNTSMVVYENTLKKIVNQSNSVIPDEVLARVETFTLQHEFCHLLGLVNLGTRMQT
                     PHEDTDENGKPNKHCNVRGCLMQANALFESNLMGNIKALELDPLCVKDLQANGGR"
     gene            107353..107886
                     /locus_tag="KQA_RS0201485"
     CDS             107353..107886
                     /locus_tag="KQA_RS0201485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2059 domain-containing protein"
                     /protein_id="WP_010177401.1"
                     /translation="MKFKCFSLVLFLILSLQSTAQQSTLTESITQYLNINGTTEQYEH
                     AVSSLLVMLKQQYVSKNVPETVWEELNQQKPTAINQIKAMLVSAYRTHFDQTEVNDMI
                     EFYKTPTGQQMITDQTKLTQDDRDKMSFFYNSPTGKKILEESDALNQSVSEISENWSR
                     ALYKSMTARLTEKGYDL"
     gene            complement(107881..108585)
                     /locus_tag="KQA_RS0201490"
     CDS             complement(107881..108585)
                     /locus_tag="KQA_RS0201490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_010177403.1"
                     /translation="MENDIFGAAITDYFETRIPNSIIVKSNEFDDDEIPIPYLFRTFN
                     EMPKVEQKALDLSFGKVLDVGCGAGSHSLHLQNEKKLTLTAIDTSAGAVEICKKRGVT
                     TVLNEDFYIHQGTYDTILLLMNGSGIVGTLTNFASFFNKLKSLLTSNGQILIDSSDLI
                     YLFEDENGEYWVDAAQGYYGEMQYQLEYKNKTSQKFDWLYVDYNTLQRAAAFNNFNCE
                     LIIEGAHYDYLARLTL"
     gene            108619..109137
                     /locus_tag="KQA_RS0201495"
     CDS             108619..109137
                     /locus_tag="KQA_RS0201495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YkgJ family cysteine cluster protein"
                     /protein_id="WP_010177404.1"
                     /translation="MQEEIDRLPKEAKEQFKENKKFLERLRQKPPKKLDVIMQDLHNK
                     TFDQIDCLECANCCKTTAPIVTDRDTERIAKHLKMKAVDFEQKYVKVDSDGDQVFKTT
                     PCEFLAHDNYCLIYDVRPKACSEYPHTNRKRFHQLNKVTLANTSICPATYRMVEKLKA
                     QFGVLNKKEKQR"
     gene            complement(109134..109409)
                     /locus_tag="KQA_RS0201500"
     CDS             complement(109134..109409)
                     /locus_tag="KQA_RS0201500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3817 domain-containing protein"
                     /protein_id="WP_010177405.1"
                     /translation="MLQKFRILALLEGISFLIILFITMPLKYLFENPMPNKIIGMVHG
                     VLFLGYVVFAIFLKTELKWSNKQTAIILLCSIIPFGTFWADKKYLKN"
     gene            complement(109448..110683)
                     /locus_tag="KQA_RS0201505"
     CDS             complement(109448..110683)
                     /locus_tag="KQA_RS0201505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1343 domain-containing protein"
                     /protein_id="WP_010177406.1"
                     /translation="MTFFKNTFLILVFPLFSCGKPNPSIKTASKIDHTVISSVKEKKK
                     TTSILTGAQQITSYLKLLKEKKIAVVANPTSIIFNIKKQPIHLVDSLLSRGVNLKKVF
                     APEHGFRGTADAGEVIKNGKDIATGLPIVSLYGKHKKPNPEMLSDIDCIVFDIQDVGA
                     RFYTYISTLHYIMEAAAEANILVIVLDRPNPNGHYVDGPIRQPKFKSFVGLHPIPIVH
                     GMTIGEYAKMINGEQWLANKLTCELSVIPLKNYTHTTAYSLPIKPSPNLPNDQSINLY
                     PSLCLFEGTNVSVGRGTDLQFQLYGAPNFSKTDFSFTPTPKPGAKHPKFEAKLCYGEN
                     LQQHKKLDQLHLNWLLKAYKQSPNKNEFFTSFFKKLAGTDQLQEQIEAGMTAKQIKAT
                     WQKDLDQFNLIRKKYLLYP"
     gene            110731..111963
                     /locus_tag="KQA_RS0201510"
     CDS             110731..111963
                     /locus_tag="KQA_RS0201510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010177407.1"
                     /translation="MNFEYFIAQRLIKEKAFAKNISSPIVKIAIIAIALGIIMMLIAI
                     ATGVGLQRKIREKIALFNGHIEISNFDNNSSQVSIKPITTNQTFYPNFSEVPEVTHIQ
                     GVATKAGIVRTETDFEGVLVKGVGSDYKWDVFETYLEQGRLPNYNEKINEEVLISSYL
                     ANRLGYKLGDKVVTYFLKNDKARTNLRSFVVTGIYNSGYEEFDKAFVIADVRHIQRLN
                     KWKKDEVGAFEVFVTDFDAVNRINAAVYKNIPSNLDSTSISQKYGNIFQWLNMFDFNI
                     AGIIGIMILVAGINMITAILVLILERTQLIGMLKAMGSSNVSIRKIFMYNATYIILKG
                     LFWGNLIGLVLIGIQYFFKVITLNPSDYYVKYAPVHITIQQVLALNIGTLVLCVLVLW
                     IPSYVITKIAPIKAIKFQ"
     gene            111993..112541
                     /locus_tag="KQA_RS0201515"
     CDS             111993..112541
                     /locus_tag="KQA_RS0201515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_010177408.1"
                     /translation="MKARLVDNDADLHQILAIQKENHLDNVSISNKKERGFVTVKHDF
                     EVLKKLNSKARQIIVSDKNEVIGYALVMLKEFKDLIPVLIPMFTLFESIQYRGKKLSE
                     LNYYVMGQICIADGYKRKGLFEKLYLKHKEVYSEQFEYCITEVSSSNIPSMKAHEKVG
                     FKTISTFCDTTDEWNVLLWDWH"
     gene            112629..114536
                     /locus_tag="KQA_RS19415"
     CDS             112629..114536
                     /locus_tag="KQA_RS19415"
                     /inference="COORDINATES: protein motif:HMM:PF01757.20"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_010177409.1"
                     /translation="MSKKHFYRPDIDGLRAIAVMLVILFHAGFTSISGGFVGVDIFFV
                     ISGFLITSSINKQMSQGTFSFQNFYLKRIRRIIPVLVFIMFIVTIPAYFILFSDDFEN
                     YSRTIIHTILSTNNFHLWIKSNDYFAESTELIPLLHTWSLSVEEQFYIIWPPLLLLLH
                     KKFNLKNRLLGVIVLLFLSFMLSVFLTHINMQMAYFLLPARLFEMLMGGVLAIFWYKL
                     PEFSKIQNHIISSVGFFMMLLPALLLTQNDSFPGINALWPCLGASLFIISGKEASKMG
                     VFNTILKIRVLVFIGLISYSMYLWHWPLLVYVKYLGFELTKPIALGVIILTILLSYLS
                     WKFIEQPFRYRYIYDFKNTLLKVLLPSVIICVSLYGVIDHFNGFPNRFTALSEFDKDA
                     NFPSKLRRNCYRKLRIGNIEECGLGTPKDQLDGMLIGDSFANHSAAFLEVLANDAHMY
                     FHDSAAGGYPVLADVDDITGEYRYDPEFGEKRLALAKKYEYVILAANWERFLDKKSKN
                     YQLVLKTVGELVETGKKVIVIDPLRKTTPMDLHKMKMFKVRNIAKIKKEDLLVPFYKR
                     PDDYIVYEFKRKFPTIKIVNLNTVMCNGNYCDYEINDNIVYRNSNHLNTSGARLLGER
                     YLKQYGNPLKK"
     gene            114752..116224
                     /locus_tag="KQA_RS0201525"
     CDS             114752..116224
                     /locus_tag="KQA_RS0201525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_001296691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IMP dehydrogenase"
                     /protein_id="WP_010177410.1"
                     /translation="MIAHESKIVGEGLTYDDVLLVPAFSEILPREVSIQTKFTKNITI
                     NVPIISAAMDTVTESSMAIAMAREGGIGVLHKNMTIQQQASEVRKVKRAESGMIIDPV
                     TLPLTAVVGDAKANMREHRIGGIPIVDEQGKLAGIVTNRDLRFEKDVDRPLIEVMTSE
                     NLVTVSEGTSLKDAEVILQKNKIEKLPVVNEDHILVGLITFRDITKLTQKPNANKDQF
                     GRLRVAAALGVTADVVERATALVNVGVDAVIIDTAHGHTKGVVDVLKKVKAAFPDLEV
                     IVGNIATGEAAKYLVEAGADAIKVGIGPGSICTTRVVAGVGFPQFSAVLEVAAAIKGT
                     GVPVIADGGIRYTGDIPKAIAAGADCVMLGSLLAGTKESPGETIIFEGRKFKSYRGMG
                     SVEAMKKGSKDRYFQDVEDDIKKLVPEGIVGRVAYKGELNESIHQFVGGLRAGMGYCG
                     AATIEDLKENGRFVKITASGINESHPHDVTITKEAPNYSR"
     gene            complement(116293..116943)
                     /locus_tag="KQA_RS0201530"
     CDS             complement(116293..116943)
                     /locus_tag="KQA_RS0201530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YceI family protein"
                     /protein_id="WP_010177411.1"
                     /translation="MKKQLINILAVTVLTASFISCKKNKEVETTNAKTVEQVVTAEKF
                     KAVPAQTMIKWNAHKIVGGHQGTINASAGLIEVKGNDLVGGNFIFDINTIKCSDLPAG
                     ENYDKLIGHLKNEDFFDVAKHPSAAFQITSVTPKNGKSVIAGNLSIKGIKKNIEFPAT
                     VSVNGNTVTITSDEFEIDRTEWGVKYNSGKFADPAKLGDYLIKDNVGIQIAVTASK"
     gene            117301..117855
                     /gene="grpE"
                     /locus_tag="KQA_RS0201535"
     CDS             117301..117855
                     /gene="grpE"
                     /locus_tag="KQA_RS0201535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide exchange factor GrpE"
                     /protein_id="WP_010177412.1"
                     /translation="MSTKDKAKETVDEIIQDSTKDAKVEEKETQPVEEKDELTLAKEA
                     AAVEKDKFLRLFAEFENYKKRTSKERVELFKTAGQEVLQALLPVLDDFDRASKEIEKS
                     EDEALKQGVTLIHNKLKDILKLKGLEQVEVNTADTFDADIHEAITQIPAPSDDLKGKI
                     IDVVEKGYKLGDKIIRYPKVVTGN"
     gene            117870..118982
                     /locus_tag="KQA_RS0201540"
     CDS             117870..118982
                     /locus_tag="KQA_RS0201540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013072537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_010177413.1"
                     /translation="MKEDFYDILGISKGASASEIKKAYRKKAVQYHPDKNPGDAEAEE
                     NFKKAAEAYEILSDPDKKARYDQYGHQAFENGGGGGGFGGMNMDDIFSQFGDIFGGGG
                     GFGGFGGGGGGQRRSKGSNLRIRVKLTLEEIANGVEKKVKVKRKVQADGTTYKTCGTC
                     NGSGQVVRITNTILGRMQTAAPCNACGGSGQQIDKKPNGADAQGLIVNEETVSIKIPA
                     GVQDGMQLKVSGKGNEAPGNGFAGDLLVAIEELAHESLQREGDNLHYDLYISFSDAVL
                     GGSKEIDTVSGKVRIKIDEGVQSGKILRLRGKGIPNLNGYGKGDLLVHVNVWTPKTVT
                     KEQKTFFEKMKDDDHFSPSPEKSEKSFFEKVKDMFS"
     gene            119357..120256
                     /locus_tag="KQA_RS0201545"
     CDS             119357..120256
                     /locus_tag="KQA_RS0201545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein MscS"
                     /protein_id="WP_010177414.1"
                     /translation="MIILFLQQKIAEKVVDTLDKNVWQKIREILTLKLELGAFKISIL
                     SLIIVIVTFIVTKYALYFITKLITKRLDKENVPKFESLFSFIKYFIYALVGVMVFQAL
                     GINLTPILAASAALLVGVGLALQTLFQDILSGVFILIDRTVIVGDIIELDGKVGRVEE
                     IKLRTTRAVTIDNKVLVIPNHKYLTKSLFNWTQNGKKTRDTVAVGVAYDSDVNLVKKL
                     LLKAVHENKKILSEPEPIVLFEDFGDSSLQFKVVYTISDSFMGAIPRSELRFEITRLF
                     REHNIQIPFPQREIRVLSDHRNN"
     gene            120268..121431
                     /locus_tag="KQA_RS0201550"
     CDS             120268..121431
                     /locus_tag="KQA_RS0201550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_010177415.1"
                     /translation="MSKILIIEDEAAIRRVLVKILSEENEAYKVSEAGNGLEGVELIK
                     KEDFDLVLCDIKMPKMDGIEVLEAINKVKPEIPVVMISGHGDLETAVNTMRLGAFDYI
                     SKPPDLNRLLNTVRNALDRKELVVENKRLKKKVSKSYEMIGNSKAISEIKEIIEKVAP
                     TEARVLVTGPNGTGKELVAHWLHEKSERSKGPFIEVNCAAIPSELIESELFGHVKGAF
                     TSANKDRAGKFEAANGGTIFLDEIGDMSLSAQAKVLRALQESKVQRVGSDKDIKVNVR
                     VVAATNKDLKKEIEDKKFREDLYHRLAVILIKVPALNDRRDDIPELINHFSKKIAESQ
                     GTIPKDFSDEAVKLLQKYDWTGNIRELRNVVERLLILGEKEISENDVKLFASK"
     gene            121431..121940
                     /locus_tag="KQA_RS0201555"
     CDS             121431..121940
                     /locus_tag="KQA_RS0201555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177416.1"
                     /translation="MKLFNTLFLFFIVNSILAQHEPGAWVVGVQGAAKVDRISDVGGS
                     FQVHYAPNCYSTYIAEVGVLNTKDGIVPELGITINSIMFNFQSWMITGGMGFIMNSAE
                     LSKKEQDDAIFAFSDGKNSFGALLKIRTLVPINKWWQLSSAFNFKSVGGKFSTVTLGI
                     IYEFPLKGY"
     gene            121942..122808
                     /locus_tag="KQA_RS0201560"
     CDS             121942..122808
                     /locus_tag="KQA_RS0201560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase"
                     /protein_id="WP_010177417.1"
                     /translation="MKAEKANSSFKISDAKTTIDIGLSEDELKDELKSVRKKLGKLQD
                     TLYAHGKYAVLVCLQGMDTAGKDSLIREVFKDFNTSGIIVHSFKVPSTIERNHDYLWR
                     HYIALPARGKFGIFNRTHYENVLVTRVHPEYILGENIPHISSVNDVDDKFWKQRFEQI
                     NDFEKHLTQNGTLIFKFFLHLSKREQKNRLLRRLEKKDKNWKFSPADLKERKLWDAYQ
                     DCYEDAIRNTSTLQAPWYVIPADHKPVARYLVAKTLYDSLSAYTDIQEPELEEDVVFE
                     LRNYLHQLKSEK"
     gene            123205..129738
                     /locus_tag="KQA_RS0201565"
     CDS             123205..129738
                     /locus_tag="KQA_RS0201565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calcium-binding protein"
                     /protein_id="WP_010177418.1"
                     /translation="MILKKLSLYALAFFGTSGFAQSSFNYAEALQKSLFFYEVQQSGE
                     LPSWNRVTWRGDSALNDGSDVGVDLTGGWYDAGDHVKFNFPMAFSVTALSWGAIEYEE
                     AYKNAGQLDIIKRNIKFVTDYLLKCHTGPTELYGQVGNGGLDHAYWGSSEVMVMDRPA
                     YKISASAPGSDLAAETAAAMAAASILFKDSDPAYSKTLLDHAKQLYKFADDYRGVYSE
                     AITDAAGFYRSFSGFQDELVWGAAWLYRATNDATYLAKAESEYDNLGNEGQSSNKAYK
                     WGLAWDDKSYGSYVLMSQLTGKDKYKADAERHLDYWTDGFNGDRVPYSPGGQAHLTQW
                     GSLRHSSNTSLLAFIYSDKVETSATNKKKYHDFAVRQINYALGDNPINRSFMVGFGNN
                     PANNTHHRAAHGAWANSLQNRPDKPSHTLFGALAGGPSSPNDQFEDDRGDFIANEVAC
                     DYNACFTGALARMYSEFGGSTLANFPVKETPSRTEIRSYSKFNSNNAFGSTVKILLQN
                     RSAWPARVMDKLSYRYYFDIAEGVAAGKTIDDYDIQLNGVGGSATMSIKSAGGTLYYA
                     EISNIPSISPIGDPAFRNETQINFRVSNGVPYDTSNDPSASGLTGSSEIESVNIPVYD
                     NGVLVFGQEPDGTTTPVDPVNTAPVASINADKFSGEAPLTVTFDASGSSDAENDALTY
                     VWTFGNGETSTDENPSTIYTTAGSYLVSLVVNDGLLNSTEETITINVNDPAVNPVVVT
                     GGTLSGGPFTFTVGDGVADNVSGVTVSGNTGATSQWVVTDETGKILGLPPAPEAVNFD
                     EAPPGTCFIYNVSYNGTLNGLTVDANISGLSGDFQLSSNRVEVVRNAPIVVTPITVAG
                     GTLNGGPFTFTVGDGIADNVSGVSVSGNSGATSQWVVTDEVGKILGLPPTPEAVNFDE
                     APAGSCFIYNVSFNGALNGLAVDSNISGLSGDFQLSSNSIEVVRNAVVVVTPPTGDCT
                     FGAPIATPLETTYGYYTNMYAFGSSAPSMGNLSGFSFNWDLANNGLWSIAIQTTDGNP
                     SYYVDLRDKTTHNLGASQPSITFAGTGIPGLDGTYYTARDGENLALVSTTADYTLYFS
                     NSSTAPDCGDVIDTPIVVNGGTLTGGPFAFTVNDGIADNVSGVSVTGNTGSNFGWIVT
                     DEDLNILGLPGTPEAVNFDEAGAGVCLIWHIAYEDGLTGLTAGENAGNLVGNFDLSNS
                     IRVDRTAAIPSTVDGGTIVGGPFTFTVGDGIADNVSGVSVSGNTGSNFGWVVTDEDLN
                     ILGLPGTPEAVNFDEAPAGVCLIWHIAYEDGLTGLTVGENAGNLAGDFDLSNSIRVDR
                     TGTNVPTPTVDGATVATSTGAVAVETITGDGIADLINFTTTSTATLNYSYLITDAAGN
                     ILVVEADSHDFEGVSVGVCLVYGISYEGTLSVTGKSITDTDLASGAFDVSDNSISVDR
                     KDIPVVVDPTDPTTGGPDVNNKYIERFTEMRNEIYDPANGYFSKDGSPHHSVETLIVE
                     APDHGHESTSELYSYWLMMEAMQGRITKDWQPLAKVWSEMERMIIPTKADQPTNAAYD
                     ASSPAAYAAEFPLPSGYPAPLDFGAAVGQDPVSAELTAAYGPEVYQMHWLLDNDNFYG
                     YGNRGDGTSTPSYINTFQRGEQESVYETIPHPSWESFEFGNSENGFLPLFILDTNYAK
                     QWRYTSAPDADARAVQAMYWAVQYAKEQSGAIDPTLLDNTKKMGDYLRLAMFDKYFKK
                     IGSQDEQGSAGTGYDSAHYLMSWYMSWGGSADPASAWAFRISSSHCHFGYQNPVAAYA
                     LTTLDELDLQTPNGERDWTTSLGRQMEFYRYLQSADGAIAGGATNSWNGDYSTYPAGK
                     STFYDMAYDDNPVYHDPGSGTWFGWQAWSVERVAEYYYITNDPLAKEIMDKWVAWVKP
                     NVKLIGSDDFDIPATLEWSGEPDTWNAANPGDNANLRVTVTNFSKDLGIASSLAKTLT
                     YYAAATRKHATLDEEAKNLAKEILDRMWVTYRDDKGVSAPESRGDYKRMFEEVVHVPT
                     GYTGTMANGDEIKTGVTFLDIRSGLKDDPEYPAVKAAYDAGEDYTTRYHRTWAQMETA
                     LANAEYGFFFGEDDEAAGAKALDVELTVYPNPASELVTVTYPTEEDVALKVTLVDFAG
                     RVITTQELLNEKSTTIDVSNLASGMYIVRLETKGNVIRTEKLIIK"
     gene            129820..131211
                     /locus_tag="KQA_RS0201570"
     CDS             129820..131211
                     /locus_tag="KQA_RS0201570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family efflux transporter"
                     /protein_id="WP_010177419.1"
                     /translation="MGKHYAKYYWNNNTLASKKVLSKYIKEFPVNLRLAYPIMIGQLG
                     NVMVGFIDNVMVGKLGASSLAAVSLGNGLFFLALSLAIGFSLSITPLVAEADGQKDYL
                     KISLLLKNGIALSTLLGGALFVVIKLLQPFLTLLDQPEEVVVLANPYINILAFSIIPL
                     AMFQAMKQFSDGLSVTRYAMIATIIGNVLNVFFNYVLIYGKWGFPKLLLEGAAIGTLI
                     ARFSMVFFMLLIFYKQQNFKVYVSNIFSNILQLNIVKNLLKLGFPAALQMLFEFGIFI
                     SSIFLSGLLSTEDQAANQIALNVASITFMIAVGLGVTATIRTGNQLGKKDFKALIRIV
                     RSILLLVFLIEFVFAIVLVFLKDYLPVFYISDVNVIALAAKLLLVVACFQISDGFQVV
                     LLGTLRGLQDVNIPTLCLFIAYWCVGFPISYYLGNPSYLGSVGIWIGLFAGLTVSSGL
                     LYIRYLYLSKKFN"
     gene            complement(131280..132257)
                     /locus_tag="KQA_RS0201575"
     CDS             complement(131280..132257)
                     /locus_tag="KQA_RS0201575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006257250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase complex E1 component
                     subunit beta"
                     /protein_id="WP_010177420.1"
                     /translation="MKTIQFREAICEAMSEEMRRDESIYLMGEEVAEYNGAYKASKGM
                     LDEFGAKRVIDTPIAELGFAGIAVGSAMNGNRPIVEYMTFNFSLVGIDQIINNAAKIR
                     QMSGGQFPCPIVFRGPTASAGQLGATHSQAFENWFANTPGLKVIVPSNPYDAKGLLKA
                     AIRDNDPVIFMESEQMYGDKGEVPEGEYVLPIGVADLKREGNDVTIVSFGKIIKEAYI
                     AADTLAKEGISCEIIDLRTVRPLDLEAIYKSVKKTNRLIILEEAWPLANIASEITYQV
                     QQNCFDYLDAPVIKINTADTPAPYSPTLLAEWLPNNEDVIKAVKKVMYK"
     gene            132613..133359
                     /locus_tag="KQA_RS0201585"
     CDS             132613..133359
                     /locus_tag="KQA_RS0201585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit alpha"
                     /protein_id="WP_010177421.1"
                     /translation="MKILVCISHVPDTTSKINFTDDDTKFDTNGVSFVINPNDEFGLT
                     RAMWFKEKQGASVDVVNVGGPDTEPTIRKCLAIGADNAIRVNANPTDSLFVAQELASV
                     AKNGGYDLVIAGRESIDYNGGVVPGMLAALLDANFVNTCISLEVEGTSATAIREIDGG
                     KETIKATLPLVIGGQKGLVEESDLRIPNMRGIMMARKKPLSVVEPTGSASQSEPSSFS
                     KPAPKGSVTLVSADNLDELINLLHKEAKVI"
     gene            133474..134433
                     /locus_tag="KQA_RS0201590"
     CDS             133474..134433
                     /locus_tag="KQA_RS0201590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit
                     alpha/FixB family protein"
                     /protein_id="WP_010177422.1"
                     /translation="MSVLIYAESDNGSLRKGAFEVASYAKGVADALGTTVTALTVNVS
                     DVSELGNYGVSKVLQVSDNALTKFQAKAYSSIIEQAAKAEQSKVVVLSSSTNSKYAAP
                     LLGVALNAAVVSNVVSLPKSTSPFVVERTAFTNKAFQETQINSDVKVICVSNNSYGLK
                     ETSVSIEAEAFSPSVNGGSLEVVSIDKATDKVSIADAEVVVSGGRGLKGPENWHLIED
                     LATVLGAATACSKPVSDMGWRPHSEHVGQTGKPVATNLYIAVGISGAIQHLAGINASK
                     VKVVVNTDPEAPFFKAADYGVVGDAFEVVPQLIEKLKAFKSTN"
     gene            134611..135231
                     /locus_tag="KQA_RS0201595"
     CDS             134611..135231
                     /locus_tag="KQA_RS0201595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010520256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177423.1"
                     /translation="MSLVRLNIRGISYSQTQNGAYALILSEMEGERKLPIVIGAFEAQ
                     SIAIALEKEIRPPRPLTHDLFKNFADRFDVVVKQVIIHKLVDGVFYSSIICERDGIEE
                     IIDARTSDAIALALRFRAPIFTYKNILDQAGIYLKQQSDGEFLSENVDGPEEDSSDEK
                     SVELVSSSADFKNLTVDELYKLLDKAVTDEDYEKAARLRDEISNRN"
     gene            135383..136207
                     /locus_tag="KQA_RS0201600"
     CDS             135383..136207
                     /locus_tag="KQA_RS0201600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010520255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_010177424.1"
                     /translation="MKQYLDLVQHVMDNGAVKGDRTGTGTRSVFGYQMRFDLSKGFPM
                     VTTKKVHFKSVVYELLWFLKGDTNIKYLSDHGVRIWNDWANDNGDLGPVYGHQWRNWN
                     NEEIDQIKEIVETLKKNPNSRRMLVSAWNPSVMPDTSVSFEENVANGKAALPPCHAFF
                     QFYVANGKLSCQLYQRSADIFLGVPFNIASYALLTEMMAQVCGYEAGEFIHTFGDAHI
                     YNDHVEQLQLQLSRSPKPLPKIKMNPNKTDLFDFKFEDFELVDYEHHPHIKGKVSV"
     gene            complement(136363..137220)
                     /locus_tag="KQA_RS0201605"
     CDS             complement(136363..137220)
                     /locus_tag="KQA_RS0201605"
                     /inference="COORDINATES: protein motif:HMM:PF12388.6"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177425.1"
                     /translation="MKKLKIVAIATTAILMVQCQDENTADIQPTEETSIENQEANLDL
                     PVVNFTPVSNEVSPEIVKGLQNMGYDTVLDKIENLGNHYLVGGDMIVDKESILEAAHT
                     DPKGKQRRFNSIMRCSEARDVTVRNLIPSINTQVRNALNDWNRIRGSFLRLRLVNGGN
                     ADMTIMRVKGVAGAADRPRNGKPGRTVYFDPDFYKGIPRRGERMRFVIRHEIGHNLGF
                     LHTNEIDNQEKGQHIPGTPNRDRNSIMNSAGNLPFNPAVWPFNNFTEADKRALRKMYG
                     GNAQNNICF"
     gene            <137876..>138280
                     /locus_tag="KQA_RS19775"
                     /pseudo
     CDS             <137876..>138280
                     /locus_tag="KQA_RS19775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016513608.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start and stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(139846..140145)
                     /locus_tag="KQA_RS0201615"
     CDS             complement(139846..140145)
                     /locus_tag="KQA_RS0201615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase"
                     /protein_id="WP_010177427.1"
                     /translation="MSISKQFLKSKPECKVTFVWNAKEAKSVTVAGDFNNWETTQLPL
                     KKLKNGTFKGSINLPIENSFQFKYLVDNNSWVNDDSADNYIWNDFAGGENGVLEL"
     gene            complement(140360..141727)
                     /locus_tag="KQA_RS0201620"
     CDS             complement(140360..141727)
                     /locus_tag="KQA_RS0201620"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177428.1"
                     /translation="MKINLLSKAKNCLYIGFSLSVSVALSQEHIIKVNSNNTFASLQL
                     SEKEYDSWIQNDDFTTSKEVVSNLTKELYNNFEDNYDFIVFVLNEKEVPTTGKIDYFG
                     INNVINSKIEGISFTNDKSDDSKFYGSDGVLKSIMHFPEKEGMLFGPFLHEIMHNWGN
                     FDVIAGEAPSEENEDGSFTFSKIPGHWGLTGGSTPGQLGGFKQSDLIKNKDGSFTTPG
                     FSFNANGGNQVPYNEFELYLMGMIPLEEVAPFDSFSNVTDFSFEEDKDTGDFTSYTFK
                     AGEVIRYTPEKILNDLGPRNPSYKNSQKEFNMLTVIITKTALTEKEWEEYDAIIKVTT
                     QKADHDDKRLYNFWQATRGIGSLNPTIHKKTNTLSIDDITDHDEEFKIYPIPVTATLS
                     IENLKNSPVKNVILCDALGKEINSYPLATTTTIDVSTVASGIYYLIFKNDHKKLVETK
                     RLVIY"
     gene            142180..142626
                     /locus_tag="KQA_RS0201625"
     CDS             142180..142626
                     /locus_tag="KQA_RS0201625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177429.1"
                     /translation="MFSRSKSKESTIDLEQKELFEHAQARIKEKKGLYRHFIVFLVSC
                     IFMIVLNLGLNFGKEYKFLELDWFVFGVLGWSFFFLIHFFRVVLFSKFMGKEWKAKQL
                     ERLVAKQKAKIAKMEQKLNLEIPKDIVSEKSILLDNTDLNDTEKLQ"
     gene            142630..143112
                     /locus_tag="KQA_RS0201630"
     CDS             142630..143112
                     /locus_tag="KQA_RS0201630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrofolate reductase"
                     /protein_id="WP_010177430.1"
                     /translation="MIILIAAAAENNALGKDNDLLWHLPDDFKRFKKLTSGHPIIMGR
                     KTFESLPGMLPKRTHIIITRQDDYFKEGCLIANSLEQAVELAGTSAKIFIIGGGEIYT
                     QSLKIADSIELTRVHANFEADTFFPEIDTEQWELVDNEQHEADEKHTYSFSYLTYVKK
                     "
     gene            143172..>144271
                     /locus_tag="KQA_RS19425"
     CDS             143172..>144271
                     /locus_tag="KQA_RS19425"
                     /inference="COORDINATES: protein motif:HMM:PF04784.12"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF547 domain-containing protein"
                     /protein_id="WP_081483224.1"
                     /translation="MKPFSLFLFLCCITAMVSCAKQKETKTVVALESLEKNGIKTLED
                     AIKGEEFTDSIEIEGDEDFIEEIKEKPLVVNDEEKVVVETLKNTEKPIKKKDATKGVV
                     IEEEIATVPVKEIGSKNEKEGTSKKVQKIEKESTQVQHKVAKIATKEVESIGAMEFDH
                     TLFDAFLNKYVSSTGNVNYKMMKSHQIELESYINSLQNKTLKTTWTTNQKLAYWINAY
                     NAFTLKLILDHYPVNSITAIAGGKPWDKKWIALNGKMYSLNQIENDIIRPQFKEPRIH
                     FAVNCAAKSCPKLGNFAYTASNLNAKLTSQTKAFINSNLNQISATHLKISKIFEWYKS
                     DFGDLVPFIKKYSTVVINDNATVEYNEYDWSL"
     assembly_gap    144272..144318
                     /estimated_length=47
                     /gap_type="within scaffold"
                     /linkage_evidence="unspecified"
     gene            144355..145236
                     /gene="fabD"
                     /locus_tag="KQA_RS0201640"
     CDS             144355..145236
                     /gene="fabD"
                     /locus_tag="KQA_RS0201640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010520249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="[acyl-carrier-protein] S-malonyltransferase"
                     /protein_id="WP_029209407.1"
                     /translation="MKAYVFPGQGAQFVGMGKDLYDNAPIAKQLFDKANEILGFSITD
                     IMFEGTPEQLKETKVTQPAIFLHSVILSKVLGDDFKPDMVAGHSLGEFSALVANGVLS
                     FEDGLKLVSQRALAMQKACEASASTMAAVLGLDDEVVETVCNEIGAEVVPANYNCPGQ
                     LVISGGVDAIAKACEILKEKGARRALVLPVGGGFHSPYMEPARAELAAAIEATTFNEP
                     ACPIYQNVTTTAVNSAEAIKENLIAQLTAPVKWTQSIQQMIADGATSFTEVGPGKVLQ
                     GLVKKIDRSAETFGATL"
     gene            complement(145317..145616)
                     /locus_tag="KQA_RS0201645"
     CDS             complement(145317..145616)
                     /locus_tag="KQA_RS0201645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177433.1"
                     /translation="MKIMSLIISLLVITGIVWFLKINTADNKARKDAIQVEASIEKVN
                     CKQRLKGDKSLVAVAYKGQVYYIFFKNEKDCNKYKENQKVTAYFSKTYNKLYLDL"
     gene            complement(145623..146777)
                     /locus_tag="KQA_RS0201650"
     CDS             complement(145623..146777)
                     /locus_tag="KQA_RS0201650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DegT/DnrJ/EryC1/StrS family aminotransferase"
                     /protein_id="WP_010177434.1"
                     /translation="MKKIQMVDLKGQYEGIKNTVNNSIQEVLDNTAYINGPQVHKFQE
                     ELEKYLNVKHVIPCANGTDALQIAMMGLGLQPGDEVITADFTFAATVEVIALLQLTPV
                     LVDVDPNTFNIDPKAIEKAITPKTKAIVPVHLFGQAANMEAITTIAKKHDLFIIEDNA
                     QGIGASYTFANGTKKKTGNLGHVASTSFFPSKNLGCYGDGGAIFTNNDELAHSIRGIV
                     NHGMYQRYHHDVVGVNSRLDSIQAAVLLAKLPNLDTYNNARRASARKYNDAFKNIPQI
                     ITPVTHTKCEGICDTCDCHVFHQYTLKVKDADRDALVAHLNKNNIPCGVYYPIPLHAQ
                     KAYTDKRYLESDFPVTNQLVKEVISLPMHTELDDEQIAFITKTVIDFVTK"
     gene            147247..148371
                     /locus_tag="KQA_RS0201655"
     CDS             147247..148371
                     /locus_tag="KQA_RS0201655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gfo/Idh/MocA family oxidoreductase"
                     /protein_id="WP_010177435.1"
                     /translation="MKNEKRREFIKQLGLVAGSTALLPSLLSFDSIINTYKKEGSQKK
                     INVALCGLGRYAKILAKGLEQTKQCKLTGLVTGTPEKEITWGQKYNIPKKNIYNYDNF
                     DSIIDNKDIDLVYVVLPNSMHKEFTIRAANAGKHVIVEKPMGLNALECVEMIDACKKN
                     GVQLAVGYRLHYEPHHKEIKRMGQEKVFGNIRYIDASLGYRIKGWKKDAWHLKKAMSG
                     GGPLTNIGIYCVQSNRYILGEEPIAVTAQFGPVQRPDYFKEVEESITWQLEFPSGAVT
                     TSASSYSYNVDRLYASGDDGFFELEPALSYGPFKGKSSLGTFNFPVINQQQVQLDEIS
                     KCILNKEPLPMHIRGEEGHKDMLVIDAIYKSAATGKKVVI"
     gene            148384..148956
                     /locus_tag="KQA_RS0201660"
     CDS             148384..148956
                     /locus_tag="KQA_RS0201660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_010177436.1"
                     /translation="MINDLLIQNIKKNVSLPDTDLKRICNYFKPKTIPKKEFLLTQGS
                     ICKFEGFVLEGCFRIFIIDKKGHENTLYFAAKDWWVMDIDSFMNQKPSDLNIQAIEDS
                     KVLLITREDKTDLYNSVPSAEKLFRIMSQKSIVAWQQRLIRNHCQTAKDRYNYYISTY
                     PDIASKLTDKQIAGYLGITHEFLSKIKKKS"
     gene            149046..149534
                     /locus_tag="KQA_RS0201665"
     CDS             149046..149534
                     /locus_tag="KQA_RS0201665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme-binding protein"
                     /protein_id="WP_010177437.1"
                     /translation="MNLLRSARSCAIAFILTLACNGGYAQITNDITHDEAFKVLLAAK
                     KKAEHSNVLVNIAIVDAGTNLKAFIRMDNSFIGSIDVAIKKAKTARYFNIDTGKLGEL
                     TQPGGIIYNIEHSNGGLITFPGGIPIKNKNGEIIGAIGVSGGTIEQDRAIASAGIKAV
                     ID"
     gene            149556..151079
                     /locus_tag="KQA_RS19430"
     CDS             149556..151079
                     /locus_tag="KQA_RS19430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stress protein"
                     /protein_id="WP_010177438.1"
                     /translation="MKKILKKIIFGTVLLVLQICSAQVSNELMLYRKDFKDISGNNTV
                     SVTSYQKGDAHFVFAGGIGNIDVYSLNKNGELTPISNHELYKGKGPARGMVADSINGN
                     DFLFVANKHGNAIETFKILNNGALERVSLVADTNKTHLGTAITLQVIHMKESSYLFIG
                     GLEETPGLSSFQIHDDGKLTHVQSMEDNEIIHTDGVIGMYTHKINGRTFLYTGGFQDN
                     GVSSFRVYENGTFKNINNISDNTNDRYLTGTYPVTGVTLGNNNYVIVGHRHHKYYKRA
                     GFIKKTDFVYHGDAVSVFKINKKGALIPHFVLKDDETTKLQGQTRIEVVSVANNEAIL
                     AVGTRDDASIQLCRLNKEGILSPINYLETGFSIYYGLRSHKIGKENFLIAGSFRFDLK
                     KIVTYKIAPKINREGKVLRHMVNLKYKDGIEESKVNEAVKNFMNLKNEIPEIASIEWG
                     INDSTEGHSKGLTHCFTLTFADEHAREIYLFHKAHLQMVSKISPIIADVLVLDYWTK"
     gene            complement(151115..152038)
                     /locus_tag="KQA_RS0201675"
     CDS             complement(151115..152038)
                     /locus_tag="KQA_RS0201675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="WP_010177439.1"
                     /translation="MRALVISGGGSKGAFAGGVAQYLMQVQQRKYDLFLGTSTGSLLI
                     PHLSINKIDKVHDIYTNVNQNTIFSLNPFVVKHKGDREYVSINYLNTVLQFVKRKRTF
                     GESKNLRKNIRKNFTREEFEFARKNVTDVVVTVSNLSKSCTEYKSIHEFSYEDFCEWI
                     WISCNYIPFMSIAKKNGYEYADGGFGAIVPIREAIKRGATEIDAVILESENLDRNKIL
                     GKNPFSLMVNLFGYLLDQVEQHNVTAGKLAAKNKNATLNLYYTPTKLTENSLVFNKKL
                     MTEWWQQGFDYAREKFEQKELNELRDLDMRG"
     gene            complement(152101..154203)
                     /locus_tag="KQA_RS0201680"
     CDS             complement(152101..154203)
                     /locus_tag="KQA_RS0201680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_010177440.1"
                     /translation="MSQFIKITSLIFSFCASIIYSRAQQKDLVDFKTIEAHIQLDTIN
                     QKVFGKIDVLFTPLKNTNQVYLDAQKMETVTPIKDAKVEYKDNKIWLKGDFKANTAYS
                     FSFNYSTTPKKALYFWGWDAKNIDPNSPNHKQIWTQGQGKYTSNWLPSIDDMNDKIIF
                     TLKIDFNTDYQVISNGSLIHKTTTNTTTTWVYQMQQPMSSYLVALAIGKYLKKEEKSA
                     SGVPLENYIYSDRITDYESTFNYHKKVFDFLETEIGIPYPWKIYRQVPVRDFLYAGME
                     NTACTLFSDDFIVDTNTFDDQNFVNVSAHELAHQWFGNIITETDSNHHWLHEGFATYF
                     ALLAEKELFGEDHFYYKLYESAEQLNHQSDLQKGKALVTPKGSSLTYYQHGAWAIVAL
                     RNNIGDAHFKKVVQQFLTTHQYKNVTTYDFLSIVFEVTGKDTSEFAKKWLHNTTFPAG
                     EALKIITQSEVMKRYLQLAGERTQPLIGKYQLLSDALDFPVNPYLGQEVVAQLQGDFS
                     KEALLLLEKAFESNQPQVLQALANSLTTIPKAFEPKMALLLKADSYATVEGALYNLWN
                     NFEAKKMNYLQATKNLIGFNDKNIRTLWLVLALNTPGFSTTDRTRFFNELNSYTAPNH
                     HYRLRSKAFEYLKLLQSYSDQSLQNLALGATHPNWRFKKNCSTTLKALYANEKYTQRI
                     NRLSATFPNKVKQLLTTD"
     gene            154283..156388
                     /locus_tag="KQA_RS0201685"
     CDS             154283..156388
                     /locus_tag="KQA_RS0201685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase RecG"
                     /protein_id="WP_010177441.1"
                     /translation="MSADILQSPVAYVKGVGPTRATVLEKELGIRVCQDLLHFFPHRY
                     IDRTRYYTISELQQNDAEVQIVGMVTQLKNVKQKKGGSRLVATFQDKTGKMELVWFRG
                     AKWIQESIKINVPYVIFGKTKYYNGFSMPHPEMELLDAHKSSMSSIMQPIYSSTEMLQ
                     RRNITNKVVSKMVQNLFLTKGVFFDETLPKNILEHMKLIGKSEALLNIHFPKSQELLT
                     KASYRLKFEELFYIQLQLIRKNILQKQKIKGYAFEKVGELFTNFYENYLPFSLTGAQK
                     RVVKEIRRDMGSEAQMNRLLQGDVGSGKTIVALMSMLLAIDNGYQATLMAPTAILAKQ
                     HFDGISALVKDLPIHVSLLMGSTKTKARREIHADLENGQIHIIIGTHALLEDKVKFNN
                     LGLAIIDEQHRFGVAQRAKLWRKNELPPHVLVMTATPIPRTLAMSLYGDLDVSVIDEL
                     PPGRKSIKTMHKYDGQRLNVFHFVKQEIAKGRQIYIVYPLIQESEAMDYKDLMDGFES
                     ISRDFPKPEYQISIVHGQMKPADKDHEMERFVKGETQIMIATTVIEVGVNVPNASVMI
                     IESAERFGLSQLHQLRGRVGRGAEQSYCILMSGFKLSEDSKTRLQTMVQTNDGFEIAE
                     VDLKLRGPGDIMGTQQSGVLNLKIADIVKDNQILQVARAYAQQILKEDPNLVLPKNSM
                     IKQAYAQLIQHKNIWNYIS"
     gene            156476..157096
                     /locus_tag="KQA_RS0201690"
     CDS             156476..157096
                     /locus_tag="KQA_RS0201690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonylcarbamoyl-AMP synthase"
                     /protein_id="WP_010177442.1"
                     /translation="MAAFIKLYEENPNPKQIAEAVKVLKNGGLIIYPTDTVYGLGCDI
                     TSVKALNRIAKIKGIKLEKANWSFICKDLSNLSDYVRQIDSSTFKLLKRCLPGPFTFI
                     LPGNNQLPSVFKKKKTVGIRVPDNKICHDLVEALGNPIVSTSIHDEDEILEYTTDPEL
                     ILEKWGNLVDLVIDGGYGDNIPSSIVDVTDNIPVIVREGKGDTSLI"
     gene            157336..157920
                     /locus_tag="KQA_RS0201695"
     CDS             157336..157920
                     /locus_tag="KQA_RS0201695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177444.1"
                     /translation="MKKLLKLGLLSVALASSVIANASNKVKVEVLASNELSITMSEVV
                     EGEVLSITNKKGKLVFSEILSATSSYTKTLDFSKLTQGVYYVKAETESAVKVTPFIIV
                     PDQVKIIKGATKTYNAPVFKVENGIAEVSIDNKDLHDVSITVYAKNSSIPLEEVRLNT
                     PKITKTYNFESLPVSEYKIVIYQGDYSYVKTVKR"
     gene            158419..159003
                     /locus_tag="KQA_RS0201700"
     CDS             158419..159003
                     /locus_tag="KQA_RS0201700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177446.1"
                     /translation="MKKILKLGLLSVALLTTVVVNASNKVKVEVLASNELSITMSEVI
                     EGEVLSVSDKKGEVVFSEILSASSSYTKTLDFSKLTQGVYYVKAETAKAIKVTPFIIV
                     PDQVKIVKGATKTYNTPVFETENDIIKLDIDNKDQHEVSITVYAKNSSIPLEEVRLNA
                     PKITKNYNFKSLPVSEYKIIVYQGDYSYVKTIKR"
     gene            complement(159079..159966)
                     /locus_tag="KQA_RS0201705"
     CDS             complement(159079..159966)
                     /locus_tag="KQA_RS0201705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_010177448.1"
                     /translation="MTEQKINYNKPSFEHLAPDIGNSLIYKRFNIENKNKQPIWHYHP
                     EIEIVYVNEGSGKRQIGSHVSYYQNGDLICIGANLPHCGFTDGFSKTRNETVIQMLPE
                     YLGKDFFNVSEMNPINALLDRAKQGLVFFGETKKEVGAIIENMYSKSPFERILDSLLI
                     LHKLEASKEFEILNAEGFVLKAQAQDNSRINNTFNYVQKNFKKQISIEEISDFVNMTP
                     PAFCRNFKKVTGKTFTQFVNEYRLVHATKLLTEKQESIQGICFECGFNNFSHFNKVFK
                     KYTGKTPTDYRKEMNFTIS"
     gene            160131..160718
                     /locus_tag="KQA_RS0201710"
     CDS             160131..160718
                     /locus_tag="KQA_RS0201710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177449.1"
                     /translation="MKKLFKGGLLSVALLAAVVVNAAEKMNVKVLGSKALNVSLSGVA
                     KGESLSIVDKSGITLFSETLSQADVFEKTFDLTYLPEGVYFLESNEEKRINVSPILIA
                     NNKVSLIAGGSKVYNEPRVVVNGSIAKVVLDNSSKTDVVITVRDADDSELLRSEVLTA
                     ENIYKKFDFSALPKGETYTITVKEDDYYFIKEINL"
     gene            160877..161944
                     /locus_tag="KQA_RS0201715"
     CDS             160877..161944
                     /locus_tag="KQA_RS0201715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate synthase"
                     /protein_id="WP_010177450.1"
                     /translation="MAGNSFGKVFKLTTFGESHGVAIGGVIDGCPAGVTIDFDAIQAE
                     LDRRKPGQSAIVTQRKEPDTVEFLSGIFEGVTTGTSIGFVIRNANQKSKDYSHIKDSF
                     RPSHADYTYYKKYGDVRDYRGGGRSSARETASRVVAGAVAKQVLKGVSFNAYVTGVGH
                     LKLTTPYNELDLSATESNIVRCPDQNMASEMESYIKQIRKEGDTVGGVVSCVISGVPV
                     GLGEPVFDRLHAELGKAMLSINAVKGFQYGSGFEGSALKGSQHNDLFNADGTTKTNLS
                     GGIQGGISNGMDIYFDVAFKPVATIMQDQHTIDKEGNIVEMQGKGRHDPCVVPRAVPI
                     VEAMAALVVVDYMLQNRASQV"
     gene            complement(162022..162732)
                     /locus_tag="KQA_RS0201720"
     CDS             complement(162022..162732)
                     /locus_tag="KQA_RS0201720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_010177451.1"
                     /translation="MQDNSILKCAIVDDSKLQRLAIVKLIEEHSSLELVAEWNNAIET
                     KNGLLDIPVDLLFLDIEMPILTGFDLLDDLENKPKTIFVTGKTKYAFKAFDYDAIDYL
                     RKPLKRDRFNAAVEKALSQTKMAATSKSAENEDYIFVKSNLKKRKIFLNNLKYVEALG
                     DYVKLIMDNSDPVVVLATMKSFESQLPSERFLRVHKSYIVNLKKVERYNNRNIEIDQE
                     QIPVSRHKKAALSEALSS"
     gene            162910..163248
                     /locus_tag="KQA_RS0201725"
     CDS             162910..163248
                     /locus_tag="KQA_RS0201725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019388304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="WP_010177452.1"
                     /translation="MNHYETVFILNPVLSEEQIKETVKKYEDLLTENGAKMVAKEDWG
                     LKKLAYPIQHKKSGFYHLFEYTVSGEVINKLEILFRRDERIMRYLTVSLDKHAISWAE
                     RRRVKLKQKA"
     gene            163251..163547
                     /gene="rpsR"
                     /locus_tag="KQA_RS0201730"
     CDS             163251..163547
                     /gene="rpsR"
                     /locus_tag="KQA_RS0201730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010229177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="WP_010177455.1"
                     /translation="MASIEQQAKGKKDGEIRYLTPLNIDTNKEKKYCRFQKSGIKYVD
                     YKDPDWLLGFLNEQGKILPRRLTGTSLKYQRKVSVAVKRARHLALLPYVADLMK"
     gene            163560..164012
                     /locus_tag="KQA_RS0201735"
     CDS             163560..164012
                     /locus_tag="KQA_RS0201735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="WP_010177456.1"
                     /translation="MELILKKDVENLGFADDIVEVKNGYGRNFLIPQGYGVLATVSAK
                     KVLAENLKQRAYKEQKLVDDAQALANKLNGLEIKISSKSGAGGKLFGSITNADVADAL
                     AKEGISIEKKFISVPGGSIKRLGSYEAPVRFHRNVIANAAFEVVAEKA"
     gene            164095..164577
                     /locus_tag="KQA_RS0201740"
     CDS             164095..164577
                     /locus_tag="KQA_RS0201740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177457.1"
                     /translation="MKYARLSKEQLEALHQEFINFLATQSITGDEWAEIKANKPEVAE
                     EEIDVFSDMIWEGVLNKVEFLEHFSKDQIHLFFLTEEKMHLIAIKVKNKAIDLLTDEG
                     YKWLQQNLMDDSVAFFNATKEYTEDKNVDKFKIIEQGANITKGDLYAYFAKLLDNKKD
                     "
     gene            complement(164861..165721)
                     /locus_tag="KQA_RS0201745"
     CDS             complement(164861..165721)
                     /locus_tag="KQA_RS0201745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein"
                     /protein_id="WP_010177458.1"
                     /translation="MQESITQNVTKTSSDVMNSLSGLFNSLQEGVAQYGLKIVGGIVA
                     LIIGLWIIKVILKAVRKAFDTSKIDSTLKPFLLTLVGFLLKVLLFISIAGIVGIPTAT
                     FAALLAAVGLAIGGAFNGSLGHMAAGVMLLIFRPFKVGDLIETNGKLGFVKEISVFVT
                     ILETFQNKTEIIPNGSITAAAITNLTTIGHLRVDMPFAIQYGTDIKKAKEVVMNVLKA
                     DDKVMKDPAPRVAVNNLGPNGVELLALPYSTSDDYWDVYWDTRQKIVEALGEANYDAP
                     LPQRIVTMKS"
     gene            complement(165837..166262)
                     /locus_tag="KQA_RS0201750"
     CDS             complement(165837..166262)
                     /locus_tag="KQA_RS0201750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF393 domain-containing protein"
                     /protein_id="WP_029209408.1"
                     /translation="MDYNNLPKDIKIILFDGVCNLCSGAIQFMIKHDKKRNFRYASLQ
                     SELGKELLAERNIDPKIIDSIILIDPKKAYYFKSTAALEISKELSGLYPLLRIFLFFP
                     EKMRDPIYDFIAKNRYKWFGKKESCMIPNDEIKSLFLDF"
     gene            complement(166249..167166)
                     /locus_tag="KQA_RS0201755"
     CDS             complement(166249..167166)
                     /locus_tag="KQA_RS0201755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177460.1"
                     /translation="MRIPNPDLLLMKKSLTPIAISLLLSIHLVNCQESSKNRPNPIEL
                     TSDFKSYWYQGEAEISTYELSQNRYGELRNGTATLIYVTEDFLPIKQVKADISAPKNI
                     PVLKLNSVKKFTTGIYPYSIMQSSFSPLKGEKKHALKTTASIQEWCGQTFMQLNNKKN
                     FEIDIKSYFASEGDQKLSLQKSILENELWNLIRIHGDKLLPKGEINCIPSFEFLRLNH
                     KKTQSYKAIASIQKNNNLNTFSLTYPELKRSLKITFQQQFPYIIESWSEEISPHLPTT
                     AKRITTKLLPYWNQNSNKFTPLRKELGLQ"
     gene            complement(167217..167807)
                     /gene="maf"
                     /locus_tag="KQA_RS0201760"
     CDS             complement(167217..167807)
                     /gene="maf"
                     /locus_tag="KQA_RS0201760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation protein Maf"
                     /protein_id="WP_010177461.1"
                     /translation="MLQEKLKNHQIILASGSPRRQQFLKDLEIDFEIQLQPVDEVYPD
                     HLKAEEITNYLSELKAAAFKQRLQHNDILITSDTIVWHNHHALGKPQSAEHAKLMIAS
                     LSNDWHDVISSVSFTTKNKQITKHFTTKVHFKELTIEEIDYYVTNYNPIDKAGAYGIQ
                     EWIGLIGIDKIKGSYFNVVGLPTHIVYETLIALTKP"
     gene            complement(167828..168301)
                     /locus_tag="KQA_RS0201765"
     CDS             complement(167828..168301)
                     /locus_tag="KQA_RS0201765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA
                     (pseudouridine(1915)-N(3))-methyltransferase RlmH"
                     /protein_id="WP_010177462.1"
                     /translation="MTITLLAIGKTDSLQLTQLIEDYKKRLSFYIKFNFEIIPDLKKV
                     KNLSETQQKEKEGELILKKINTSDTLILLDENGKQFNSVDFSNYLQKHMNSGIKNLFF
                     VIGGPYGFSETIYKRANGKISLSKMTFSHQMVRLFIIEQLYRGFTILKNEPYHHR"
     gene            168351..169208
                     /gene="nadC"
                     /locus_tag="KQA_RS0201770"
     CDS             168351..169208
                     /gene="nadC"
                     /locus_tag="KQA_RS0201770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007649995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide diphosphorylase
                     (carboxylating)"
                     /protein_id="WP_010177463.1"
                     /translation="MISKEQFNHEIELIIANAIREDVGDGDHSSLACIPKDTQGKAKL
                     LVKDEGILAGVAFAKQVCAYVDPNLEIEVLIPDGSAVKYGDIAFYISGSSLAILKAER
                     LVLNAMQRMSAIATKTKFFVDLLAGTGTKILDTRKTTPGIRALEKWAVTIGGGENHRF
                     ALYDMIMLKDNHIDFAGGITQAINQTKSYLKETGRDLKIIVEARDLNEIKEILKSDGV
                     YRILIDNFNYEDTREAVRLIGDTCLTESSGGIDEHTIRKYAECGVNYISSGALTHSVY
                     NLDLSLKAV"
     gene            169210..170133
                     /locus_tag="KQA_RS0201775"
     CDS             169210..170133
                     /locus_tag="KQA_RS0201775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YihY/virulence factor BrkB family protein"
                     /protein_id="WP_010177464.1"
                     /translation="MSFKLTKIGLKIPGVLLLTKVLKKIVIPGFEGLSIYDLVKMYVN
                     GIVEGAFSTRASAISFSVFTAIFPFLLFLLNLISVIPIDGFQEEFIVFINSLLPPRTS
                     DFFDSIIYDIANKPRPGLLSSTFVLSMVFMTNGINAVFSGFQNSFHTKISRNFLKQYG
                     VAFWVAIIVALFLISTVYIILYFTYLVTAYEQFLIGDTIFWLKFGRVGIFILMIFTTM
                     ATLFYFGTKEGRITRFFSPGAVLTTVLIIVTTYLFGFYIDNFSRYNELYGSIGALLIL
                     MFYIWINANLVLLGYELNASLRNLKMQTVNK"
     gene            170147..170710
                     /locus_tag="KQA_RS0201780"
     CDS             170147..170710
                     /locus_tag="KQA_RS0201780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chalcone isomerase"
                     /protein_id="WP_010177465.1"
                     /translation="MKKVLLALVALMMLNSAVAQTVIGDATLPNNKTYESHELILNGA
                     GLREKLWFDLYAAGLFLKEKNTDADAVVAADQPMAIHLVILSGMLSKKKMIGAFRDGF
                     ENTNDKATVQKLQSKIDKYVSFISEEISVSDRYDIIYTTEKGNELYKNGKLLGAIEGL
                     EFKKALFNIWLSKEPVDDDLKDSMLGN"
     gene            170759..171325
                     /locus_tag="KQA_RS0201785"
     CDS             170759..171325
                     /locus_tag="KQA_RS0201785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_029209410.1"
                     /translation="MKQLLITLALLCSVVATGYAQIPVGRTVMEYEVEYDDTTLKMNG
                     AGTCSMLFIELYSGGLYLQEKSSDPIAIAYDDETMAIRIKITSKLIKRETMLSAIEEG
                     FEKATEGKTGPLKDRIAKVREYYAKPISKGDLLELVYVKGKGVFCYLNSKELGVIEGQ
                     DFKFALFKIWLGENPASESLKKGMLGDF"
     gene            171507..171764
                     /locus_tag="KQA_RS0201790"
     CDS             171507..171764
                     /locus_tag="KQA_RS0201790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2061 domain-containing protein"
                     /protein_id="WP_010177467.1"
                     /translation="MITEKVAGANTTYAQDASSEKPIRSVVKAVSWRVVGTLDTLVVS
                     YLVLGEGRLGEASAIAGVDFVTKMILYFAHERVWNKVKWGK"
     gene            171843..172472
                     /locus_tag="KQA_RS0201795"
     CDS             171843..172472
                     /locus_tag="KQA_RS0201795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoadenylylsulfate reductase"
                     /protein_id="WP_010177468.1"
                     /translation="MSFTQEEIVKYNEELKGKTPLEIVQWAVSKAKKPVVTTNFRPYE
                     ASILEVCVAAKADIPVIWCDSGYNTPNTYRHAEAVIAQLNLNVDLYVPQQTVAHRDVV
                     MGVPGVDDPKHAEFTKRVKLEPFGRAMEAHKPDVWFTNLRKGQTTLRDSLDILSLGAN
                     GVLKVSPFYNYSDAELDVYLSEKGLPNEHKYFDPTKVLGNRECGLHTSN"
     gene            172660..173562
                     /locus_tag="KQA_RS0201805"
     CDS             172660..173562
                     /locus_tag="KQA_RS0201805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase subunit CysD"
                     /protein_id="WP_010177469.1"
                     /translation="MSKELSINPLETEAIHIFREVVSQFEKPVLLFSGGKDSITLVRL
                     AQKAFWPAKIPFPLLHVDTGHNFPETIEFRDRLAKELGVELIVRNVQDAIDAGKVKEE
                     TGKYASRNSLQTVTLLDALEEFKFDAAIGGARRDEEKARAKERIFSVRDDFGQWDEKN
                     QRPELFDMLNGKIDLGQNVRVFPISNWTELDVWSYIEQEEIEIPSIYFAHKRKTFVRD
                     GMIWSAEDDVVYREEDEIVEERLVRFRTVGDMSCTAAVLSDAVSIEKVVGEIRESTIS
                     ERGARIDDKRSEAAMETRKQQGYF"
     gene            173708..174955
                     /locus_tag="KQA_RS0201810"
     CDS             173708..174955
                     /locus_tag="KQA_RS0201810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate adenylyltransferase"
                     /protein_id="WP_010177470.1"
                     /translation="MEVLKIATAGSVDDGKSTLIGRILYDTKSLTTDKLEAIETRSKA
                     NGFDYLDFSLATDGLVAEREQGITIDVAHIYFSTAKKSYIIADTPGHIEYTRNMVTGA
                     STSQASIILVDARNGVIEQTYRHFFINNLLRIKDIVVAVNKMDLVDFSEEKFNAIKAE
                     FEKMIAQSDYKDQNITFVPISALKGDNVVSTSENTPWYKGESILDHLEKLEAQDVFEK
                     GQARFPVQTVIRPKKDEFHDFRGYAGKLYGGDLAVGDQVTVLPSLTKSKIKEIYFFDK
                     KFDKAGRGSSINVTLEDNINVSRGDMIVKTGEEPGVHKTLKAKVCWMDSKNLVGGTKY
                     LLQHGVNRVQAMVTGIDNVLAPDFSGEDASADALALNQIGEVNIKLAKPVFYDKYAEN
                     KTNGSFILIDPQTNHTAGVGFIQ"
     gene            175075..177165
                     /locus_tag="KQA_RS0201815"
     CDS             175075..177165
                     /locus_tag="KQA_RS0201815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite reductase"
                     /protein_id="WP_010177471.1"
                     /translation="MQSFRTEIENPIVEKDIIELADKIQMFHNGKIDEEKFRSLRLAR
                     GVYGQRQEGVQMIRIKLPYGKVRSNQLRRICAVSDEYSRGRLHITTRQDIQIHYVDLN
                     RTPELWAELEKDEVTLREACGNVVRNVTASETAGFDVNEPFDVQPYAHAIFEEFLRNP
                     ICQEMGRKFKVSFSSTDEDTGLSYLHDIGFIAKIENGVRGFKVMVAGGLGSQPHLAET
                     LYEFLAAEEIIPAMNAILRVFDRFGERKSRAKARMKFLMAKIGLDAFKELVEEQRIAV
                     PYTSVAIDADAYPQPVIAEVSEIPSVEIKDQKAFTQWKATNLIPQKQAGYIAIGVKVL
                     LGDFYTDKARLLADLVDKYAAGEIRLTLRQNIVIPHVKEELIEVVYAELEKLGFVDAG
                     YNKAVDITACPGTDTCNLGIASSTGIAEELEKVIASEFPQYLNNEDVVIKISGCMNAC
                     GQHNMANIGFQGMTIRTKDKKVAPALQVLLGGGNFGNGEARFADKVVKIPSRRGPEAL
                     RRILNDFDANGNGKKFEEYYAEKGERYFYDFLTELSEADSLPAEYFIDWGTNEEYVKA
                     IGVGECAGVVIDLIETLFLESEEKIANAKISFDNGVYSDAIYHAYSSQINSAKAILLA
                     ENKKTNTQADIVAGFDKEFVETGVIKLEGTFADSVYAINKNAPTKDFATDYIADAEAF
                     LVAVRKFRAASQNA"
     gene            177169..177942
                     /gene="cobA"
                     /locus_tag="KQA_RS0201820"
     CDS             177169..177942
                     /gene="cobA"
                     /locus_tag="KQA_RS0201820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III C-methyltransferase"
                     /protein_id="WP_010177473.1"
                     /translation="MSNYNENTSKGKLTVVGAGPGDVELITLKAIKALKSADAVLYDA
                     LVNPELLDYCTNADLLYVGKRKGCYAFQQEQINELIVQYGKSHGHVVRLKGGDPFIFG
                     RGAEEMEYAAKQGMEVAMVPGLSSSVSVPAMQNIPVTKRGSAESFWVITATTKEHKLS
                     KDVLTAAKSNATVVILMGMHKLGQITEVFANEGKSETPVAIIQNGTRDTEKVVVATIA
                     TIEKEVKKQELSSPAIIVIGEVVNHRTSLLEMQQKLNEV"
     gene            178034..178618
                     /locus_tag="KQA_RS0201825"
     CDS             178034..178618
                     /locus_tag="KQA_RS0201825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="siroheme synthase"
                     /protein_id="WP_010177475.1"
                     /translation="MERNNLYPVFLKVKNLNVLIVGGGNVAEEKLHFLTKSSPDAKVL
                     LVAPMFREGTIALANKFCATMVTDVYHEKYLEGRHIVIATTEKPEVNVQVWKDCRAQA
                     KLVNVADNPPYCDFYMGGIVTKGNVKVAISTNGKSPTTAKRLRQFFEEVIPENVDDLV
                     QNLNEYRKTIKGDFEEKVETLNEFTKGLIAKKEK"
     gene            178618..179673
                     /locus_tag="KQA_RS0201830"
     CDS             178618..179673
                     /locus_tag="KQA_RS0201830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="WP_010177477.1"
                     /translation="MIKTDILIIGAGPTGLFCVFEAGLLKLKTHLIDALPQPGGQCSE
                     IYPKKPIYDIPGFPEVLAGDLVDNLMEQIKPFEPGFTLGDRAETIETLDDGTFVVTTK
                     RGVKHNAPVVAIAGGLGSFEPRKPPIPGIEGFEDKGVSYIIRDPEVYRDKKVVIAGGG
                     DSALDWSIFLADVAAEVTLVHRRKEFRGALDSVEKVEELSKAGKINLITDAEVKELFG
                     EGELSGVGIKHKEKGDIKLEVDNFIPLFGLSPKLGPIGNWGLEIEKNAIKVDNSYDYQ
                     TNIPGIYAIGDVNTYKGKLKLILSGFHEAAIMCQSAYQRIFPDKKYVMKYTTVGGVTG
                     FDGSKKEAKKEVVKAIG"
     gene            179822..180139
                     /locus_tag="KQA_RS0201835"
     CDS             179822..180139
                     /locus_tag="KQA_RS0201835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_010177478.1"
                     /translation="MSDVTIKITDREGKVHEVQAPTDMAMNLMEVCKAYELPVEGTCG
                     GMAMCASCQCYVTSDTPLPEMGYDEDMMLAEAFHVEDNSRLGCQIPITPELDGLEVTL
                     APE"
     gene            180342..181694
                     /locus_tag="KQA_RS0201840"
     CDS             180342..181694
                     /locus_tag="KQA_RS0201840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent monooxygenase"
                     /protein_id="WP_010177480.1"
                     /translation="MKQKKIAIVGSGLVGSLLAIYLRKRNYQITVFDRRPDIRKIKFS
                     GRSINLAMSVRGWNALEAIGIKEEVEGLGIPMYHRYIHVNTKDDYTQKYGKDGEAIYS
                     ISRGVLNRKMIDLAEKEGVVFKFEEKVWDVNLPEAKLYTGETEKGKWEEHEFDLIFGC
                     DGAFSRIRHKMQRRSRFNYSQDFLNTGYKELSIPADANGKHVIDKNALHIWPRGKFML
                     IALPNLDGSFTCTLFMPHEGENSFESLTTPQEVRVFWQTYFPDTLQIMPTLLEDYMSN
                     PTSALVTMKCYPWTYWNKVALVGDSAHAVVPFYGQGMNAGFEDVFELDQIIERLGDTD
                     WQNIFETYQEQRKPNADAIAELSYRNFMEMSQKTADPNFILRKKIEKKFSEHYPELWQ
                     PLYSRVTFSNRPYSEAISYGEVQAEIMDQVMQMENIKQDWDTDVVMEFIKEKSSKSMI
                     "
     gene            181733..182173
                     /locus_tag="KQA_RS0201845"
     CDS             181733..182173
                     /locus_tag="KQA_RS0201845"
                     /inference="COORDINATES: protein motif:HMM:PF13673.5"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family N-acetyltransferase"
                     /protein_id="WP_010177483.1"
                     /translation="METHFVSIGSSLYKEACQLRKELFFKDLENAELLLNDNYEKNSM
                     HLVIESKGAVIGTGRLTITDNNTIGIISQMAIDPDFQRLGLGKFILQSLLKRGRELNV
                     NRITLNARLTAITFYAKNEFIPIGEVFASTKTGVLHQQMELQLG"
     gene            complement(182223..182588)
                     /locus_tag="KQA_RS0201850"
     CDS             complement(182223..182588)
                     /locus_tag="KQA_RS0201850"
                     /inference="COORDINATES: protein motif:HMM:PF06094.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamylcyclotransferase"
                     /protein_id="WP_010177485.1"
                     /translation="MNNEIFLFVYGTLLNKHKNPFAQLLKKNSTKIAKGYIYAKKYHL
                     GEFPGIKLDSNKTYKTYGELLKITSNNTFVLSELDFYEGFFPKKPEESLFIRTTTKVF
                     TKGNIVDAFVYEYTKEINP"
     gene            complement(182581..183225)
                     /gene="msrA"
                     /locus_tag="KQA_RS0201855"
     CDS             complement(182581..183225)
                     /gene="msrA"
                     /locus_tag="KQA_RS0201855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-methionine (S)-S-oxide reductase"
                     /protein_id="WP_010177486.1"
                     /translation="MKSLVILSLFILGINACINNPKNPISKINSEPIQTQRNDGLQNA
                     YFASGCFWCVEAIFESVKGVQEVVSGYSGGITDNPTYKQVGSGNSGHAETIEVQYDPK
                     IINFKTLVKVYYGSQNPTTYGQAPDFGSAYRSIIFFQNENERLIAVEARKEVQNTISK
                     KVRTEIIPFEKFYKAEAYHQDYEKRNPEYPYIVRVSIPRLNRFKAKFPELLKNE"
     gene            complement(183343..185010)
                     /locus_tag="KQA_RS0201860"
     CDS             complement(183343..185010)
                     /locus_tag="KQA_RS0201860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="WP_010177488.1"
                     /translation="MLEISDLKSKKLPELQEMAKALKVPKFRTLKKLDLVYQILDHQA
                     DDPTKVAKVASVLKEEPTETKVNESKPEAPTKTAKETTTPAPSKPKRERKERVVPKKE
                     NNNTPELAKPKRKAPEKDAAPVKEVVKNEKREPNKPRFEKNDRGNNANNNHKNKNHKN
                     NNGNTRDNKGNRDPRNRYKEPDFEFDAIIESEGVLDIMQDGYGFLRSSDYNYLSSPDD
                     IYVSQSQIRLFGLKTGDTVLGQVRPPKEGEKYFPLIKVNQINGLSPQVVRDRVSFEHL
                     TPLFPQEKFNIADRQSTISTRIMDLFSPIGKGQRGMIVAQPKTGKTMLLKDVANAIAA
                     NHPEVYQMILLIDERPEEVTDMQRNVQGEVIASTFDKEAHEHVKVANIVLEKAKRLVE
                     CGHDVVILLDSITRLARAYNTVQPASGKILSGGVDANALHKPKRFFGAARNIEGGGSL
                     TIIATALTETGSKMDEVIFEEFKGTGNMELQLDRKISNRRIFPAIDLVSSSTRRDDIL
                     LDDTTMQRMWVLRKFLADMNPVEAMESINQRVKQTKNNEEFLISMNG"
     gene            185302..185700
                     /locus_tag="KQA_RS0201865"
     CDS             185302..185700
                     /locus_tag="KQA_RS0201865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4293 domain-containing protein"
                     /protein_id="WP_010177491.1"
                     /translation="MIQRIQSVYLLLAALVSGVLSYFFPTGFDKVGEISAPFYYEMLL
                     ISALLSFIIIFVFKNRKLQFVLGRLNILLNVILLGVFVYLTLTVSGEVFASEKGIGRF
                     IPVLSIVLIVLANKAIKKDEQLVKSVDRLR"
     gene            complement(185789..186088)
                     /locus_tag="KQA_RS0201870"
     CDS             complement(185789..186088)
                     /locus_tag="KQA_RS0201870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDGSH iron-sulfur domain-containing protein"
                     /protein_id="WP_010177493.1"
                     /translation="MRYYLKSILTQVEVYCNLELKKYTMSDKKTPIKVSLEPGKKYAW
                     CTCSHSENQPFCDGSHRKHNATPSLAFEVTEAKEASLCTCKLTNNPPYCDGSHRK"
     gene            186249..>188702
                     /locus_tag="KQA_RS18330"
                     /pseudo
     CDS             186249..>188702
                     /locus_tag="KQA_RS18330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522299.1"
                     /note="too many ambiguous residues; incomplete; partial in
                     the middle of a contig; missing stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
     assembly_gap    187632..187681
                     /estimated_length=50
                     /gap_type="within scaffold"
                     /linkage_evidence="unspecified"
     gene            complement(189197..190444)
                     /locus_tag="KQA_RS0201880"
     CDS             complement(189197..190444)
                     /locus_tag="KQA_RS0201880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OmpA family protein"
                     /protein_id="WP_010177496.1"
                     /translation="MKKTLLIIITTLTIGALHSQENTYNKWSIELDAGALKTFNLASP
                     GHFSPVPEFVAGNFGVRYSLNTKFGIKADFGYQDINNDDNSIEFETKYYRGSIQGVIN
                     LGNIMGFRTTAFKNIGLLFHGGGGLSSFDYNTLGNTGDELAVNFILGLTPQLKLSKRV
                     SFQVDLSYLRHLGQNFNWDGAQNVSGFGSMLTATAGFAINLGKNENHADWTIEDGASS
                     KQLEELSTKIANIEADMIDTDQDGVADYLDREPNTTSGVTVNTKGVTIDNNRNGIPDE
                     FETALDRKYANDTPTATTAPEVSYDEAIKKLLGEGYVNVYFNTASATPSIYSLDAINY
                     LIEYMKEHPEAKAELIGFADQRGSDSFNSSLSARRAKKVYDILIESGIAAERLSHTGN
                     GETASGTSKESLQLRRKVTFKLK"
     gene            190800..191051
                     /locus_tag="KQA_RS0201885"
     CDS             190800..191051
                     /locus_tag="KQA_RS0201885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type B 50S ribosomal protein L31"
                     /protein_id="WP_010177497.1"
                     /translation="MKQGIHPENYRLVAFKDMSNDDVFITKSAANTKETIEIDGVEYP
                     VIKLEISRTSHPFYTGKSKLIDTAGRIDKFKNKYAKFKK"
     gene            191190..192365
                     /locus_tag="KQA_RS0201890"
     CDS             191190..192365
                     /locus_tag="KQA_RS0201890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphate thymidylyltransferase"
                     /protein_id="WP_010177499.1"
                     /translation="MNYILFDGPQRQALLPFTYTRPVADIRIGILTIREKWERYLGST
                     TSTVTEDYLAEKWPMVELESNTFICGGILPTKKLVKAIKALQLKEVLYSENEELIAFC
                     VPEGEDPDLDSYKAIQFNDAFAEVKNTWDIFSLNEQAIEADFELLTVDETSQKLSETN
                     KVIGDGRVFIEEGASVECAIFNTTKGSIYIGKEATVMEGAIIRGPFALCEYATIKMGA
                     KIYEGTTVGPHSKVGGEVGNSVIFGYSNKGHDGYLGNSVLGEWCNLGADTNTSNLKNN
                     YAEVRLWSYETSGFAKTGLQFCGLMMGDHSKSGINTMFNTGTVIGVSANIFGGGFPRN
                     FIPSFSWGGSAGFVTYKTNKAFEVAEKVMQRRKIDFTAQEQAVLEHVFEETVRWRKE"
     gene            192501..193076
                     /locus_tag="KQA_RS0201895"
     CDS             192501..193076
                     /locus_tag="KQA_RS0201895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_010177501.1"
                     /translation="MKSLLKVIALYKNEEALLKGLLKNNRSAQRKLYELHAPKMLSVC
                     RYYIKDLHHAEEVMLNGFFKVFQNVNKFKNEGSFEGWIRKIMVREAISYLRSQKKIEF
                     ITETIVLESEYENNIHSTIEVDQIQHCIDLLPEGYKIVFVMYAIEGYKHSEISKMLKI
                     TEGTSKSQLFKARKLLQKKVNELNRTGYATK"
     gene            193063..193857
                     /locus_tag="KQA_RS0201900"
     CDS             193063..193857
                     /locus_tag="KQA_RS0201900"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177503.1"
                     /translation="MLQNEFEKVNKEMLEARSIQPSVDAWDRLSKRLDDDQQNKHKQY
                     KRKYWWLGIAASLIGALFITQQFLYSDFITRSTDVDIVVTENKDIDHLNRKKILKTTT
                     LVTEKQEFNIDSNKSVKHKTALVNREEKSSKKEAKKLVVLNVVPKEKVMMPSQVAHLE
                     KKDTVLKGVTFQDQKIKELLVEVDALEETEVVLSNEIIEDLLLKAQIEIDIENSQIEN
                     KETVNASSLLKSVENDLDMSFRNKVLKALKENYSKVKTGIVQRRDD"
     gene            194012..195076
                     /locus_tag="KQA_RS0201905"
     CDS             194012..195076
                     /locus_tag="KQA_RS0201905"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177505.1"
                     /translation="MNVITKYMVLVLGFVMNIQVANAQDTIQKDVNQFKIKKLETLKA
                     DIKKQEREFLKQEVAAIDELYSKKEITKEQAASQKMEAAKKRALNIDNRIAIINNKIL
                     ILNRNQKDANYKGVIIGDSLKEVFNSIDCESDVPDEKEYDKRIKSGLVLAFGFNNALF
                     DGMDLEDSPYKFAGSRFFEIGWAWNARVFEHTNFMRLRYGLSMQINRLKPDDNKFFVQ
                     EGNKTMLANFPSNLKKSKLTMTNLVLPLHFEFGPSKKEEKETYTKYSTKHKFKIGVGG
                     YGGLNIGTKQKLKFKEDGERVKEKQKRDFNRTKLIYGVSSYIGFGASTLYVKYDLSPI
                     FKNQDVDQNNISIGIRFDVD"
     gene            complement(195259..201912)
                     /locus_tag="KQA_RS19435"
     CDS             complement(195259..201912)
                     /locus_tag="KQA_RS19435"
                     /inference="COORDINATES: protein motif:HMM:TIGR04183"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="T9SS C-terminal target domain-containing
                     protein"
                     /protein_id="WP_010177507.1"
                     /translation="MKTKTLYLVLLFLVTLSSYAQTYEARINFQNNPNITTPPTGYIA
                     DHGKAFGTSQITIDNSNYNYGWKLKSDDTPFDASADVPGNNNGIGRNRLGIAYDNATD
                     IEKLTGTLVHLQGNHISTWESQPRGNEIYWEIEIPNGIYDITIGVGDVSNSIDSRHAL
                     TIEGISIVPGFIPTPRETREETLTIEVTDGLLTVNALGGFNTKINYINIDTSTNTADL
                     NSLNFTNTNVSTITPENTTVTLIEELTASSDPATLTLSIENLLEVPADTSITNGWLTI
                     QKTGIVGNYTFEINTSNLADGTQETATIIATTKGYKPAIINLALTVGIIPCNPISTLD
                     CNQLKAKLPLQLTFDGSQGGISNTGFTMVDAPSARLASDQPIFSNEIPGYEPSKLLLE
                     NNQLIITATKGIAYQDNTTSRNTNSQINALGTGIDFSELTNFDIITTINQPYSDTSNN
                     FEQAGIWLGLNEDNFIKFVIRNGNNLEVLTELNALAPNAERINLNVPNLNTSKVQLRL
                     HIDVNTNSITAFYKLNDTTEVSIGTIELPQEIRDGNTNYQNLSFAGIYVSKRNENENT
                     EVTYTFEDFSIIPTIEEELINLKINFTTNGSPDIIDYLKDTGLPFEDRGNNFSYGWLT
                     TDGTSPLDLSRNTRNRNTNGVSELQNTLLHMQYGDTGGNNGNTTEGIWELELPEGLYN
                     IIVSVGDPLVDSPATTPLHTINIEGINTINDFTPTGNATTGNRFTTATLTTNITDGRL
                     TIDASGGFNTKINSIEIEQIANSVRPFFTDVNPANNTTDVALENFQIGVSLITPNGYE
                     LDENTIDGNVNLFEVTPTGEVLIPSNSNDTGGGDFINLTPLTPLKENTTYIYRITSNV
                     EANLIGNLNDRLSFFPFESTFTTGMRSTQGSNSRDLTGVAFQKVFGTDLGDGTENERF
                     SSLIIGPDGKLYASTIGNFASDGKIHRWTIETDGSLSNLEILSPELNGAPHPIDGIRD
                     NDTRLIIGLTFDPTSTPTNPIAYITHSKSALSNAPEWDGVLSRLSGPNLEVVEDILIH
                     LPRSAKDHLTNSLAFDESNDLYISQGSNSAGGEIDPAWAFRPERLLAAAILKVELDKL
                     PTNLPLSVYTTDDISVINNAPSDNILMSNNTYNPYATNSPVTIFASGVRNAYDLIWHS
                     NGWLYVPTNGTAGNNTNSPNAPSTADYTLARRIDGLTSIPDVPALQGGNTQKDWLFKT
                     QGGSYHGHPNPYRGEFVLNHGGLAYSNLPGQEDNPYIDVPKYPSTVLPDPNYQEPAYD
                     FGFNKSPNGVIEYKSNAFGGRLQGLLFVSRFSGQDDLLGLDVNSASGDVIDAYNAIPG
                     LQGFDDPLDVVEDVTTGNLYVSEYDRAGGGTPRLTLLRALSGPNNIAVSSDELFFETT
                     VNTDGPMTETNTISVSNTGQSTLEINTISLSGNFSNQFSFSPTATAVSINPGETYELD
                     IIYAPDLNQQDLGFQDAILTIESNNPANPNTRINLYALKKRGFEGGEEPTLQSVVNTI
                     GVGIDVGWTTLANGVNPDPIGDEVETELWVKASDAPVTLTPVARYSPAEELPYGWYTN
                     QQTTQQFNVIDTLETGLQNAQRLFPPSKSGIKEFDPQNEVFGIFVESLFFNRISYTQD
                     PLNIDVAHRTRIYPNKDRNGSIIENSFLIAFEDLNNGDYQDYVFILDNATPATILPTS
                     NGILSLENLTKIPTTNIGFPAEDYLTFHKIRDIRPNTDVQDSNTLRLNNVGTEALVVS
                     DIKISGPSVFSFSILDTTGNPISLPFSIEAGSFADLPIIFDGDGSDGKSFFINEMTVT
                     SDAITTPEVKATLNGSHQQGQEGGREINAQQVFDAFGLQTSMLSIVNDNGTITPPNFR
                     SFRPSSNFPIATNIDMGYEGDMIFSEAFVQADPTQPVIGFQISAMHGPGGNGARFVAL
                     DNTDTVGDINFFHSRTWFQTLLPRNNRGDNISFDTATTISEPFRIAISNYLTTGGNNI
                     DGRRPDLLGARVYRVINNKGELIPNEYIVLQDFVQNGCGAGSANCDWNDNIFYFKNIR
                     PQAVPTATAITNQTATIAQNFELNVTDSFDKGYPGNKLTYIVNLSNGTALPNWLTFNE
                     ATGTVSGIPPVNSQGSILSIAIEAIDFNGLTASTEFTLAIIDTNPPTQPIVTTNATTT
                     NSDIIIFPNPTSDLINIQTQDINSIQSIDFFDSNSAILIASFTTNQLETPNGLQFSTI
                     SYPQGIYLLKINFNNGTSEEHLIEISR"
     gene            complement(202547..203161)
                     /locus_tag="KQA_RS0201915"
     CDS             complement(202547..203161)
                     /locus_tag="KQA_RS0201915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177509.1"
                     /translation="MIKNLFLTISILFFLNTYSQKNGVNIIEEVGKKRTLIFAKNTTN
                     KPRSVFFKVHANGYRRSGDRPVIKQLPPNSKTLLITLIPLVDVPSRYTYTFVANKTLE
                     NIQLKGKEESEADVAELMKQEIVVFTNSSCSKCDNLKKQLNNKHIKYREIDIDLRERF
                     YKYTWKLLEKKGYRTDTLKLPLASVKGKIFHPINSIATFLNEIE"
     gene            203311..204078
                     /locus_tag="KQA_RS0201920"
     CDS             203311..204078
                     /locus_tag="KQA_RS0201920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="WP_010177510.1"
                     /translation="MELKLSRPICFFDLETTGVNISKDRIVEISILKVFPNGNKESKT
                     WLVNPEMPIPTETTAVHGVTNEKVANEPTFKQLAKVISDMIKGCDLGGYNSNKFDIPL
                     LAEEMLRADMDFDMSNNVAVDVQNIFHKMEQRTLVAAYKFYCDKDLTNAHSAEADTTA
                     TYEVLCSQLDKYPDLENDMEFLSEFSTRRKTADFAGFIAFNEKEQEVFTFGKHKGKLV
                     EEVLDKEPGYFGWIQNADFPLYTKKILTAIRLRKFNA"
     gene            204085..204696
                     /locus_tag="KQA_RS0201925"
     CDS             204085..204696
                     /locus_tag="KQA_RS0201925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAA hydrolase family protein"
                     /protein_id="WP_010177513.1"
                     /translation="MKIICIGRNYAAHIEELKNEKPSDPVVFLKPDTSVLLKKQPFFM
                     PDFSNDVHHEIEFIIKINRIGKHINPKFAHKYYDEVSVGIDFTARDVQNELRAKGLPW
                     ECSKAFDGATVLGKWVSKSKFPDISNVNFKLYKNDVVVQDGFTKLMLYSVDELIAYVS
                     KYFTLKIGDIIFTGTPAGVSPVAVNDQLKGYLEEEEMFHIKVK"
     gene            204697..205038
                     /locus_tag="KQA_RS0201930"
     CDS             204697..205038
                     /locus_tag="KQA_RS0201930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hpt domain-containing protein"
                     /protein_id="WP_010177515.1"
                     /translation="MSISYDLEKVKELAGGDESFVEILLQTFLEEIPEDLKNMSDAVA
                     VNDAKVAYQYAHKMKPNFQLFGIDVIDHIKRIESWANEEITFDEAKVALLVVEEKAEK
                     AIVSLRELLNK"
     gene            205045..206307
                     /locus_tag="KQA_RS0201935"
     CDS             205045..206307
                     /locus_tag="KQA_RS0201935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence/damage-inducible protein A"
                     /protein_id="WP_010177517.1"
                     /translation="MLAEIITIGDEILIGQIVDTNSVFIATELNKIGVDVHQISSIRD
                     DREHILKALAEAQSRVDLVLVTGGLGPTKDDITKHTFCEFFNDTLIENKDVLEHVKGL
                     FDKYIKSPISEVNKKQALVPSKAEVLTNEFGTAPGMWLVDKNTVFVSMPGVPFEMKAI
                     VKDQLIPRLQERFNRPYILHKTILTYGMGESRVAERIEDFENNLPTYIKLAYLPSLGR
                     VRLRLSARGDNEKQLKLGIAKAVEQLKDLIGDIIVGFDENESLEHVIANLLTTHNFTL
                     ALAESCTGGKIARGFTKIGGASAYFKGGLVPYDTALKTTILGVPKALIEAHSVVSTQV
                     AASMAEQSLKLFQSDFAIATTGNAGPTKGDSDAEVGTVCIAIASPKGVVSEQFVFSNH
                     RERTIGKAVNKSLELLQEQILAVLGTAE"
     gene            206444..206683
                     /locus_tag="KQA_RS0201940"
     CDS             206444..206683
                     /locus_tag="KQA_RS0201940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011710112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_010177519.1"
                     /translation="MSRVCELTGKKAMVGNNVSHAMNKTKRRFNANLIKKRFFIPEEN
                     SWVTLKVSTAALKTINKIGISAAIKESVEKGIYKK"
     gene            206711..206893
                     /gene="rpmG"
                     /locus_tag="KQA_RS0201945"
     CDS             206711..206893
                     /gene="rpmG"
                     /locus_tag="KQA_RS0201945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011963553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_010177521.1"
                     /translation="MAKKGNRIQVILECTEHKATGQPGTSRYITTKNKKNTPDRIEIK
                     KFNPILKRMTVHKEIK"
     gene            206901..207053
                     /locus_tag="KQA_RS19780"
     CDS             206901..207053
                     /locus_tag="KQA_RS19780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010250750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4295 domain-containing protein"
                     /protein_id="WP_010177523.1"
                     /translation="MAKKSVATLQTGSKRLTKAIKMVKSPKSGSYTFVESIMAPDATK
                     DFFNKK"
     gene            207166..208119
                     /locus_tag="KQA_RS0201955"
     CDS             207166..208119
                     /locus_tag="KQA_RS0201955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002990307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle-docking protein
                     FtsY"
                     /protein_id="WP_010177525.1"
                     /translation="MGFFKKIFSKDKKESLDKGLEKSKTSFFSKLGKAVAGKSKVDDE
                     VLDNLEEVLVSSDVGIKTTVKIIDRIEARVAKDKYLGTAELDQILREEIAGLLSETNL
                     GEAEEFVIPKDKKPYVLMVVGVNGAGKTTTIGKLANQFKKQGLSVVLGAADTFRAAAI
                     DQLQVWADRVDVPIVKQSMGSDPASVAFDSLKSGVAQNADVIIIDTAGRLHNKINLMN
                     ELTKVKNVMKKVIPDAPHDVLLVLDGSTGQNAFEQAKQFTAATEVSSLAITKLDGTAK
                     GGVVIGISDQFQIPVKYIGVGEGIDDLQVFNKFEFVDSFFK"
     gene            complement(208251..209444)
                     /locus_tag="KQA_RS0201960"
     CDS             complement(208251..209444)
                     /locus_tag="KQA_RS0201960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyhydrolase"
                     /protein_id="WP_010177527.1"
                     /translation="MSTQKETNLREEYQLTDEIIDKFGITNPDKLSAATKRALKWPRD
                     LGKDWFFEYEVYDLKGDLAYEEGVVRRDPSALIKVDGLYYVWYTRSTGPSQGFGGDIE
                     NDKVFPWDRCDIWYATSEDGITWKEQGPAVERGPKGAYDDRSVFTVEIMVHEGVYYLS
                     YQTVKSPYTVRVKNQIGLAWSNSPNGPWTKSEEPILSPADNGVWEGTEQNRFRVEKKG
                     DFDSHKVHDPCIIPFNGKFYLYYKGEQMGEEITFGGRQIRHGVAIADNPKGPYIKSEY
                     NPISNSGHEICVWPYNNGVAALITTDGPEKNTVQWSPDGINFDIKSVIKGAPHAIGLN
                     RTLDSEKGPVEILQWGVTHKYMNYDYQYIRGFKTWTIENHTAPGEATKDGTTSNEGSV
                     ITDKF"
     gene            complement(209528..212083)
                     /locus_tag="KQA_RS0201965"
     CDS             complement(209528..212083)
                     /locus_tag="KQA_RS0201965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 2"
                     /protein_id="WP_010177529.1"
                     /translation="MKLFFLISSLALFFISCNQPKSQDTVTPKITDFNFGWKFYLDKG
                     TTDASSENFDDSKWNAVLLPHDWVIEESIDTTNASNQLYMGSGYRKGEGIGWYRKSFA
                     SPSKDKKVYILFDGVYNNSEVFLNGKSLGIHPYGYSPFYFDISNKLKTDATQNILAVK
                     VDHRTYADSRWYSGAGIYRNVSLITTNKLHIPVWGTFITTPKVSKESADVSIKTTLKN
                     NTQATQNFTLKTVIIDPTTDNIITSSASEQTVETNTTIEATHILNITSPKLWDIKHPN
                     LYKIETTITQNDKIIDRDQSSFGVRSIRFDSNTGFFLNGENHKIKGVCLHHDGGLVGA
                     AVPKGVWKRRLLKLKEGGVNAIRISHNPASNEFLDLCDEMGFLVQDEFFDEWDYPKDK
                     RFNQKEKKALPETEGYPRFFQEWAEKDLKNTILSHRNHPSIFQWSIGNEIEWTYPRNA
                     AATGFFNNMNWDGNYFWSEPPYAPEEIKKQLETLPKGKYDIATTAQKLSKWTKELDKT
                     RPVTANCILPSASHLSGYADALDVVGYSYRRVLYDYGHKNYPNKPIMGTENLAQWHEW
                     KSIMERPHISGTFLWTGIDYQGEIREPWPTVVQPSGLLDIAGFEGGSFGMMRSLWNNK
                     PNMFVTTQHIEKSLYKLDNKGKIIAKDPEAWKHALWQWHPINRHWNYENGKMIAVESY
                     SNCTEIELFLNGKSFGKKFLIDNDDHIYKWAVPFNAGTIKLVGIKDGKTITENITTAG
                     APTKIKLSVDNSQLTNNNYDVSHIVAQLVDKDGNPVKTEEQKITFNVPASLRVLGVDN
                     GDKQNNQDFNSNSLTTSKGRALLIVQSTETITEATINATSNTLKSNEILIKVN"
     gene            complement(212298..212957)
                     /locus_tag="KQA_RS0201970"
     CDS             complement(212298..212957)
                     /locus_tag="KQA_RS0201970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="WP_010177530.1"
                     /translation="MGITKIAPSVLAADFANLQRDIEMINNSQADWFHIDIMDGVFVP
                     NISFGMPVLKAIQKHATKPLDVHLMIVDPDRYIKTFVELGAEIITVHYEACTHLHRTL
                     QLIKSYGVKAGIALNPHTNIELLKNVLTETDLVCLMSVNPGFGGQSFIENTYSKITAL
                     RQMATEQQTDLLIEIDGGVSNKNANQLIDAGANVLVAGSYIFGASNPVETVKNLKEQL
                     L"
     gene            complement(213145..214008)
                     /locus_tag="KQA_RS0201975"
     CDS             complement(213145..214008)
                     /locus_tag="KQA_RS0201975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015482077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="WP_010177533.1"
                     /translation="MRQLKITKQVTNRETASLDKYLQEIGKVDLITADEEVELAQRIK
                     AGDERALDKLTKANLRFVVSVAKQYQNQGLTLPDLINEGNLGLIKAAKRFDETRGFKF
                     ISYAVWWIRQSILQALAEQSRIVRLPLNKIGSINKINKTYAFLEQSHERPPSAEEIAN
                     ELDMTISDVKESMKNSGRHVSMDAPLVEGEDSNLYDVLRSGESPNPDRELMHESLRTE
                     IERALETLTPREADVIRLYFGLGNQHPMTLEEIGETFDLTRERVRQIKEKAIRRLKHT
                     SRSKILKTYLG"
     gene            complement(214183..214641)
                     /locus_tag="KQA_RS0201980"
     CDS             complement(214183..214641)
                     /locus_tag="KQA_RS0201980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010522271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_010177534.1"
                     /translation="MENFELDNYDRSIIKELELDGRKAYSAIAQKLDISNTMVNQRVN
                     KMIENGILTGIGPIINEKKAGYDWGAFTGLTLKKDHDSEKIIKKLKEIPEITECYFVT
                     GSFTLFVRINAKSHEHMREILYNKLDHIKGIQKTDSIVDLGCAFKRNITL"
     gene            214797..217391
                     /locus_tag="KQA_RS0201985"
     CDS             214797..217391
                     /locus_tag="KQA_RS0201985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_010177537.1"
                     /translation="MIKINFLLGLLLLSTFGMLGQIEVTGSVTDNIGNFLPNADIIEK
                     GTTNGTTTDFNGNFKLEVNKGATIVISYVGFESQEIEITTQTSFQITLNPDNSLKEIV
                     LVGSRSPKRTVVDSPVAVDIIDIAEVTSKTGKVEITELLQFAAPSFNAQKQSGADGAD
                     HITPATLRGLGPDQTLVLINGKRRHQSSLVNLFGTRGRGNTGTDLNAIPASSIKRIEV
                     LRDGASAQYGSDAIAGVINIVLKTSVNKLTGEVFYGASDVNDNGGFGIPAKEGLDGNT
                     YKATANYGVALNEKGGYVNVTGEFLKKEKTFRPGADFRSKFGEASIDAFHGFFNSEIP
                     INDLSTFYAFGGASIKDTDAFAFDRGANDNRNVTTIYPNGFTPRISSIIRDRSISAGI
                     KSKFRDWDVDFNTTYGINEFHYFIKGSLNASLLEASPTEFDAGGHSLSQNTTGIDLTR
                     NFDVLSGLNIAFGGEYRIENFNIFTGEEASYTQYDLKGVPLSSATPVEDRPTAAQSRP
                     GGSQGFPGYSPANEVDQFRTNLSAYIDGELDVNDNFLIALAGRFEHYSDFGSTFTGKL
                     SSRLKLIPNLNMRGSLSTGFRAPSLVQLFYNLKFSDFEAGELTETLLSQNASPVTQSF
                     GIGKLKEEKAKSASVGFSYSGNGFSASIDGYYTKVDDRIVLTGSFNESSGLNPNLGVA
                     AARFFANGVDTEVLGLDFVFTYTTRFDEHKLGANLIGNLNKLNITEINTGDISEANID
                     TFFGEGEQAFLKFSSPEYKISLGVDYAYSKYSANIVTTFFGNVGPFVSNDDSSLKNTY
                     GSTSTTDISVAYSITDNIKITIGSNNVFNQYPDEQDPNGTESFGIYDAVQQGFGGAFY
                     YTRLSYSF"
     gene            217476..218744
                     /gene="rocD"
                     /locus_tag="KQA_RS0201990"
     CDS             217476..218744
                     /gene="rocD"
                     /locus_tag="KQA_RS0201990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine--oxo-acid transaminase"
                     /protein_id="WP_010177539.1"
                     /translation="MNLEKTFIDQEEMYGAHNYHPLPVVLKKGEGVYVYDVDDKRYYD
                     FLSAYSAVNQGHCHPKIIEALTSQANKLTLTSRAFFNDQLGPFEEFISKMFGYDKVLL
                     MNSGAEAVETAMKLARKWGYQKKGVAQNKATLVFVTGNFHGRTLSIISASQDPVSKNG
                     FGPYMEGISIVPYNDIEALEVCLSTNKNIVGFIVEPIQGEAGVILPDATYLKRVRALC
                     TEYNVLYIADEIQTGIARTGNLLASCGDCKCTDRCNLTKEIKPDIVILGKALSGGVYP
                     VSAVLANNEVMLCIQPGEHGSTYGGNPLACVVSRAALDVIIEEKLTIQAKEKGAYLRD
                     KLEMLKDKYPLIISVRGKGLLNAIEIDSSEQSELAWQICLEFRDNGLLAKPTHGNKIR
                     LAPPLIITYDQIDECVCIINKSLQKFSCHE"
     gene            218737..219735
                     /locus_tag="KQA_RS0201995"
     CDS             218737..219735
                     /locus_tag="KQA_RS0201995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidinotransferase"
                     /protein_id="WP_010177541.1"
                     /translation="MNKGNSMVQDKVNTEGTKVFSQRPALTSNVMMVRPANFGFNDET
                     AENNAFQINNTEISTAEIAAKAVQEFDRFVTMLKKNDVNVEVIQDPQFPVNPDAVFPN
                     NWISFHHPDFVVTYPMFALKRRNERRKEIIDDLKLAYSIKAQFEFEHFEKEKMFLEGT
                     GSIVFDRTHKIAYACKSIRTNEYLFNKFCEDLHFTPILFDAVDKKGQPIYHTNVMMTV
                     GVDFVIICMESIASVVDRKKLEALFKETGKAIIPISIPQMEQFAGNMIQLKNKNEESL
                     LVMSSKAFNSLTQVQLIEMENYAKIIHADLDVIETYGGGGARCMIAEIFLKPLHGK"
     gene            219760..221013
                     /locus_tag="KQA_RS0202000"
     CDS             219760..221013
                     /locus_tag="KQA_RS0202000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidinotransferase"
                     /protein_id="WP_010177543.1"
                     /translation="MEETKILIDSQPKYSVQAEFNRAQAVIMHEPSSELYYGVLHPHA
                     ALFDSYFNAAKAAKEHKQFQQLLKNRGIEVFTVKEALLKNVVDELGEPIEGKELEEFR
                     DFARSCVRLNTPSLTGLSYDEIVEQHIYLDKVFKKMHPVDLVRTILLQPNLILKRTLT
                     NTFVTADYNANPVMNLYFSRDQIITTGKGVVLTNLNSPQREIETRILCMCLKKIGIKP
                     LLDLSKVNKSAHIEGGDFFMLNNIALIGEGMRSNRLAIEILMKADVIGTEQVALIKDN
                     YHYQPQMHLDTYFNIIDKDLVAISHNRYNAGPGTKQELLVDIYVKGAASYQLTEVSIP
                     FKKYLEDYLKVEVIVISDEDQKNYGLNFLCISPRNIIAVKGQSEDYKNKMALHNVAVE
                     WVDFENLKQGWGAAHCTTQVINRKI"
     gene            221017..222645
                     /gene="pruA"
                     /locus_tag="KQA_RS0202005"
     CDS             221017..222645
                     /gene="pruA"
                     /locus_tag="KQA_RS0202005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="WP_010177545.1"
                     /translation="MSNAFYTIPEPSNELVKSYAKGSLERKLLFEAYDEMYKRRIVVP
                     LYINGEAIFTENKEAIRPPHDFNHVVGDYVKASPSHVKSAIDSCLKAKADWEQMPWQD
                     RAAIFLKAAALISGPYRYKINAATMIGQSKNVYQAEIDSACELIDFFNFNAKFLEEIY
                     SSQPISSVGIWNRTEYRPLEGFVYAITPFNFTAIAGNLPAAPVLMGNVCVWKPSESQM
                     YSANIIMEVLIEAGLPKGVINMVSGDPVMISDSVLNHKEFSGLHFTGSTKVFKTLWKQ
                     IALNLDHYKTYPKIVGETGGKDFVWAHPSADAAIVGTALIRGAFEYQGQKCSAASRAY
                     IPKSMWAELKVFLEAELKTIRVGSPRKVSNFINAVIHEASFKKLVEIIEFVKASNDAS
                     ILFGGGYDNNIGYFVDPTIIVAKNPNFRTMTEELFGPILSIYVYEDTQWEKVLKTVDQ
                     TSEYALTGAIFAQERSVITKATAILRNSAGNFYINDKPTGAVVGQQPFGGARGSGTND
                     KAGSIYNLLRWVSPRTIKENFVPPTNYSYPFLEE"
     gene            222687..223262
                     /locus_tag="KQA_RS0202010"
     CDS             222687..223262
                     /locus_tag="KQA_RS0202010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarC family protein"
                     /protein_id="WP_010177547.1"
                     /translation="MVFDIKEIITATMILFAVIDIVGSIPIIIDLRKKVGHIQSGKAT
                     IVSAILMVTFLFVGKQMLELIGIDVNSFAVAGSFIIFFIALEMILGVQLYKAESLQTA
                     AIVPLAFPLIAGAGTLTSILSLRSEYQPVNIIIAILINCLVVYIVLKSSVKIEKVLGN
                     QGIDVVRKIFGVILLAIAVKLFTTNIKGLLA"
     gene            223304..224140
                     /locus_tag="KQA_RS0202015"
     CDS             223304..224140
                     /locus_tag="KQA_RS0202015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010177550.1"
                     /translation="MLLSLSACKKEVPQIAEADTEFISRSHLSNEEEISKVPILNFGT
                     FHMGNTNDARKTEFDEKNEENKRKVHKIANALAKFKPTVIIVERLPKYDKKLLASYNE
                     YIKNPKESFKNPSEIELLAFEVGRLSNTKRMYGIDHHMDYNYMIGDEIKNQIDATMYN
                     QFDINPLLYYPKINVDEDKLSLLDKLKLTNQDDYLDFLIEANADILTHAGTDANFEGA
                     DEAAKYYKRNLRMYSNLNRIKLEPTDRVFMIMGASHTAFFRDFIKRSPKYKMVDTFDY
                     LK"
     gene            complement(224153..225493)
                     /locus_tag="KQA_RS0202020"
     CDS             complement(224153..225493)
                     /locus_tag="KQA_RS0202020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010177551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M28"
                     /protein_id="WP_010177551.1"
                     /translation="MKKGLLLVSFLFLIKFSFAQIESKIYDIIENVSAKQIEKDIRKL
                     AGFGTRNTFSDTLSETRGIGAARRWIKAEFEQISKNCNHCLEVSYQKDFVTKSMSKRV
                     PKDAWVVNVLAIQKGSKYPNRYVIMSGDIDSRASDTMDFTTDAPGANDNASGMAGTIE
                     AARVLSKYTFENSIIYVGLSGEEQGLFGGAGLAKYAKEQAWDIIGVLNNDMIGNIKGV
                     DGVIDNRSFRIFSEPTNITDTEDQIKRRRYYGGEVDGISRQLARYVHKSVQTYMPEMN
                     PMLIYRLDRFGRGGHHKPFNDLGYAGIRIMEAHENYTQQHQDIRTENGIDYGDTVEHV
                     NFGYAAKLTAVNAINLAQLAWASPPPTEVKIGGIVESSVKLKWKKISDSNIKGYKIYW
                     RSTTSPTWDYSRYVGNVDQFTLKGIVIDNYFFGVSSVSMEGIESPVVFPNAVFK"
     gene            complement(225667..227883)
                     /locus_tag="KQA_RS0202025"
     CDS             complement(225667..227883)
                     /locus_tag="KQA_RS0202025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010521877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyribonucleotide nucleotidyltransferase"
                     /protein_id="WP_010177554.1"
                     /translation="MIPQVFKEVIDLGDGREITIETGKLAKQAHGSVVVTMGKTMLLC
                     TVVSNYKQSDVDFLPLTVDYREKYAAAGRYPGGFFKREARPSTEEILVMRIVDRVLRP
                     LFPKDYHAETQIMIQLMSHDPEVMPDALAGLAASTAIQLSDIPFEAPISEVRVSRING
                     EFIVNPTFAQLAESDIDMVIGASADSVMMVEGEMDEISEEEMIEAIKVAHEAIKVQCA
                     AQVRLAEAFGKKETREYTPEDTDEELAKVVNDFAYDKCYAIAKQASAKHDRGAAFGEI
                     KEELQAQYSEEELAEKGDLISKYFNKTQKEAVRNLTLEEGIRLDGRKTTDIRPIWCEV
                     DYLPTTHGSAIFTRGETQALATVTLGTSRDANIIDNASHEGEERFYLHYNFPPFSTGE
                     ARPLRGTSRREVGHGNLAQRALKGMVPEDCPYTVRVVSEILESNGSSSMATVCAGTMA
                     LMDAGVQIKKPVSGIAMGLISDGDRYAVLSDILGDEDHLGDMDFKVTGTEDGITACQM
                     DIKVKGLSYEILVNALKQARDGRLHILSKLTDTIATPAGDVKDHAPKMVTRVIPNEFI
                     GALIGPGGKNIQELQKTTDTTIVINEDPVTEEGIVEILGTGAEGIDAVLARIEAMLFK
                     PQVGSVYEVKVIKILDFGAVVEYKEAPGNEVLLHVSEFAWERVENVTDVLNLGDELDV
                     KYFGIDSRTRKEKVSRKALLPKPEGYVARPPRDDKGKGRDNRGRDNRDRKPREKRD"
     gene            complement(228156..228425)
                     /locus_tag="KQA_RS0202030"
     CDS             complement(228156..228425)
                     /locus_tag="KQA_RS0202030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007096857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_010177556.1"
                     /translation="MYLTKEVKEEIFAKHGKGKNDSGTAEAQIALFTHRITHLTEHLK
                     QNRKDYNTERSLVKLVGKRRSLLDYLIKKDILRYRAIVKELGLRK"
     gene            complement(228549..229061)
                     /locus_tag="KQA_RS19785"
     CDS             complement(228549..229061)
                     /locus_tag="KQA_RS19785"
                     /inference="COORDINATES: protein motif:HMM:PF08534.8"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TlpA family protein disulfide reductase"
                     /protein_id="WP_081483225.1"
                     /translation="MISKSYNKANELTKNSKYGKIIGTFIKLSKNPKKGDQFTDFTQN
                     DSNGKSITFSNVKKKYTLIDFWASWCLPCKKLNPELRKVYHEFNAKGFEIVAVSLDQN
                     QEAWLNAIRKDQLDWIQLSDLNGWENPVGYMYGVKNIPENFLIDTKGTIIDTRLNPKK
                     LRKVLSNVLN"
CONTIG      join(AHHE02000004.1:1..37365,gap(68),AHHE02000005.1:1..106838,
            gap(47),AHHE02000006.1:1..43313,gap(50),AHHE02000007.1:1..41434)
ORIGIN
       1  CTGATACACC TTCAGGTACA TATGTAGTAG AATATGAGAT TTGTGAAGTT GGAGCAAGTC
      61  CAGTGAATTG TGATAAAGCA GAAGCTACTA TAGTTGTTGC GAATCCAATA GTTGCGACTG
     121  ATGAAGACTT TAGTGCTACC CCATTAACCG TAGGAGATAG TAGTCCAAGT GTTATTGATA
     181  TGAACGACAC TTTGGATGGA AGTGGTCCAG TAACCGTTGG AATAAATCCT GGTGATGTAG
     241  GTTTAACAGG TACTAATGTT CCAGCAGGTT TAACATTTAA TCCAGATGGT ACGATTAGTG
     301  TTGATGCTGA TACACCTTCA GGTACTTATG TAGTAGAATA TGAGATTTGT GAAGTTGGAG
     361  CAAATCCAGC GAATTGTGAT AAAGCAGAAG CTACTATAGT CGTAGCGAAT CCAATAGTTG
     421  CGACTGATGA AACTTTAGCT CCAGTAGATA CGTTAGGAGG CGATGTTACA ATACCTTCAG
     481  TAATAGATTC TGGAGAAACT TTAGCAGGAA CACCAGTTAC TGTTGGTACA GGAGCAGGTG
     541  ATGTTACAGT TAGCCCTAAC CCAAGTGGAA GTACCCCTGT AGGTTTTACA TTAAATAATG
     601  ATGGCTCAAT AGTTGTCCCA GAGAATACAC CTTCAGGAAC TTATACTGTA GATTATCAGA
     661  TTTGTGAAAA TGGGTCAACA CCAGCAAATT GTGCAATGGC TACAGCTACA GTTATTATTG
     721  ATAATTCGAT AGTAGCTACT AGTGAAACTT TAGCTTCAGT AAATACTGTG GGAGGCGATA
     781  CTACTACACC ATCAGTAATT GATTCTGATG AAACTTTAGC TGGTATTCCT GTTGTTATTG
     841  GTACAAGCCC TGGAGAGATT ACAGTAAATG ATAACCCAAA CACAACGAAT CCAACAGGGT
     901  TTATTGTTAA TCCAAATGGT ACTATTACAG TGCCTGAAGG AACACCTTCT GGTTCTTATG
     961  ATATAGAATA TGAAATTTGT GAGAATGGAG CTTCACCAGT AAATTGTGCT ATAGCTGTAG
    1021  CAACTGTTGT AATTGAAAAC CCAATCGAAG CTGAAATAGA TGACTATACT ACAACATCAA
    1081  TTACAGGAGG AGCATCTACA CCTAATATTT TAGGTAATGA TACTTTAGCG GGTAGCCCTG
    1141  TAGTTTTAGG AAGTGCTCCT GGAGAGGTTA GTTTAATAGG AACTAATGTT CCTAGCGAAT
    1201  TAACATTGAA TCCTGATGGA ACAATTACCG TAAGTTCTAC GGCGTCTACA GGAACGTATA
    1261  CACTAGAATA TCAGATTTGT GAAAATGGTA CAACACCTGT AAGTTGTGAT ACTGCAACAG
    1321  CTACCGTTAG AGTAGAAAAC TCATTAGTAG CATCGAATGA TGACTTTACA TCTACTCCTT
    1381  TTGGAACAGG ATCTACTACG CCAAGTATTT TGGATAATGA CTCTTTAAAT GATTTAGGAC
    1441  CAGTTGTACC AGGAACAGGA ATAGGAGAAG TAACTTTAAG TCCAGTAAAT ATACCTGAAG
    1501  ACCTAACTCT TAACCCAGAT GGAACGATTA CCATTGCGGA TGAGGCTTTG CCAGGAACTT
    1561  ACACATTAGA GTATCAAATT TGTGAAAATG GAGCAAACCC GGCAAAATGT GAAACTGCAA
    1621  CAGCTTCTAT AGAAGTATTG GATGATCCAA TCCAGGCGAC TAATGATGAT TTCACAGCCA
    1681  CACGTTTTAG TCCAGGGGAT ACTACTATTA TTGTTATAGG CGATAATGAT ACCTTAAACA
    1741  ATGAACCTAT TGATCTCGGT ATAGGTACTG GTCAGGTTAC TATTACAGAT AATCCTAATG
    1801  GAACAAATCC AGAAGGAATT AAGGTTAATC CTGATGGTAC AGTGACTATA GACTTAGATG
    1861  TAAAGTCTGG TTCTTTTGTA GTGGAATACC AAATTTGTGA GAACGATGCT GTTCCAGCAA
    1921  ATTGTGATGT TGCTTCTGTT TTAATAGAAG TAGCGGCTGG AGATGTAGAG GTATTTAATG
    1981  GTTTATCTCC TGATGGGAAT GGATTAAACG ATTTCTTGAG AATTGATGGA CTCCAAGACA
    2041  CATCAAGCAA TTCGATTGAA ATTTATAATA GATGGGGAGT TAAGGTTTAC GAAACTAAAA
    2101  ATTACGGTTC GAACGGTAAC GTATTTAGAG GTTTCTCTAA TGGACGTGTA ACGATAGATG
    2161  AAAACCAATT ACTTCCAACA GGTACTTATT TCTATGTTTT GAATTATACA AAAGACAATA
    2221  GAAATGAAGT GAAACAAGGT TATATATATA TAAACTAAAT CATCTTAATA TCATTGGCTC
    2281  TGTAATTTTA TGCAGAGCCA TGATTTAAAT CATAAATATC ATGGAAAAGA AATTTTTTAG
    2341  ATCAGCTATG GTAATTTTAG GAATTATTAT TTCTACAGTT GCACAAGCAC AGCAAGATCC
    2401  TCAATATACC CAGTATATGT ATAACCCTTC TGTAGTTAAT CCTGCTTACG CAGGGTCAAG
    2461  AGATGTGTTA AGTATTGTTG GATTACACAG AAGTCAATGG GTTGGAGTAG AGGGAGCACC
    2521  TAGAACACAA ACCTTAGGGA TTCATTCTCC AATAGGTATA GGTCGAGTTG GTTTAGGAGG
    2581  GAATATTGTA CACGATGAAA TAGGGCCATC TCAAGAGACC TATTTGACTG CAGACTTTTC
    2641  ATATACAATT CCAACTTCTG AAAAAGGTAA TTTAAGCTTT GGTATTAAAG CTGGAGCTCA
    2701  TATTTTAGAT GTTGATTTTA CTAAATTGAA TATATCTGAT GCAGGTGATA TCTTCGATAG
    2761  AAACATAGAT AATAAAGTAA GTCCTAATAT TGGATTAGGT TTGTTTTATT ACACGGATAA
    2821  GTTCTATTTA GGGTTAAGTG CTCCTAATTT ACTTCAAACT AGACATTTTG ATAATGTGAA
    2881  TATCAATACC TCAACAGGTT CTAGTTTTTT ATCTAAAGAG CGAGTACACT ATTATATTAC
    2941  TACAGGTAGG ACATTTGATT TAAGTAGTAA TGTGAAGTTT AAACCCGCGA TCCTTTCAAA
    3001  GATTGTCTTT GGTGCACCAT TACAATTAGA TCTTACGGCT AACTTTTTAA TATGGGAGAA
    3061  GTTAACTCTG GGTGCTGCCT ATAGATGGAG TGCTGCTTGG AGTGCATTAG CAGGTTTTCA
    3121  AATATCAGAT AGTTTAATGA TTGGCTTCGG CTATGATCGA GAAACGACTC CGTTAGGGGA
    3181  TACTTCATTC AATGATGGAA GTTATGAGGT AATGATGCGA TTTGAACTTT TCAGAAAGCA
    3241  GAATAAAATA ATAACACCAA GATTCTTCTA AACTTAATTG ATTATGAATA CTAAAAATAT
    3301  TAAAAACGTC ATATTATATT CTTTCTTGGG GTTTTCAGCA TTAGTTGCTC AGGAACAAAA
    3361  GATAAAAAAA GCAAATAAAG CTTTTGAAAA TTACGCATAT ATAGATGCTC AAAAAACATA
    3421  TTTATCCGTT GTAGAACAAG GGTATACTTC TGCAGATGTA TATGAGAAAT TAGGAGACTC
    3481  TTATTACTTT AATGCGGATT TAGAAAGTGC TGCTATTTGG TATGGTAAAT TATTTTATGA
    3541  ATACGCCTCG AATGTTAAGC CAGAGTATCT ATTTAGGTAT AGTCACGCAT TAAAGAATAT
    3601  TGGTAATTAT GAATTATCAG ATAAAGTAAT GGAGCAGTTT GGCAAAGTTA CTGGGGTAAA
    3661  AGAGCAACGT GTAAAATTCT TTAATAAGGA TCGTAACTAC TTGGCATTAA TAGAAAAGCA
    3721  ATCAGGTAAG TTTAAAGTAT ATAATGTAGA AGGCGTAAAT ACTTCGGGTT CAGATTTTGG
    3781  GCCAAGTTAT TATAACGATA ACACTATTTA TTTTGCATCT GATCGCTCGA ATATAGCTAA
    3841  AAAAAATATT CATACTTGGA CTAATGCACC TTTTTTAAAT CTTTTTAAGG CTGATAAAGA
    3901  TTCGAATCAA CTTACGAATT TAAATAACTC TTCAAAAGTA AACGGGAATA TTAACTCTAA
    3961  GTACCACGAA TCTTCAACTG TATTTACTAA AGATGGTAAA ACAATGTATT TTACTAGAAA
    4021  CAATTATACA GACAAAAAGA AGAAATCAGA TACTAATGGC ACTACAAAGT TAAAACTTTA
    4081  CAGAGCCGTT TTAAAAGACG GAAGATGGTC AAATGAATTA GAGTTGCCTT TTAATAGCGA
    4141  TGAATATTCT GTAGCGCACC CAGCATTATC AAAGGATGAA AAAAGGCTTT ATTTTGCAAG
    4201  TGATATGAAA GGAACAAAAG GGCTTTCAGA TTTATTTTTT GTGGAGATTC TTGGGGTAAA
    4261  CAAATATAGC GAGCCTCAAA ATTTGGGAAG TAATATAAAT ACAGAAGGAA GAGAAACCTT
    4321  TCCTTTTATT TCTAATAATG GGGATTTGTT TTTTGCCAGT GATGGACATA TTGGACTTGG
    4381  AGGCCTTGAC ATCTTTATAG CTAAAGCTAC ACCTAGTAAG AAAAATTTCG AAGAGGCTTA
    4441  CAATGTAGGG AAACCTATTA ATAGCAAATA TGATGATTTT TCTTTTATTC TAAATTCATC
    4501  AAAAAAAGAA GGATATTTTA CTAGTAATCG TGAAGGAGGT TTAGGGAATG ATGATATCTA
    4561  TGCATTCGAA CAAGTAGAAG AGTTGATTAC AACATGTGAC CAGTACTTGA AAGGTATAAT
    4621  AACTGATGCA GAAACAAGAG CACTTTTACC AGGATCAAAA GTAACCTTGT TAACTGAAGA
    4681  TTTAAAGCCT ATTACTTCTA CGGTCGCAGA TGGTAATGCA TTTTATGAGT TACCAATAGA
    4741  ATGTGATAAT AAATATGTAA TCCGAGCAGA AGAACCTAAT TATAAACCAA CTGAAGTTGA
    4801  TTTTGCATCC TCATCGGTTT TTGAGTTCAA TCATAACCAG CCAATTCAAT TAAGAAAAGG
    4861  AGCTCCTATT ATTAATAATG TGGCAGCCAA GGTTGGTGAT GATTTAGCAA AATTGCTACA
    4921  GCTAAACCCT ATTTATTTTG ATTTCGATAA AGATTTTATT CGTCCTGACG CAGCTTTAGA
    4981  ATTACAAAAG GTGATAGCAG TTATGAAAGA ATATCCAAAT TTAGAAATAG ATGTTAGAAG
    5041  TCATACGGAT AGTAGAGCAC CTTTTGCTTA CAATATTGAC CTAAGTACTC GAAGAAATAA
    5101  AAATACGATC AAGTACATTG TAGAAAAAGG AGGTATGTCT ACTTCTCGAT TGACAGGTAG
    5161  AGGATACGGT GAAATAGAAC TTACTAATGA ATGTGCTGAT GGAGTTAATT GTAGTGAAGA
    5221  AAAGCATCAA TTAAATAGAA GAAGTGAGTT TATTATTGTA AAGCAATAAT TATTTTTGTT
    5281  TTATGCATTT ATAAGTTAGT AGTAATTAAT GTAAAAATCG TCTGGAAATT TAAATTCCCA
    5341  GACGATTTTT TTTATTTGAG TGTATAAAAC CACCGTCAAA GACGGTGGTC ATGTTTTAAG
    5401  GGCTTTGCCG TTCTTTAGAT TTGACCATCA AAACTCTTTT CAAGATGAGT AAATATAGAA
    5461  AACTAACGCA CGTGTATTAC AAGTGTAACT ACCACATTGT TTTCACTCCT AAGTACTAAT
    5521  TTCGTGTTCT ATTAGGAATG ATAAAATCAT TAATCGAACA TGACTTTCAG GTTCTCAGTA
    5581  GTTGGAAAGA TGTTCAAATT CAAGAGTTGA ATAATCAAAA AGGTCATGTT TATATGGTCT
    5641  GCTCTATTCC TCCCAAGATA TCAGTGTCGC AATATATAGG GATTATTAAA GAAAAAATAG
    5701  CAATTAAACT TTTTAAAACA TATCCAAGCC TAAAGCAAAA ACCATAATGG GGAAATCATT
    5761  TTTGGTCAAG AGGTTATTTT GTTAGAACGA TTGGTTTGGA TGAAGGCATG ATAAAAAGGT
    5821  CTGTAAAGTA TCAATCTCAC AACGAAGGGA ATTAAGGTGT TGCCCCTGTA GGGCTAATCT
    5881  GAAAATCAAA GCCTCCGTTC TAACGGAGAT TTTTTACTTA AAGTATCAAA GCCTTATTAT
    5941  GTAGCCTTCA GTATTAAAAC GCTGTAGGTC TAATATGTAA AATCAAAGCG TTTTTTTAAA
    6001  TTACATGTCG TAATATTGTT ATATGTTGTC GTAATAGTTT AATTTTGCCC AGCAAACCTA
    6061  AGAAAATGAA AAGAAACGTT TCTGAACTTT TTAATAGTTA TGCCATTCAT ATTTTCTCAT
    6121  GGGCAAGACT TAGATTACAA AAATCTAGAC AGTGCGGATT AAAAAGGTGT TGGCAACAAT
    6181  AAGGGTGCGT TCAACATACA TAAATAACCT TTAATATTAA TTTTATGAAA ACCAAATTAC
    6241  TTTATCTTTT TACTTTTATT ACTACTTTAT CCTTTAGTCA AACAAATTTA GTCCCAAATG
    6301  GGAATGTTGA AAGTTGGACA AATTCTACAA CATTAGATAA TTGGATAACC GAAAACAATG
    6361  TTTCTCAAAA CACTACTGAC TCAACGGAAG GAAATTCAAG CGCATCTTTA TTAATCATTG
    6421  GTAATAGTTC AGTTAACCCA AAAATTGTTA CAAAAGTTCC TTTAACGAGT GGTATAACTT
    6481  ATACTGTTAG TTACAAATTT AAATATACGA CTTCGAGTTT TACTGGATCT AGATCCGTAT
    6541  GCTTAAAATT AGTTAAAGAT GGTAGTGCAA CTACAACAAC TAGGTGCTCA ACACTTAATG
    6601  ATAACTTATG GAATTTTAAA GAAATAACAT TCACTCCTGA TCAAACAGGA GATTATGATT
    6661  TAAGTATTTC AACGTCCAAT TTTTCTGGCA TCAATACATT TGAAGTACTA ATTGATGATA
    6721  TAAAAGTTTT TGATCCTTTA AATTTGAGCG TTGATTATTT TAAAAATGAT GATCAAAATC
    6781  AAAATATTTA TCCAACAATT ACAAATGGAA AAATCTATTT TGATAAAATA GAAAACGTTG
    6841  ATGAACTTAA TATTTCAGTT TTTAATTGTA TTGGGCAAAA AGAAAATTTT GTGGTTAACA
    6901  ATAATACAAT TGACTTATCT AGACTAGCGA CTGGAATATA TTTTATAAGT TTGAAAACAG
    6961  ACAAGCTGAA CACTGTAAAA AGAATTCTAA AAAAATAATA CAGTTGCCAA TACTGTATCA
    7021  CAGAAATAAT AAGGTTTGAG ATGGGAGTTT AGTGAGAAAC CCTTCATCTA AAGTAGGAAG
    7081  AAAAAATGCG CAAAGAAATG CTATTTATTT CAACTAAAAA CCATAGACTT TCAGAATGGA
    7141  ATTAATTGTG CTTGGGTGAA TTACATCAAG AGATGTAGGT TATTCTAAAA AGGAATCAAA
    7201  AAATTTAAAA CCGGATCTTA CTGAATTTAG GAAACGTATA GAATCAGTTA AAAATGCTGG
    7261  TGGTAATCGA ATACGATGGT GGTGGCACAC GAATGTCTAG ATAAGTCCTG TTTTATACAC
    7321  TATCCCGTAA AGTGTGTAAG TTTAAAATAT GGAGGGTTTA GCTTTTTAAA GTTGAACCCT
    7381  TTCTTTAAAT ATAGTTAAAA ACAGATCCAA AATTATTCCC CAATTTCTAA TAGGTATAGT
    7441  CCATTTTTTA GTTGATTCTC TCAAAGCTAA AAAGGTAGAC TTCATAACAG CATTATCTGT
    7501  TGGGAATGAG AGTTTGTTTT TAGTGTATTT ACGGATTTTA CCATTTAGAT CTTCAATAAG
    7561  ATTAGTAGTG TAAATTATCT TCCTAATCCC GACAGGGAAG TCATAAAATA CGGTTAATTT
    7621  CTCCCAGTTA TCACGCCAAC TTTTAACAGC ATAAGAGTAC TTTGATTCCC ATTTTTGAGC
    7681  AAAATCGTTT AATGTAGCTT CTGCTGCATT CTTGGTAGGA GAATTATATA TTTCCTTCAT
    7741  GTCAGCAGCG AACTCCTTTT GTCCTTACAT ACTATATATT TGGCTGCATT TCTAATCTGA
    7801  TGTACTAGGC AAATTTGAGT AGTTGATTCA GGTAATATAT TACGAATAGT CTGTGTAAAT
    7861  CCAATGAGAT TACCCGTTGC TGTGATCAGT AAATCTTCTA CACCTCGAGT CTTCATATCT
    7921  ATAAGTACAT TCATCCAAAA GGCTGCTGAT TCATTTTTGC CAAGCCATAA TCCAAGAACA
    7981  TCTTTCTTAC CATCTCTAAG TAGGTCAACA GCTATATACA TAGTCTTGTT AATCACTTTT
    8041  TAGTTTTCTC TAATCTCAAA AACGATGCCA TCCATTCAGG TAATTAAATA AACAGGTTCT
    8101  AAAGGTCTAT TTTGCCAAGC AATAATATCA TTGCTTATAC GATCTGTAAT TCTTTAAATT
    8161  GTAGAGGTAG AGATATCAGA ATTACTCATT GCTTTTGCAT ATAGGCTTAT GACGACATTT
    8221  TCAATACCAT CAACTATATT TTATCGCTTA GGAACCATCC ATTGGATTAA AAGATGATTT
    8281  ACGATCTCGA GGAACCTTAA TTTCGGTCTT TCCTAATGAT GTTTTTATCT TTTTTGTAGA
    8341  ATACTTATTA CGAGAATTAG TATTCTCTGA TTTTTGATGT TTCACATAAT TAAGGTGAGC
    8401  ATCCAATTCG ACTTCTAGAA TTTTTTCAAC TCTGGCTTTT GAATCGATTT AAGAAAACTA
    8461  GTAAGCTTTT TTCCTATTTT GAATTGCTTA AAAAATTCAT CGTTCAAGAA ATCTTCTTTT
    8521  TTCATAAGTG CATAAAATTT AAATTTGATC AAAAAAATAT CTGGGGTCAT GACCCCAGAT
    8581  ATTTTAAACT TTACACACTT GGTGATATAC TACTAAAAAA AAATCATCTA GAAATTTTAC
    8641  TTTCTAGATG ATTTACTTTG TTTATTAAAT GATAGATTTG GATTTCTATG TTTTGTGGAA
    8701  ACTTAATTTG AAATAACTAT TGAACGACCA ATTTGGTAAC CAGAGTATGT TGGTTTTTAT
    8761  TGATTTTAAT TAAATAAATT CCTGAAGTCA ATTTACCAAT GGTTATTTTA TTAGATGTGT
    8821  TTTCTACTTT TTTCTGTAGT ACTAAATCTC CTTTTAAATC ATAAATATAA AGTTTAGCAC
    8881  CTTTTATGTT TTCGTTTACC ATTAAATTAA AAATTTCATC TTTTACTGGA TTAGGAAAAA
    8941  TACTAAATCT TTTTTCTGTT TCATTTCTAA ATTCCGAAAT AGAAAGAGAA TCTTCAGTAA
    9001  GATCAATAGT TGTCTTTTTT ATATCTCTAT CAGTCATAAA ATTACCATCA ACCTCTCTAA
    9061  TTATTGCTCT CACCTCATAG TCGTTAGCAA TAGGCCAAGT ATCTTCCGTT TGTATTGTAA
    9121  TAGTAACAGT GCCGATACCA GCATCAACTT TTTTCTTTGC ATTTCTAAAA AAAGTACTAC
    9181  CACTAGGATC ATAAAGCGCA ACAACAATAT CTGCGCTTGA AGTTGCCTCA TAATGTACTT
    9241  CTACATCAAA ACTCTGTCCT TTTATAACAT CATCTGGTAC ATCATCAATA GTAACTATAT
    9301  CATTTGTTAC TAAATTTTTT GGTGTCAACT CCCAAGTTCT CACCCAATCA TAATAAGTTG
    9361  TGCGTTCTTC TTGTGTACCA CCCATGCCTT GTTGCCCATC ATTGGGCACC GAGTTCCACT
    9421  TATAAGTTTC TGTTACTAAA CGTAAATACA TATCAAGATT AAAATCAGCC TTAGGAGTAA
    9481  TTGAATGAAC TTCCTGCCCA TCTAGAAAAA ATATTAGTTC TTTTGGACTT TTCCACCAAC
    9541  ATCCATAAAC ATGATAGTTA GCCCATGCTT CTTCATTTAT AGGACTTTCA GTACCCCTAG
    9601  AACCAGTAGG TGTTTCTGGA CATGATGTAT TCCTGCTATG AGAATTTGAA TTCATATTCT
    9661  TGTTGTAGTC TTTTTTGTTT GGGTCGGTAC TGGTAACCAG CCCTACTACT TCAACGATAT
    9721  CCAATTCAGT AGTTCGACGA TCACACCCAG TAAAATCATC AGGTCTATTT ATCAACCAGA
    9781  ATGTTGAAGA CATAAAAGTT TTGTTAGCTT TCATTTTCGC TTCAATGTAA TATCCAACAC
    9841  TAGCTTTTCT TTTAGACCAA ATATTCCCAC ATCCATGTGT ATACGTTTCA CCATCTATAA
    9901  CTCTCGGGGA ATCTAAAAGA TAATTTTCTA ATCTTAAATG TTCTGCAGCA ACTGTGGCTG
    9961  ATTTTTCTTG AAACAATCCC GGAGGTCTAC CAACCCACAA ATCCGCTCTT GTATTTTCCC
   10021  ATTTTGTAAG ATCAAGTTTA GGACTGTCAA ATTCATCTGA CAAATCATCA ATTAATTTCC
   10081  AACTTTTACT ATCAGGACTA GGATCTTGAC CTAAATTAAA CGTTGGGTTA GTTGGTTTTG
   10141  TTTGACCGTG TAAAGATAAA GTAGTTGCTA GGCACCAAAA AACTGATCTT AAATGGCCAC
   10201  CTGAGAAAAA AGATTTCACA TTAAACATTA TTATTTGATT TTGATTAATA CGGTGCGAAT
   10261  ATAATAGTCA AAGTCAGTGG AATATTATAT CCAACTAATA TCGGTGTGCG AATCCGTTGA
   10321  AAGGCGTTTT TACGGGTTTA AAAGCAAACT GTTTTTGTTT GTTAGAGAAA GAAGTTCTTA
   10381  AGTGTCGAAA AAAGAGCTTG TTCTTGTTTA AAAAGTTAGC ATCTGTTCTT ACTAGTTCTA
   10441  GTCTATACTG TAAATATGTG GAATAGCCTC ATAGATTAAA TTTTGTTAAG TATTTTGAAA
   10501  TGATATGCTA TTAAATTTTG TGTTGTTTTT GGTATGAAAA ATATTTGTTT TATACGTTTT
   10561  TATTTAAAAT CAGCTGGGTT ATTTAATCAA AATTCAAATA CTTTAAAAAT ATTATGCAAC
   10621  GTATGGTTTT TTTAATTAAA AAAAACCATT TGTGTCAAAC TATAACGTTA TAGTTTGATC
   10681  ATATTTGCCC ATGTAATCAA ACAACTAATT TTTTATGAGG AATTTTTTAG TATTATCGAT
   10741  TTGTGCCATT TTTTCCAATG TTTATTCTCA ATGGGATACG GGGTGGTTTC CTAATCCAGA
   10801  TAATTATGTT CCAAAGTATA ACGGCAAATC CTGGCAAAGA CTGGGCTGGA TGTCAGATGG
   10861  CTTTAACGAT GGGTGGTTAA ATGAAACCAA GTGGAAACGA GGTTATTTAA ATGAATGGAA
   10921  TGATAAAGGT AGGACGCGTT GGAACTCATG GCCTGATTAT GTGAAAGTCA GTAATACCTG
   10981  GGGGCAAGGT TGTGCCCAAA TTGGCCATTA TTGGAATGAC GCGAGTGCGG GAGGATGGGC
   11041  GAATACTATA AGTTGTGGTA TAATTAGCTC TAGAAACACA GTAAAGTACC CAGTCTATTT
   11101  AGAATCAAGA ATTAGAGTTG CAAATACAGA GTTATCTTCA AATTTTTGGT TATTGGATAC
   11161  AGGAGAAAAT AGAAGAGAGA TAGACGTGCT TGAATGTTAT GGGGGGAATT CATGGAATGG
   11221  AAACAGAGCT ACATCTAATT TTCATTTTTT TACTGATAGT GACCGTAAAG ACCACTTCAA
   11281  GAGATCGGAT CATTGGAGAG GCTTTCCTTG GCGAAATAAT TTTCATCGAT TTGGTGTTCT
   11341  ATGGTTAAAC CCATGGGATG TTAGATTTTT TATTGATGGA AAAAGAGAAG GATACAATTT
   11401  CTATAGTATA AATCTAAAAA CAAAAGATGG CTTACAATTA AATAAAGATT GGTGGAATTA
   11461  TAGCACAGAA ATGAAAATTA TTTTAGATGT AGAGGAACAC AAAGGAACAG CCCAAGATCC
   11521  TATTTGGAAG TATAAGCAAG GTTTATGGAA TACAGATCGT AAGATGTTAG TGGATTGGAT
   11581  TGGGGTTTGG AAACCAAATA CTGGGGGTAA GAAATTAAAT ACTTCATCAA TTAATACTGC
   11641  AGAGCTTCCA AAAGTATACC CAAACCCTGT AAAACAAGGG CAGGAGTTGG TTTTAAGTAA
   11701  TATAGAAAAG GGGCAAAATT TTATTTTTTC TAGTGTAGAC GGGAAAATAA TATCTTCTTT
   11761  CAATATCCCG CATGAGGACA AACTATTTTT GAATACTAAA GATATAAGCC CTGGGTTGTA
   11821  TATACTTCAA GTTGATACGA ATGTGATAAA ATTAATAGTT AAATAGTTTG AAAAAACATC
   11881  TATTAAATGA TCATTTTCGA GTAGTTCCAT GTTTTTCGTC GTCGAATTAG AGGGTAAGAG
   11941  GACTCTAACC ACTTTCTGAT TATTTGCTTC AAATATATTT TATAAAAATA TATCAAGAAT
   12001  AGTGATGGAT TTAAAATATG TTAAACTTGG AGTTTTCGAC CTACTATTAA AAGAAAGCAC
   12061  CTTTTGATAA AACACTTGCT TTTAGAACTT ATACAATCGA TGGTAATTTT AGTTAGCATC
   12121  ATAAATATGA TTACTACGCT TGATATATTC TATTCTTGAA AGTTCAATAT ATGACAATAC
   12181  GGCCTATAAG CTAAATCACT AAGCAATACT AAGTGTAATA CAAACCTATC TATCGGGATA
   12241  ATAAATAAAA CTATTTATTC GCTAAGCAAA TATTATACTT GATTAAACCA TGCTTCAGTA
   12301  TTTGTTTTAA GATATCCAGA TAATCGATAT AACAAAAAAT ATTAATTCTA TAAACAACTA
   12361  ATTTTATGAA AAATTATTTA TTATTCATGT TATTTAGCGT GCAATTATTA TTTGCACAAA
   12421  GTGTAAAGCT TCCTGAGGGT TTTACAAAAG ACAGCTCATT ATCAGATGAT TTTAATTATG
   12481  GTAGTGATAA AAAGGGAATG TCGGATAAAT GGGATGATTT TAACAGCAGT GGTTGGAAAG
   12541  GTCCTGGTCC TACGGAATTT AGAAGTGAAA ATATTACTTT TAAAGATGGT AAATTAATAA
   12601  TTAAGGCTAG TCATTTTGAA GGTGGAGAAA AACATTTTGA AAATGGACGT ACATGGACCA
   12661  GACAAGTTCA CACAGGTTAT TTAGTAAGTA AAGAAGATAA TCCTATATCA CCACCAGTAT
   12721  ATTTTGAAGC AAGTCTAAAG GCGAATGCGA TAGGTTTAGC CAGTAATTTT TGGGCAAAAA
   12781  GAGGAAATAT TGATAATAGT TCCGAAATCG ATGTAGTTGA AACGTATTCT GATACTGACA
   12841  ATGGAAGTAA CAATTATCAT TTTTTTAGAG ATAAGAAGGA TTATAATGAT CAAAGAAGGC
   12901  CTCCAGTAGG TAATGATGTA GAGTCTAATT TTAATGTCTA CAGTTGCTTT TGGAAAAGTA
   12961  AAACAGAAGT TATTTTTTAT GTTAATGGTA AGCAAACTAG ACACATTTAC CCATGTGCGC
   13021  CTGATCCAAG AGATAGATTG GTTGATCCTG CTGGAAGGTT TTTTGATGAA AATTTAAGAA
   13081  TTATTTTAGA TTGTGAGGTG CACACATGGA GGATAAAACA AAAAATTGCA AACGCTCTGC
   13141  CTACCAAAGC AGCCTTAGAC AAACTTACAG ATGATCAGCA AATGCAAGTT GATTACATGC
   13201  ATGTTTATAA ACCTGGATCA GGTTATAAAG TTTCAGATCC TTGTGGCAGT GATTCATCAG
   13261  ATTCAACAGA CAGTGCAGCT GATGACAAGT CCTTTTCATC GTTATCTTTT AACCAGTCAA
   13321  CAGAAGGAGC AAATAATAAT CCATTAATTC TAAGCGCACC AAATACTGTA GAAAGAAATA
   13381  TTAAAGGTTA TCCACTGAAG GCTTCTTTTT CTCAAGATGG TTATGCCATC TTTCATTTAA
   13441  AGGATAGAAA CAATGGGTGG AAATCATATG GTCACGTAGG TAAACAAGTG ACATCTGGGA
   13501  AACAATATAA TTTTTGGTTG AAGACCAATG AGTATATATC AGGGAACAAT CTAGATTTAG
   13561  TATGGGAGAT TAAGGTGAAT AATGGAGCTA AAGGTTTTGC TGTAAAGTCA ACCAATGTAA
   13621  ATAATGGTGG CAACAATCAA GATACTTTCT CAAATAATAG TAGTCCAACA ATTCAAAACG
   13681  CCCCCAGTTC TATAGTTAGA AATATTAAAG GCTACAATTT ACAGGCTTAT TTTCCACAAG
   13741  GAGGTTATGC TATATTTCAT TTGAAAGACA AAAATAACGG TTGGAAATCA TATGGCCAAG
   13801  TAGGCAAGCG AGTTACATCG GGATCTACAC ATAATTTTTG GTTGAAGACA AATCAATATA
   13861  TATCAGGTAA TAACCTAGAT TTAATATGGG AGGTTAAGGT TGATAATGGC GCTAAAGGTT
   13921  TTGCAGTAAA ATCAACCAGT TTAAACAGCG GTGGCGGTAA CCAAAACACT GTTTCAAACA
   13981  ATAGTAATGC AACAATCCAA AATGCCCCTA GTTCTATAGT TAGAAATATT AAAGGTTACA
   14041  ATTTACAGGC TTATTTTCCA CAGGGAGGTT ATGCTATATT CCATTTGAAA GACAAAAATA
   14101  ACAGTTGGAA ATCATATGGT CAAGTAGGCA AGCGAGTTAC ATCGGGATCT ACACATAATT
   14161  TTTGGTTGAA GACAAATCAA TATATATCAG GTAATAACCT AGATTTAATA TGGGAGGTTA
   14221  AGGTTGATAA TGGCGCTAAA GGTTTTGCAG TAAAATCAAC CAGTGTAAAC AGCGGTGGCG
   14281  GTAACCAAAA TACTGTATCA AACAATAATA ATCCAACAAT TCAAAATGCC CCTAGTTCTA
   14341  TAGTTAGAAA TATTAAAGGT TACAATTTAC AAGCTTATTT TCCACAGGGA GGTTATGCTA
   14401  TATTTCATTT GAAAGATAAA AATAACGGTT GGAAATCATA TGGTCAAGTA GGCAAGCGAG
   14461  TTACATCGGG ATCTACACAT AATTTTTGGT TGAAGACCAA TGAATATATA TCAGGTAATA
   14521  ATCTAGATTT AATATGGGAG TTAAAGGTTG ATAATGGCGT TAAAGGTTTT GCAGTAAAAT
   14581  CAACTGGTGC AAACAGTGGT GGCGGTAACC AAAATACTGT ATCAAACAAT AGTAATCCAA
   14641  CAATTCAAAA TGCCCCTAGT TCTATAGACA GAAATATTAA AGGTTACAAT TTACAGGCTT
   14701  ATTTTCCACA GGGAGGTTAT GCTATATTTC ATTTGAAAGA TAAAAATAAC GGTTGGAAAT
   14761  CATATGGTCA AGTAGGCAAG CGAGTTACAT CGGGATCTAC ACATAATTTT TGGTTAAAGA
   14821  CCAATGAATA TATATCAGGT AATAATCTAG ATTTAGTATG GGAGTTAAAA GTTGATAAAG
   14881  GTGCTAAAGG TTTTTCAGTA AAATCAGCGT ACGTTAATAA TGGTAATAAG TCTTTAATTC
   14941  AAAAACAAAG TGATGATTAT ATTGTAAAAT CAAATAGCAT AAAGTTTATT AATTATACTA
   15001  ATAATTCCTC TTTCAGAGTT TACAACCTAT TAGGTGAGCT GAAGGATGTA GATATGATAC
   15061  ATTCTTCTGA TTCGGTAATT CTAGATTTTA GTAATATGAA TCATGGCGTC TATTTGGTCA
   15121  AAACTTCTAA AGAAAAAGTA ATTAAATTTT TAAATAAGCG TAGGTAGTAT AATAGCTTAT
   15181  GTGATATGAA TGAAAGCGAT TGGTATTGTA TTTTAGGATA AACTGCGTAT AGTTATCAGG
   15241  TTTCTTCTCT TGTAAAGAAA CAATAATTAA GTTACTTAAG AATTAATTCA ATACCAGATT
   15301  TAAAAAAATT GAAGTTTATT GGCTTTGATT TCACCATAAC CCCATTGAAT ATAGTATTCA
   15361  TGGGGTTTCT TGTCTTTTCT AAATCAGTTT TTTTCATAAG CATTGGATAT TTCAATTTTT
   15421  TTGACAGATA ACTAAATTTA CAATGTATGA ATTGATAATT GTTTAGTGTA TAGTTATGTA
   15481  CTAAGGCATT TTGCTCTAAA ATAATCTTTA AATAATTGTT TTGGACTATT ATCTAAAATA
   15541  CCTATTTTGC CCTATTTTTT ATAGTATAAA GAGAGCATAG TTTTGTGATT AATTTAAAAA
   15601  TGAGAGAAAT GAAAAAAAAC TATGGATTAC TAATTATGCT GTTCTTCAGG GTATTCACTT
   15661  ATGGACAAGT TATTCTTAAC ATACCTGATG TAAATTTTAA AAATGCATTA CTAAATAACG
   15721  ACCCCGTAAT TGATACCAAT GGTGATGGAG AAATACAAAA CGGTGAAGCC TTTGTATTTG
   15781  GAGGACCTTT GTTTTTGGAT AACAAAGGGA TTGTTGATAT GACTGGTATC GAAGCGTTCA
   15841  ATAATGTGAG GATTATTCGT GCATCATCCA ATCAAATAGA AACGATAGAT CTATCAAAAC
   15901  ATACTTCGTT ACAGGAATTG TATTTGTCAA ACAACAAATT AAGACAATTA GATCTTTCTA
   15961  AGAATTCGAG ACTACTTCGT CTTGAGGTAG CCAGTAATAA TTTGGTTTCC TTAGATCTTA
   16021  GCTCAAATGC AAATATGAGA AATGTAAATG TAAGCAGTAA TACAATAAAA ATTCTCGATT
   16081  TTTCGAATAG TCCCTTTATG GAGCGATTTA TAGCCAATGG AAATGATTTA AGGTTCATAA
   16141  ACGCGCAGAA TGGAAGTAAT ACAGGGTTGA CAGACTTTGT GGTTAGCAAT AATCCAAATT
   16201  TAAGCTGTAT TATGATCGAC AACGTTGTTA GTTTTATTGT TCCTCTTACT TGGGAAAAAG
   16261  ATGCTACTGC AAGCTACAGC GAGAATTGTG TTGCACCTAT TGTCAATATT CCAGATGCTG
   16321  CATTTAAAGG GATTTTATTA AACCATAGTC CAGCTATCGA TACCAATAGC GATGGAGAAA
   16381  TACAAATTTC GGAAGCGGAA GCGGTGTCCA ATATAAATAC CTCTCGTAAT GGAGATATAG
   16441  AAGATTTAAC AGGGATCGAG TATTTTGTGA ATTTACGAAC ATTAGATTGT AGAGCTAGTG
   16501  CGCTAAAAAC ATTAGATGTA AGTAAAAATG TAAATTTAAC AACACTATAT TGTTCGTCTG
   16561  GTGAAATTAC TAGTTTAAAT ATTTCTAAAA ATACAGAATT AGAGGATTTA AGGTGTGGGG
   16621  ATAATTTTAT AAAATCATTA AATATTTCAA AAAACCCGAA GTTAGAGATT TTATTAGCTG
   16681  ATAAAAATGA TATGGAAACG TTTTTTGTTT CAGATATCGA AAATACGGTT TTACATACAC
   16741  TACACGTGCA GGAGAACAAG TTGAGGATTC TGAATGAAGC TAAATTTCCA GCCTTGGTAA
   16801  GTTTTAGATG TGAGCAGAAT CTAATTACCA GTTTAGATAT TTCAAATAAC CCTAACATTA
   16861  GGACTTTTTA CGCCTTTAGT AATGCGCTAA CCTCATTAAA TCTAAAAAAC GGGGCCAATA
   16921  CCCTTTTTAG TCCTCTACTA ACAAATAATC CAGATTTATA CTGTATTAAG GTAGATGATG
   16981  TCGATTATAG TAATACGAAC TGGAATGGCC TATCGAATAA AGATGATCAA GCGGTATATA
   17041  ATGAAACTTG TAGTACTAGG GGTATACTTA TACCAGATGA CAATTTTAAA GAGGCATTAC
   17101  TAAATTACAT CCCAGTAATA GACATCAATC AAGATGGACA AATACAGTCT TTCGAGGCTA
   17161  CAGCTTTTAC GGGTACGATG AATGTAGTAA ATAAAGATAT AGCTGATTTG ACAGGGATAG
   17221  AGCATTTTAC GAATATCACA AACTTATTTT GTAACAATAA TAGTCTAACG GCTTTAGACG
   17281  TATCTCAAAA CACAAAGTTA ACTACCTTAC ATTGTGGTTT TAATGACCTT TCTGCTTTAG
   17341  ACATTAGTAA AAATACAGAG TTAATAGATT TGTTTTTCAG CTTCAATAAG ATCAAAACAA
   17401  TAAATATTGC TTCGAATACA AAATTACAAA CACTAATAGG CTTTAATGCT GAGTTGGAAA
   17461  CCCTTGTAAG TGCTAGAGAT AATTATCCAA GTTTAACACG ATTGTTTTTA GCCAATAATA
   17521  AGTTATCAAC TTTAATTACA AGCCCGTTTT CGAATTTACA GATATTAACC TGTCAGGACA
   17581  ATGAGATAAG TGCTCTAGAT TTTTCTCTTA ACACAAAAAT TACTGAAATT TTAGTACAAA
   17641  ATAATCAATT GACAAGTGTC GATCTTAAAA ATGGGAATAA TGGCATATTC AAGTCCCTAG
   17701  ATAGTGATTT TTCAGGGAAT TCAGATTTAG AGTGTATCCA AGTAGATGAC TTAGACTTTA
   17761  GTAATAACCG TTGGATAGGC TTGAAAAGAG ATTCAGGAGT TCAGTTTAGC GAAGATTGTG
   17821  GTGCGAATTT AAGTGTGAAT GAATTCGAAT TAACAGCAAA CACCAATATC TTTCCTGTGC
   17881  CAGTAATTGA TCGTTTAACA ATAAACAGCA TATACGATAT CGTAGCTGTA GAGGTGTTAA
   17941  ACTTGGCGGG GAACACGGTA TTATTATCAA ATGAAAATAC AGAGAGTATC GATATGCAAG
   18001  ACCTTCCATC AGGCTTATAT CTTTTAAAGA TTACCTACAA TGAAGGAGTG GTGTATAAAA
   18061  AGATAATTAA AAACTAAGAA GATAATCTTA TCTAATCATT GAAAGGGCTT AGTATCAATC
   18121  CGGGTACTAA GCCCTTTTTA TTGCTTTTAC TGAATATCCG TAAATACTAA TAATTAGCAT
   18181  TGTGTCATCC TTTATTTCAG GATCTCATCT AGAATATGAA AATCAATAGG ATGAGATTCC
   18241  TTAAGCAAGG AATGACGAAA CGCTACTAGA TATTATCAAT TACGGATATT CAAATTGCTT
   18301  TTTTCTTCTG TTATATAATT CACAAAATTT TACAGTTAGT TAAAATTTAC TTCTTATTGT
   18361  GTGATTGTAT CTTTCAAACA CAGTTCAGGA AGTAATACCA TTTAGACTTT AAAGACGTCA
   18421  TAATAAAATG TTCTTTTTTC GCTGTCTTTT GAAAATAAAA ATAAGCCGTA ACCCTGCTAT
   18481  GCTTGATTTT TCTTTTATAT CGCTTTCAAA GCCTAAATGG TATAATATTC AAGGAATCTG
   18541  AGTCTCTATT ATATTTTACA GGTGTCATCT CTCGTGATTT TTCGTAATGA AATGTAAAAA
   18601  AATAGTACTT TGACAAAACT CAGTAGAGTT ATCGAGAGAT AAGTTTTGAT ACAAATTCAC
   18661  TTCGTTAACC TGCTGTAAAT CAATGTTAAA ATACGTAATT ATTTTGGAAA AATTAAACTC
   18721  GGGTAAGGAA GAACGAAAGT CAATAATTTC GCTAATAAAT AAGGGGAAAT ACCTAGAGTT
   18781  TTAATGTGAA GGTGTATGCT ATTGAATACT GATTTAGCTA TATATTATGA GAAAAGGATT
   18841  GAGAAAGGGA AAATGATGTA TTTTGAAATT ATAGAAGATA GAAAAACTAA ACATAGCCTT
   18901  AGCTACGTTT CTTTTTTATG TTGAGCTAGA ATTTTAAAAG GCACATTTTA ACCCAGTAAA
   18961  TTCAAATAGC TAATGGTATT AGAAACAAAA TACAGTAAAG AGTATCTGCG CCGTAGTAAA
   19021  AAGAGGCACT CCATATGGAT ATGCCTCTTG GTAAGAAAAA ATTACACTAA AAAGTTGATT
   19081  GAGCCATGTA AGGTAATTTT ATTATGGCGT TTTTAAAGTT TAAATGGTAT TAATCGAAGA
   19141  CGCCTAAAGC TATTCTTTAG CAAAACGTAG TGTTTTAGCA TCATTCTTGA ACTTTAAAAG
   19201  ATATAGACCT TTAATCAAAT TACTAATATC TATTGTTTGG TTGTTATCAA TCGAGCCTTG
   19261  TTTTACAGGT TGTCCTAATA GATTGTAAAT TTTGAATTGT CCAGATGTGT TTAAATTACT
   19321  AACCTTTATA AAGTTTTTTG CGGGGTTAGG GAAAAGTTCA ACTCTAGCTC CAGTTAAGTC
   19381  AAAATCATCG ATGCTTAGCG TAGCTGTTTC GTTATACAAT GTTGTTACTT CTGTGTCTGA
   19441  TATAGCTCTA GTCCATAAAC CAATTTCATC TAAATTCCCA TCAATGGCCT GCGGTGAACC
   19501  AGGCAAAGGG TATCTAGAAA ATTCTAAAAA TAGTTGGTAA TTAGGATTGG CATATATGCC
   19561  TTGCAACGAG GTGTCAGAGG CTTCTAAATT ACCATCAATA TAAATTCTTG CAGTTTGCGT
   19621  ACTCAAATCA TAAGTACAAG TTATCATATG CCAGTCCGTA AGATCAGCGC TGGTATTTGC
   19681  ATAAATTAAA GCGGCATTAG AACCAGCATC ACTTCCTAGT CCTAATCTAA ACCCTTGATT
   19741  TGGTATATAT ACCAACGAAT AGCTGTAACG GTCGTAGGCA CTTCCACCAT AACCACCTCT
   19801  GTGGAAAATA CGTTGCGTTT TGTTAATGTC ATTTGTTTTA AACCAAAAGT TAATCGTAAA
   19861  AGAAGTTGGT GCAAAATTAA ATAATGTAAT ATTATCTGCA TTATCAAAAG CATGACTTCG
   19921  ATTAATGGCA CCAGAGCTAA CTACCGTACT GAGTACTACT GTAGGGTCTT CATTACCAAT
   19981  TTCATCTACA ACTGTTTGAC TGTCTAAACT GTAATAGTGC GCTATATCGG TTGTAGGAGT
   20041  AGTATCTGGT AACTCATATT TTATGATTTT ACCATTATCA AAATCAGATA TATATAAGTC
   20101  ACCTTTGTAT GATGTAACAT CTCCAACGGC GCTTATATTC AGCAATTGTC CAAACGTACC
   20161  TACAGGATCA TTAATGTTAA AACTTAATAA TCTACCAGTA GGATTTTGTA AAAAGTATAT
   20221  AGTATTATTA ATAGCTGTCA TGCCAACGTT AATTCCAGCT AGTAATGGTT CTTGGCTACT
   20281  GTTTATGACA TTGCCTAATG AAGGGGTATT TGCTGTAAGA TCGAATTTCC TAATAGCATT
   20341  TTCTTGCGTT ACATAAGCAT CATTGCCAAT TTTTACAAAA TCGTAAATAA GGTTTGCTCC
   20401  AAATACTAAG GAAACATCAA TTGTAGGGTT GTCAAGATTA AATTTGAAAA CATTATTGTT
   20461  TGCACCCTTG GTGTATAAAT AATTATTATG AATTAACATC CCCTGAGGTT GTTCAATGCC
   20521  AACAAAAAAA TCTTGTCTAG TTGCTGGTAA GCTTGATGTA ACGTCTACTC TTGAAATTCT
   20581  GTTAGCTTCA GAAACATATA GCGTATTACC ATTAAAAACT AGCTCTTTAG GGGTATCTAA
   20641  GCCAGTAACA ACTTCTACTG GGCTAGGATT GGTCTGAGTA AGATCAATTT TAAGAATTCT
   20701  ATTGGCTGTG AGTTCTGTAA AGTATAATTC GTCACCATTT ATAGCAATGC CTCGAGGCTT
   20761  AGTTAATCCT GTGAGAATAT CTGTAGTTTG TGCAGAAGCA GCTGTTAAAA AGGAGAAAAA
   20821  CAGTCCCAGT AAAACGTGAA AATATTTCAT AATTTTTATT TGTTATTAAT GGGTATAAAA
   20881  CTATAGCTCA CACGTACGTT GAAAAATAGG GCAAAATGGG TATTTTTTGG TGTAATTGTA
   20941  AAAACACCTA AATTTTAAGA TGATAATATG ATTTTGTGTG ATATCTAAAA TTCTTTCGGA
   21001  TTTTTGGCTA AAGACTCACT TATCGTTTTT TTAAACGATC TCACCGTAAT GAAGTTGTAT
   21061  TTGCAAATCG CTTGACGATT TGAAAAATAC CCATTTTAGC CTATTTTTTT TAGTCTGTTT
   21121  GAGGGATAAT TTTGTATTTA AATGATAAAT CAAATACAAC TAAAGATAAG TTCCTTTATA
   21181  TTCCTCGTAC ACCTTTTGGT GATAACTATT TATGGTCAGG GATTTGTTAA TATACCCGAT
   21241  GCACATTTTA GGTAGGCATT ATTGGGTGAT TTTACCAGTC ACCCTAATAT AGATACCGAT
   21301  GGTGATGGAG AAATACAAAT TGCAGAGGCT AAGGCCGTAG AAGTATTAAA TTTAAGAAAT
   21361  AAAGGTATTC TAGATTTAAG AGGGATAGAG TATTTTGTAA ATTTAAAAGA ACTATATATA
   21421  GAACACAATC GGTTAACAAG TCTAGATATT TCTAAAAATA AACAGTTAAA AGAATTATAT
   21481  GCTCAAGGTA CTCTCTTAAC TACACTGAAT ATTGCAAGCA ATGAAAAACT TGAGGTCGCG
   21541  GATATTCGTG GAGGTGAATT AGAGATGTTA GAGGTTGATA ACTGTGGTAA CCCTCATTTA
   21601  CGAGAACTTA TACTAACAGA TTGCTTTTTT ACAAACTTGG ATAAATCTAA GTTTCCTAAT
   21661  TTGAAAATAC AGTTTTGTAA CTATATTGAT TAGTTTACAT TATAGCTTAA GTGTTAACGA
   21721  ATTCTAGTTT ACAACAAATA CTGTACGTAA ACACAGCCAT AGCAAATGTT ACAAATACCC
   21781  ATTTTACCCT ATTTTTAAAT ACACAATACG TGTCTAGTTT TGAAGCTCAA AAAAAATAAC
   21841  TAGACAATGA AAAACAATTA TTTCTTACTA ATTACACTAT TTTTAAGTGT AACACTTTTT
   21901  GGTCAGTCTG TGGTTAACAT CCCAGATGTC AACTTTAAAA ACGCACTTAT AAATCATAGT
   21961  CCAACAATTG ATACGAATAG TGATGGAGAA ATACAGTTAA CAGAAGCAGA GGCTTTTTCT
   22021  GGTTCACTTG CGGTATCTAA CAAAAATATT TCTGATTTAA CGGGTATAGG GGCCTTTATT
   22081  AATATTACTC GTTTAGGTTG TTCTGGAAAT AATCTAAGTA CTATCAATAT CTCTAATAAT
   22141  AAAAAAATGC AATTTTTAGC TTGTTTAGAA AATCATTTAA AAAGTTTAGA TATTACTAAT
   22201  AATTTAGATT TAAAAGCCTT ATGGATCAAT AGCAATGAAA TGGAAACCCT AGACCTTTCT
   22261  AAAAATTTAG CTTTACAAGA ATTATCGTGT TTCAAAAATA ATCTGTCAAG GTTAGATGTC
   22321  TCTAAAAATT TAGACCTGCA AATTTTCTAT TGTTATGAGA ATAATTTGAC AACGATAGAC
   22381  ATCTCTAAAA ATGTAAATCT AAAAGTTTTA TGGTGTAGCA ACAATGATAT AAAGTCATTA
   22441  GATGTTTCTA AAAATATGTA CTTAAGAGAG CTATCTTGTT CTAATATTAA TCTAACCTCC
   22501  TTAGACATAT CAAAAAATTT AGAATTAGAT AGACTTTCTT GTTCTAATAA TAAATTAACT
   22561  GCTCTAGATC TCTCTAAGCA TACAAAGCTA GAAAGATTAA ATGCCAGCAA CAACCAATTA
   22621  ACTCGATTGA ATCTTAAAAA CGGAGTAAAT ACAGACTTCG AGCATAGTTT CTTAAACTTT
   22681  AGAAATAACC CTGATTTAAC CTGTATCCAA GTAGACGATG CCAACTTTAG TAATACCAAT
   22741  TGGTCTTCGA TTAAAGATGA TACAGCTGAT TTTAGTGAAG CATGTGATTA TGTTATAGTG
   22801  TTCCCTGATG CCAACTTTAA AACTGCGTTA TTAAATCATG ATCCAGTAAT TGATACCAAT
   22861  GACGATGGCG AAATACAGAT TTCGGAAGCT GAAAGTGCCA TTACTCTAAA TATAGCAAGG
   22921  GCAAACATTA ATAGCTTAGA AGGTATAGCC TATTTTGTGA ATTTAGAAGA ACTTTTTTGT
   22981  GCTATAAATA ATTTGGATGC TATCGATATT TCACAAAATG TCAAATTGAA AAAACTGTAT
   23041  TGTGCTTCGA ATAATTTAAG GGAATTAGAT ATTGCAAAAA ACACGGTATT AGAAGAATTG
   23101  TCTTTTGGTT TTAACGGGGT AAAAAGTATT GCCCTAACAT CTACAAAATT GAAATTAATA
   23161  ACAGCCACAA ATGGAATATT GGAAGAATTA CTTGTGCTAA GAGGTACAAC TTATCCCGAT
   23221  CTAAAGGAAA TATATTTGAC TCAAAATAAT TTAACTCAAT TATTTCTTCC TGCTTTTCCT
   23281  AATTTGGAGT TTTTGTCCTG TGCAGACAAT AAGCTTACCT CACTAGACTT GTCAAGTAAT
   23341  ACTAAGATTA AAGAGGTCTA TGCCTTTAAC AATCTTTTGA CCGAAGTAAA TCTAAAGAAT
   23401  GGAAACAATG AAAATATAGA TGTTACACGA GGCTTAACAA GTTTTGCTCT CAATATTGAT
   23461  TTAGATTGTA TCGAAGTAGA TGATGTAGCC TATAGTAATG CCAATTGGCA AGGGATTAAG
   23521  GATAGTGCAA CACAGTTTAG CGAAGATTGC GGTGCGGGGC TTAGTATTAC TGATTTTGAA
   23581  TTAGCTTCAA ACACTAGTGT CTTTCCAATT CCTGTAATCG ATGATTTAAC CATAAATAGT
   23641  AACTAACTAT GATATTGTAT CATGCGAGGT GTTAAACTTG GTTGGCAAAA CAGTACTAGT
   23701  TGCAAATGAA AATCCAGATA GTATCGATAT GGAACACCTT CCTTCGGGCT TATATCTTTT
   23761  AAAGGTTACT TATAATGAAG GAGTGGTCTA CAAAAAAATA ATGAAAAAAT AAGGTGATCA
   23821  CTAACCATTG AAAAGAGTTT GGTCCAGTGT ACTAAGCTCT TTTCATTTGC AGTGGCTATG
   23881  GGTAATACCA TTTGAGCTTT GAAAGCAGTA TTAAAGATAA TTAAGATTTT TTAGATGTAT
   23941  TAAAAAAGAA AAATCAAGCA TAGCAGTACT ACGGTTTATT TTTATTTTGA AAAGACAGTG
   24001  AAAAAAGAAC ATTTTATTAG GGCATTTTTA AAGCTCAAAT GGTATAAATC TCGTGCTTAT
   24061  CTAAAAAATA CCCATTTTGC CCTATTTTTT TAAGTTCGTG CAGAGAGTAG TTTTGACCTC
   24121  TAAAGATAAA CAGAATAAAA TGAAGAAAAA CTACTTAATA TTTTTTGCTC ATCTCTTAGT
   24181  GTTGGCAATT CATGGCCAGG GGATAGTTAA TATCCCTGAT GCAAACTTTA AAGATGCATT
   24241  ATTAAACCAT AACCCTGTAA TTGATACTAA TGGAGATAGT GAAATACAGG TGTCTGAAGC
   24301  CGAAGCGTTT CTCGGGCGAA TCAATATTTT TGCTAAAAAC GTCTCTGATT TAACAGGTGT
   24361  TGAGGCTTTT GTGAATATAA GTGGGTTGAA TTGTGGTTTT AATAATTTGA CCGAAATAGA
   24421  TGTATCAAAA AATACAGAGA TAACATTTTT AAGTTTCGGT CTAAATCCAA TAAAGCAGAT
   24481  AAATATATCT TCGAACCTAA AGTTAGAAGA ATTGTTAGGG AATTTTTCAG ATTTAGAAAC
   24541  ACTTTTGATG CCAAACGTGA TTAATGAAAA TTTGACGGAT ATATTTTTAA ATGATACTGA
   24601  AATTTCCCAG TTGGACACTA CTCCTTTTCC TAATTTGAAT ATTATAAGTT GTATAAATGC
   24661  AAAATTGAAT TCGTTAGATG TGTCGAATAA TACAAAGTTG AGACAACTTT TAGTTCAAAA
   24721  TAATCGTTTG GTTAGCTTAA ATCTTAAAAA CGGGAATAAC CCTTTTTTAT TAGGGTTTGA
   24781  TAGAACAGCA TCTAATTTCA CTAATAATCC AGACCTTGAT TGCATACAAG TAGATGATGC
   24841  TGACTTTAGC AATACAAATT GGGGGACAAT TAAAGATAGC GGAGCACAAT TTAGTGAAGA
   24901  TTGCCAGGGG AGTCTTGGTA TTGAAGAACT GGAATTAGCT TCACACACTA GTGTCTTTCC
   24961  AATTCCTGTA ATCGATGATT TAACCATAAA CAGTAAATAT AATATTGTAT CATGCGAAGT
   25021  GTTAAACTTG ATCGGAAAAA CTGTGCTAGT TGTAAATGAA AACACAGATA GTATTGATAT
   25081  GGGACACTTT CCTACTGGAG TATATCTTGT AAAGATTACT TACGATGAAG GAGTGGTGTT
   25141  CAAAAAAGTA TGTAAAAAAT AGTTTTGTTG TTGGTAGAAT GGTGGAGGGG TTGGTCCTAA
   25201  CAATTCCTTC ATCTGTTCTA CGTTGATATT AAATCAAGTT AAAATTAAGG GCAAATTCGA
   25261  TCAATTGAAT TTTGGAATCA AATCCTGCTT TTTTGTAGAT GTTCTTTTTG TGTTTTATTA
   25321  CAGTATGATG AGATAAAAAA AGGATATCAG CAATTTCATT AACGTTTTTT CCATTACAAA
   25381  CCCATTTTAT AATTTCTTTT TCTCGTTTAG AAAACGAGGT ATAAAATGAA ACATTCTCTT
   25441  CGATGTATTT CGATGATTCT AAAACGGTAT TGACCTCCAA ATAAAAATCA TCTATCTGTG
   25501  TCATGGCCGT AGTAACCGCC TGAAAAACAC TTTTTGTAAA ATCGGCCTTA ACACAGGTGA
   25561  AATAGGTTTT ATAATCTTCG TCACCAACCA TCTTAAGTCG TTGATTGTAA ATCAAGGTTT
   25621  CCTCTTCAGA TCCTTTTTTT GCGAATTCCG TTAATAGGTT TACACACCTT TCTATATCCT
   25681  CGGGATGCAT AATTTCAGCT AGGAAGGCTG GTCCTAAAGC TCTAATTTCT TCCAGAGTCT
   25741  TGCCATAAAT TTCACATCCT TTTTCTTCGA GATAAAGTAA TTCGATGGTA TTGATGTCAT
   25801  TTTCATGATA AAACCCTAAA AAATCTTCGA GGCTATCAGT TCCTTGGTTA CTTATTTTTT
   25861  CTTTTAAAAC AGCAATGGTC GATGCTGCGT TTTTAAATTT TGTCATTTAT CTATTTTAAA
   25921  TTTTGTACAG AAATAGTAGA AGTCATAAAA GTTATTGACA TTCAGTTTCT TGTAAATGTT
   25981  GATTTTATGG TTTTTGATTG TGTGTATCGA TAGATGTAAA GAGTCAGCGA TATCTTTTAG
   26041  ACTATTTTCT TGACAAAAAT ATTGACATAG CATTACCTCC TTTTTTGTTA AGGAATCGAA
   26101  AACGGCTAGA TTCCTCTTTA TAAAAGAACT GTTTTGAAAT AAATCAAGTA CCGTATGATT
   26161  AAAAAGTTTT AGCTCATGAG TAGGAACACT TAAATTTATT ATTCTATTAT CGTCTAAAAC
   26221  CCTTCCTCTT GTATAAAAAC AATGTTCTTC TTTTTCTTTG GGAAATTTGA CTCTTTGGAA
   26281  AAAAGCTACA TGATTTTGCG TTTCTAGATT TTCTAAATAT TTAAAATTAG CATCAATTGC
   26341  ATTGCGAAGA TCGTCTGGAT TGACCATTTC TATCATAAGT TCGGGACCAT GTTGCAGTAG
   26401  TTCATCTGCA GTCCGATCGA TATGATTCAA AACAGTACTA TCTGCTTCTA AAATTCGAAA
   26461  ATCATCTAAA GAATTAGTGT GTATATGACA AGGTAAGTAA TCACTAATTT CTTGTATTGT
   26521  TTTTTCTCCG CTCAAAATTT GACGGCTGAT TTCTGTGATG CTAAAATTTT GCAATAGAAC
   26581  TTGATTTGAT AGATATTCAA ATTTAACTAT ATCCCAACAA AATTTGTTTT GTACAAGAGC
   26641  AATTTTTTAG GCAAGTATTT GTTTTAAAAA AATGATGTAA CTTAAGTAAA CGGTGGTACT
   26701  TGTAGAATTT TAATCTTTAA CTAGTCATTC TTTTGTTCAT ATTTAGTATA ATTTATAACT
   26761  CTTTAAAATT ATTATTGATA AGTCGTATAA GTACTTTTGG GTAATTAAAA AAGGTAAATA
   26821  GCAATTAAAC AATTCAAGTC TTCTTTCTTA ATTAGAATAA ACTGTATTGG AAAAATCGTA
   26881  TTTAGTCTTG ATGTTATTTT TGGAGTACCT TGGATTTAGA TGAGGACACA ATAAAAAGAT
   26941  ATGTCAAATC TTACCAATAG TTTTTGAGCT GCTGCCTCTA TAAGGCGAAT TGGTAGAGAG
   27001  ATAAATTTAA ATGCTCATAT TTTAAATCAT TTGCTGACTT AAAATTAATT CAATATCAGA
   27061  TTTCAAAAAG TTCGAACTCT GTCCGCTTTG GTTCACGAAT AAATAAAAAA GGAGAAAAAT
   27121  AATTTAAGCT TGCTCATAAA TTATTTTTCT CCTTTTTGTT TTCAAAGTTT AGCTTTGAGG
   27181  GGTGTGCGTT AGCGAATCCT ATTCGTAATA GAAACTTCGA ATTTTGTCCG TTCAATGTGA
   27241  CTACATAAGC AGGATTTTTC CTATTGCTGT GATTTGTATT GAAATGAATC AGTCCATTTA
   27301  TGGAACACAT TTTTATAAAA GACTCGTAGA GGTTGCATAG ATAGTAGTTT AATCAATCTT
   27361  TTATTTATTG GGGGGGGTGT TGTTGCAAAA CGGATAATCA ATATAACCAT GTTTCCCACC
   27421  ACCAAATATT GTTGCCCTAT CTGGCTTATT AAGTCTGAAA TTTTTTTCAA AACGTTCTGG
   27481  CAGGTCGGGA TTAGCGATGT ATAACGTACC AAAGGAAATA AGCTTTGCAA TGCCTTTTTC
   27541  AAGTTCTGCT TCGGCAGAGT CCTTATCGTA TCCTGCATTA GCAATAACTG TATGACGAAT
   27601  CATCCTCCCA AATAATTCAA TTTCGTTGTC AGTTGCATAA TGTTTTGGTG ATGGGAAAAA
   27661  TGTACTACGC TTCTGAATCT CCACATAGGC AAAGTCCAGT TTGTTCAGTT CTTTAATTAG
   27721  ATACGAATAA GTGGCAGAAG GGTCATCCAG TATAATATCA CCGTAGGGAT GGAATGGAGA
   27781  TATTTTAATA CCCACCTTTT CACTTCCTAC CGAACTGATT AATTCCTGCA TTACCTCTAG
   27841  CACAAAGCGG CATTTATTAG GGATGCTACC GCCATATTCA TCCGTCCTTT GGTTGGCACT
   27901  TTCAGCTAAG AACTGGCTGG GCAGATAGCC ATTAGCAGCG TGCAACTGAA CTCCATCAAA
   27961  CCCTGCTGCT ATTGCATTTT TTGCGGCCTG ACCAAAGTCC TTTATGGTCT GTTTGATTTC
   28021  TGGTATTGTT ATTTCCTGAG GTATTTCGTA TTCCTTTTTC CCCTGAGAAG TAAAGTGCTG
   28081  CATTCCCCAT ATAGGAATGG GGGATGGCGC AAGAGGGAGC TTGCCGTTTC TGTCTACAGA
   28141  ATGTCCCATA CGGCCGGTAT GCCAAAGCTG TGCAATAATA ACACCGCCTT TTTCGTGTAC
   28201  TGCCGTTGTA ACCTTCTTCC ATGCTTCTAT TTGTTTGTCT GTGAAAATAC CTGGAGTAAG
   28261  CGGGCTACCA GTAGCCTCTT TACTAATTCG GATAGATTCT GTTAACATCA AACCAGCGCT
   28321  AGCCCTTTGG GTGTAGTATT CTACTGTTAT ATCACCCACC AATCCATTTC TGTCTACGCG
   28381  ACCTCTGGTC ATAGCTGCCA TCGCCATTCT ATTCTTCAGG TTGACACCTC CTAATTGTAC
   28441  TTTTTCTAAA AGTTTCATTT GATATTTTTC TAGCTTTTAT TTTTGTTAAG TCCGTTTTAT
   28501  GTATTAGAAC TTCGACATGA GGCTGTGATA TACAATAAAT ACTAGTGTTT TCTTAATTTT
   28561  AGCATAGTTA TCACTATGGT TAAATCAAAA AACTCAGTTT ACGTTAGCAT TTGAAGTAGA
   28621  TTGCAGCTGT AATAGATTTT CTAATGCATA AAACGGGTTA AAGTCTACCG AAAAAAATGG
   28681  CCCATAAATT CTTTCTCAGC AATCGGACTT TTTGTTGATA CACAGTATCA TTTTGTGAAA
   28741  ATTATACTTC TTTTCGTCTG GCCATACGCT GAGCGATTAC GCTGGCGGCA ATCAATTGCA
   28801  AGGCATGGTA AAGCATGAGT GGTAACAATA CTATTCCGGT GATGGTACTA TGCTGAAAGA
   28861  GTACTTTTGA CATGACCGTT CCGTGTACCA ATGACTTTTT AGACCCACAA AATAAGACCG
   28921  TAATGCGGTC TTCATTTGAA AAGCCAAACC ACTTGCTGAG TAATCCCACA CAAAAGAATA
   28981  CGGTAAAAAA CAAAGCCATC ATCCCTACAG CAAGTCCGGC AAGTTCCAGA GCAGAGAAGC
   29041  TTGCAAAAAG ATGTTCGGAA AAAGACTTGC AAAACGAGGT GTAAATAATG GTGAGGATGA
   29101  TTGCCTGATC GAAATACTTC AGTTGCTTCT TGTATTTTTT GGCAATGTTA CCAAAACGGG
   29161  AGTTGAGGCT TATACCGATG ATAACTGGTA ACAAAACCTG AAGAACCAAC TTTAAAACAA
   29221  TGTCGCTTAC ATCAAAACTA CCTGTTGCAG AAGCGATGAA CAGCCCTATC CATAGTGGAG
   29281  TAGCCACTAC TCCAATCAAA CTGGAAATGC TCGCATTGAA AATGGCTGCG GGAACGTTGC
   29341  CCTTTGCAAT GGAAATCATA ACAACCGAAG ATGAAACTGT TGACGGCAAA GCTGCTAGAA
   29401  AAAATATACC CAACCAAAGC AATTCTAAAT CGGTTTTCAC GAAAAAAGGT CGAAATGCCA
   29461  AAACTAGAAG TGGAAAAAAT AAAAAGGTAG TCAACTGAAC AATAATGTGC ATTTTCCAGT
   29521  TTGAAAGTCC TACCTTTAGT TTTTCAATAC TTAGTTTTAA GCCATAAAAC AAGAAAATAA
   29581  ATGAAACGCC AATATTGGCA ATTTGACCTA GCGAAACAGG TTCTTTAATC ATTCCTGGCT
   29641  GAGGCAAAAA ATAGGCAAGT AGAATCATAC TACCTATCAT TAATATGAAA CCGTCTAAAC
   29701  CTACTTTATT TAATACTTCT AATAACTTCT TCAAAATGCT CTTACTATGT TTTTCTATTC
   29761  ATCTCAGATT ATTTGTCAAT TAATACATTA GAACTAAATC CCAAGTTCTT TGCGTATTAT
   29821  TTCTGCTCCA GCGCTTAAAG CACTTAACTT ACCTCTTGCG ACATTTCGAG ATAAAGGAGC
   29881  CATACCACAG TTGGTACAAG GATAAAGGTT TTCAATATTT ACAAAATCAA GTGCTTTACG
   29941  TAGTGTATCC GCTACTTCTT CTGGTGTTTC GATGGTATTA GTTGCCACAT CGATTGCACC
   30001  TACCATTACT TTTTTACCAC GAACGAGTTC AATTAAATTG AAAGGTACAC GTGAGCCATG
   30061  ACATTCTAAT GACACAATAT CAATATTAGA ACTTTGAATT TTAGGGAAAA TTTCTTCGTA
   30121  TTGACGCCAC TCTGAACCCA ATGTCTTTTT CCAATCATTA TTAGCTTTTA TTCCGTAACC
   30181  GTAACAAATA TGTACAGCAG TTTCGCAGTG TAAACCTTCA ATGGCTCTTT CTAACGTAGC
   30241  TATTCCCCAA TCGTTTACTT CCTCAAAAAA TACATTAAAT GCGGGTTCAT CAAACTGAAT
   30301  AATATCTACT CCAGCATCCT GCAATTCTCT TGCCTCTTCA TTTAGTGCTT TTGCAAATTC
   30361  CCAAGCTAAT TTTTCTCGAC TTTTGTAATG GCCATCGTAT AATGTATCTA CCATTGTCAT
   30421  CGGTCCAGGT AATGCCCATT TTATAGGCTT ATCAGTCTGT TTACGTAAAA ATTTAGCATC
   30481  ATCAACAAAA ACTGCTTTTT GGCGGGTAAC CTCATCTACA ACAACAGGAA CACTCGCGTT
   30541  ATAACGGTCA CGAATTTTTA CAGTTTTGCG ATTTTTAAAA TCCACACCAC TTAAATGCTC
   30601  GATAAAAGTT GTAACAAAAT GTTGACGTGT TTGTTCACCG TCACTAATGA TATCAACCCC
   30661  TGCCAATTGT TGCTCTTGCA ATGCAATGCG CAAAGCATCT TGTTTCCCTT CTAGTAATTG
   30721  ATCCTCTTCT AAGTTCCATG GTGACCACAA TTTTTTAGGA GGCGCAAGCC ATGCAGGTTT
   30781  TGGCAAACTT CCAACAATTG AGGTTGGTAA TATTTTTTTC ATAATAAGAT GGTTATAATG
   30841  TTTTAAATTA ATTAAAGATC GAAATCGGCA GCCCACTGCT CAAGAATATA TTGGTAAGGT
   30901  TTGATGAAAT ATTCTTCACA ATATTTACCC TGCTCAATAG CCAGTTGACT GCGTTCAACA
   30961  CGATCATACT CTACACGTGT CAGTGAGTAA TCTTCATGTT TAAGACTAGG TTGAAAGATT
   31021  TTACCAGCCA CAGAATTTGC ATTGTAAATT TCGGGGCGAT AAATCTTTTG GAAAGTCTCC
   31081  ATTGTGCTAA TTGAGCTGAT CAATCCAAGA TCAGTATACT CTTTAAGTAG GTCACCGGTA
   31141  TGATAAAAAG CCATGGGTGC TACACTATTT GCCGGCATGA AAAAACGAAC TTTCATGCCC
   31201  ATTTTAGAGA AATATTGGTC AGTGAGAGAA TATTCATTCT GTAAGTACTC AAAACCAAGC
   31261  ACCGGATGCT GAAACTCGGT GCGAGTATAT ATTTTGTTGC CCGATACACT TAGACAAATA
   31321  ATAGGTGATT GCTTAAAGTG TTCTTTATAT GTCTCTGATC TTACAAAAGA CTGATAAAGC
   31381  TTGCCGTGCA AATCACCAAA CTTTTCCGGA ACTGTAAATT TAGGTTTGTC TTTATTGTAC
   31441  TCGATTAATA AAATACTGAA ATCATAGTCA CGGACGTATG AGGAAAAATT ATTTCCTGCA
   31501  ACACCTTCGA CATACTGATT CGTTTTACGA TCTAAAATAT TCGTTTTCAA AACTTCCATC
   31561  ATCGGCAGAT TGTCAATACT TTTTTTATGA TCAATATTCA ATGTTACTGT CATGATTTCA
   31621  AGTTCTACAT GGTAACGATC ACCTTTTGGG TTATCTAAAT GAGCCAGTGC ATTGAATCGA
   31681  TTGTTGATCA TATTCAAAGC GTTCCGTAAG TTTTGCTGGC GATCAACACC TCTGGCCAAG
   31741  TTTGCGAAGT TGGTTGTTAA ACGTGTATTA CTTTCCGGGT GATAGTTTTC ATCTAAACGC
   31801  CTGCTCATTA GTGTGAATGA AAAATCTGTT TTGATAGTAT TCTGGGTGTT TTTCATAGCT
   31861  TTTTTCCTTC AATTTTGAAT CTTCTAGTAG GTTCGATTTA ATTGTTTGCG AATAGTTGTT
   31921  ATACACTGCA AATCTTATAA TAAAAGATTA TTTAATTACT ATGTTAATTA AAATAAGTCA
   31981  AATAATCTTT ATAATGGGTT TTGGTAGATA AAATATCTTT TATCTTGGTG ATTTAATTCG
   32041  TAAAAAGAAA ATTTATCTAC GGTTGACTTA GACCAAACTG ATTTGAAGTT ATTAGAGTTG
   32101  CTTCAATAAA GCAGGAAATT GACTAGAAAA TAGATTGCAC AACAAGTGAA TCTATCGCCA
   32161  ACTCCTGTTT ATGAAAGAAT AAGAGGTTTG GAAAGAGAAG GAGTTATTAA AAATATGTAG
   32221  TATTGGTGGA ACCAGTAAAA GTAGAGTAGG ATCTTATCGT TTTTTGTGAT ATTACTTTGA
   32281  AAGAGCATAC TAAAGAAATA GGTCATCAAT TTGTAGGGGA TACTATGCTA TCTAAATTAT
   32341  TTCTGTGGGT GTTATAATAT TTCAAGGGAT TATGATTTTT GATTAAAGGT AATGGTCAGA
   32401  GATATGAAAC ATTATCAGGA TTTTGTATTC AATAATTTAG GTTCAATAAA AAATATAGGG
   32461  GGTGCTCATT GTACATTTGT TATGGGAGTT ATAAAACATG ACTATGCTGT ACCGATATAA
   32521  AGTGTGATGC CCTATAACTT AGGACGTCTT TTTCAGGGCG TCTGAAAATT TTAAATTAAG
   32581  ATCACTTATT AAATTATTTT TGTGCTAATG TTCGATTTTG ATAGAATTAG ATAAATATCT
   32641  TCTCTAAAAA AGTTCGAACT CTCTCTGCTT TGGTTCACAT TAGAAAGCCA GACAATTTTG
   32701  TCTGGCTTTC TTTGTTATGG TTGCTTTTAT ATTTTATTTA AATTTTGACT GAGCCATTTT
   32761  ACAGAAATTA ATTCTTCCAT TTGTATCAAA ATTATTTTAG TGTCTAATAT AAATAATTCA
   32821  GGTTGAGGTA TAAGCGATTA ATTTCGGTAG GATATTATTT ATTGGTGTTT TTTATTTTTG
   32881  GAGCTAGCTT TTACATAAAT ATGTAGATTG TAATAAAAAG AGGGTGCAAC TTTAAATTGC
   32941  ACCCTATTAA TCAATATAAA TTCAATTTAA TAAAAAAGAA TTATTTGTTT ATAACAATTC
   33001  GTTCAACTCT TTTAAAGGTA TCTCCTGTTA ATTCTAATAG ATAAACCCCA TTGGCTAATA
   33061  AGCTTACATC TAAATTATTA TTATTTAATG GCGTACTAAG TACTTTTGCC CCTTCTATGT
   33121  TAAATATGGT AACAGTATGG AATTCTTCTA TATTACTTAC AGATACGGTA TGTTGGGCAG
   33181  GGTTGGGATA AAGAATAGTT TCGGGGGATT TGTCATCCAG TGACTTAGCT CCTGAAACCG
   33241  CATCAAAACT CCATTGTTGG TTTTGATTGG TGTTACTACT AGCCCATAAA TAGACATTTT
   33301  GTTGTCTAGC TCCACCATTA CCACCATCAA TTGAAAAGCC GGGTGCATTA CGTTTTTCTA
   33361  ATCGGAATCG TCCGTTAATG TTCACTTTTC GCCAATGTTG ATTTTGGTTA TTAGTACCGC
   33421  ATGTAAATAA TTTTACAGTT TGACCATTGG CTCCTCCGGT TCCACCATCT AAACAAAAGT
   33481  TAGTATTTTT CTTTCGGTAA CTAAAAAAAC CATTACCTCT ATTAATTTCT TCCCATTGTT
   33541  GGTTCACATT TGAAGTACTT CTATTCCATA AATACACATT TTGCTGGTTT GCACCGCCAT
   33601  TACCACCATC AATTGAAAAA CCTGAAGCAT TACGTTTAGT TAACACAAAT GTATTCCCGT
   33661  TATTACCATT GTTTCCACCA CCGCCATTGT TATTACAGTT GGCATCTGGG AATTTATCAT
   33721  TTATGCCGAC TATAGGTAAT TTTGGTTGGT TTGAAAATCC ATTGTAACCA ATAGTACCAA
   33781  AGAAAACACC AAAAGAGTTA CTATCATAAA TAACGGGCGC AATTGCTGGG CCAATATAGC
   33841  TATAGCCATC AGGACCAGGT CTTGAAGAGG TGAGAGATTT TAATGGACAG GGTACAAATA
   33901  CTCGGTGATT TGGTCTTATT TGTGCGGTTG TACCATAATT GACTTGTATT CCTGTAATTC
   33961  TCGAATTATT AGCAAATGAT CCAATACCTC TATCTCCAAA TCCACGTTCT ACTCTTACTC
   34021  CAAAAGAACA ACTATTGGAT GTTACTCCAT TAATATTTAC TGTTCCTCCT ACAGCCGAAT
   34081  GAGGAGAAAG CATTACCGCT GCATTTCCAT TGGTACCTAT GATATTTCTA CCTACAATAT
   34141  CTGTTGCCCC AACAGTTTCA AAATTGGCAG GTTCAAGGCG AAGTGCGATT CCTCCTTCGC
   34201  TAGAAAGGTT TTTAAATAAA ACTCGATCGG CTTTTCCAGC TTGGACACAG CCATAGCCGT
   34261  AACTGGCATT CAATACATCA ATATTTTTTA TAATACCTCC TTCGGGTGCT TGATTATTAA
   34321  ATCCTCTTCC TAAAACAAAA GCGGATTGCT CGGTAAGGTT TTCTATAACT CTAGCATTTT
   34381  CAAATTTGAA ATTTTTAACA TTTTCAACTT TAACGAAAAT ACAAATTTCA TCGGTGTTAG
   34441  CGCCATCCAT ATTTACTGTG AATTTACCGC CATCACCTCT AATACTTACA TTTTCTACAG
   34501  CGTTTCTACT TCCTACCCAA AAAATAGCAC CCCAAGGATT ATCATTTTCG GGTAATTTAA
   34561  TTACTGCATT AGGAGAAAAT ACTAGGTGGA CATTACTCTC TAAGTGTACA AATTTTATGC
   34621  GATACTCACC TGCTGGGAAA TAAATTTTCC CACCATTAGG TTGTTTACTA ACATCGTTAA
   34681  TAGCGCGTCT TACTGCCGGA GAGTCATCAG TATTGTCATT AACAGTAGCG CCATAATCTG
   34741  TAATGACATT TTTACTTACA CCATTGTTAA ATGTTTCTCT GTAAAATCTA TTTTCATTGT
   34801  CAATTTGACC AAAAAAAGGA GTGATCATTA AGTTGATTAA AACCAATAAA AGAACTGATT
   34861  TTAAGTGGGG AATTTTTAAA TACGTTTTCA TTTTTGATTG TTGTTTGTTA TTAAAAAATT
   34921  AGAACGACCA TAAACAATTT GAGCAAATTA TGGACGGGTT ATAATTTAAT AAATAACTAC
   34981  CATTAAATCA ATGAATTACA TGTAAGAAGA GTATGTCGGA ATATGTGATG ATTTGTGTTA
   35041  AATTTCTATG AAATAAATAT AAAACTAGTT TAGGTGATGG ACGATTAAAA TCCAAAAATC
   35101  AAGGTGTTGA TCAAACTGAA AGTCTTGTTT TAAAGAAGCC TTTTTAGCTA GTTATAGTGC
   35161  TACCTATTTT TATGCCTATT CAATTGTTTT AAATTTTGGC ACAAAATAGT TTAAGCAATA
   35221  AAGCATTACT CCGTAAGTAA AAATGAGTGT TGGCATGTTG GTGTTAAAAC CGAGATCAAA
   35281  TTCTGGAATA CCAAGAATTT CTCTAAAAGA ACGAGTAGCA ATAAGTAGCA TAAAAATAAT
   35341  TCCGTAACCG AAAACGGCAA TAATAGCTAG TTTGTTTTTA CGGGTTCGTA TAATCCCTTT
   35401  TTTTGTTTCT TCTGTGAAGA AATACCAAAG TGCTCCAGTG CTAAATATTG CTTCAATAAA
   35461  AATGGCTAAA TAAGGACTAG AAGCATATAG ACCAAGGCCG GCTTCCATTG TATCAGCTCC
   35521  AAATAGATGA TGCATATGAC CAGAAAAAAA ATCCAATATA AAATGTACTG CTACCAATAG
   35581  GATACTTACT AATCCTATTT GTGTACTTTT AAATAGGAAT TTTCCAATTG CGAATACTAT
   35641  AATGAACCAT ACTAATTGGG GTAATAAATC GTGGCTATAT AGCATATCTA CAGCCATATT
   35701  AGTTAAGGTA GCATCAAAAG CATCACTTGG TGTAGTAGGC TCAAGGCCTA AATAATGAAA
   35761  GATAAACCAT AAAAAATCTT GTAATTGTAC TATAATTAAA AAATAAAGTA AAGATCCTTT
   35821  TGGGAATTTT TGTTTGGCTA TTAATGCGGT AGTAAAATGT CCTGCGAGCA TAATTCCTGT
   35881  TTTTGATTTA TTTGGAGGTT TCTTTTCGAG ATGTACCTTA TTCATCTTAC CGATCAATTA
   35941  AAAGTAAATT AATCATCTAC CCCTCCGTAT CAGTCACGAG CTTTTTGTTT TTAATTTATG
   36001  AGTTTGTAAA TTAAAATACT GATTTTGAGT ATTCAAGATA TGAAAAAAAT AGGGTTTACT
   36061  CTTTGTAGTA AAAAATAATG CTGTAAAGAA TAGCTTATTT TTAATTAGAG ACTTTGGTTC
   36121  AAGTATTATT TATTGGGAAG TAGGAATAAC TAAGCATACA TTTTTCACTA TAAAACAAAG
   36181  ATAACTTAAT TTAGAATTAG TTGTTTTAAA GATACTTAGA GCAAGATCAA AGCTTCCTAT
   36241  ATTTTTTAGG ATATAGTTAT TGAACATCTA GTTGTTAGTA TCTGGATTTC TTATTAATTC
   36301  GTAATTAGTA CTTCTTCCTC CAGATGTTTC TTGTTTTAAA ATTCCTTTTG AAATTAAATT
   36361  TTTAATATCT CTAAGAGCTG TATCCGTTGA GCAGTTTGCG ATTTTTGCAT TTATTTTATT
   36421  CCAAAGATGC TTTTGAAATA GAAAAAGCGG ACATCATTAT TATACCAGGA ACAAAAAATA
   36481  CACTAAATGA CTTACACTTT TTACGAAAAC AAAATATAGT CCAAGTTATA CTATCTCATT
   36541  ACGAAAAAGG AAAAAAAGTA ATAGGAATTT GCGGAGGTTA TCAAATGCTT GGTCAGTTAA
   36601  TTAAAGACCC ACATCATGTT GAAAGTGATA TGAATGAATT GTCAGGCTTA GGCTTATTAC
   36661  CCATTACTAC AACTTTAACT AAAGAAAAAA AGACCGTACA GCAAGAATTT CTGTTTAAAA
   36721  ACAAAAAAGC TATTTGTACA GGTTATGAAA TACATATGGG AGTTACCAAG GGCGTAAAGT
   36781  CGTCCCCTTT ATTAAAAACT AAAGATGGAC GAACCGAAGG TTATGTATTG GATAATAATT
   36841  GTTGGGGAAG TTACATGCAT GGGATTTTAG ATAATGCGGT GGTGATAGAT GATTTGTTAG
   36901  GGAGTGTTTC AAAAAATAGC CCCATTTCCT ACCAAGAGTT TAAAGAAAAA AATTATGATT
   36961  TATTAGCAGA CTTGTTAAGG GATTCATTGG ATATGGAATA CATGTATTCG CAAAGTAAAA
   37021  AGCAAGATGA TTAACGGTCA CGGAGACGAT GCTAACAGGT ATACCCGAAA AGTAGTACGC
   37081  AACTTTATCC TTATGTTTCA GAAGGATTAT CAGTAATGGA AAAGCGAACA ATAGTGATCT
   37141  CTTTATTCTT TTTTAGGCGT ATTTTTGGAA TGGATTTATA GTCAACAGAC CGCTTTTTGC
   37201  GAATCATCAG AAAAAACAAA GGAAGCATTG GAAAATTTAT TTTTATATGC TGATGGAGAA
   37261  GTAGAATAAT ACGATTTATA GATAAGAATT TCGTATAAAT ATGTTGAATT ATTTTTTGCT
   37321  AGTCTAAGGC AGGGCAGCAC TATAGTGATG AGCCAGTTGA TGCTTNNNNN NNNNNNNNNN
   37381  NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNATTAGCT
   37441  ACGGTTGCTT TTTTTAACGC AAGAATGGTG AAAAAGAAAC AGCATATATG CGAAATTCTT
   37501  ATCAGTAAAT CGTATAAAAT ATAAACAAGA AGGTTTAAAT CTTTATACAT TTCTAAAAAG
   37561  CACACAATAT TTTATAACTT ATTACTAGGG AATAAATTTA AAAAAAAAAA TATATTTATT
   37621  TTAACATGCA TAGGTTCTTC TAAGGCTATT TTTTTATGGG GAATTATTAC TTTTAATGTG
   37681  AGTAGAAATA ATACGATTTG CAGATAATAA TTCAGCATAT ATGCGAAATT TTTGTTAGTA
   37741  AATCGTATAA GCATTATTGT TTTTGTAATA GGGCTAATCT TTATCAAGAA ATGAAAATTT
   37801  GTATAGCGCA AACGGAGCCA ATCAAGGGAG ATATTTTAAA GAATATTGAA AATCATAAAA
   37861  AATTGATTAT GCTTTCTGTT AAAAAGGGAG CAGATCTAAT AGTTTTTTCA GAACTTTCTT
   37921  TAACAGGATA TGAGCCCGAG TTAGCTCAAA AATTAGCAAC AACTAAGGAT GATCAAAGGT
   37981  TTAATGAATT TCAGGAGATT AGTGATGTAC ATAAAATCAC AATAGTAATT GGATTACCTA
   38041  CTAAAAATGA TCAAGGTACC TGTATTAGTC TAATCTTATT TCAACCCAAT AAGCCTAGAA
   38101  TGACTTATTC TAAAGCTTAC TTACATCCTG GTGAAGAAAA ATATTTTATA ACAGGGGAAA
   38161  ATTTAGCTCC AATTCCAATA GGCAATCATA AAGTGGCATT TGCAATATGT TATGAAACAT
   38221  CTATCACGGA ACATATAGAA AAAGCGTTTA ATAATAAAGC AGACGTGTAC GTGGCTAGTG
   38281  TACTCAATAC AGTAAGTGGT GTTGATAAGG ATATACATCG AATTTCGGAA ATTGCAAAAA
   38341  AATATACAAT GCTTGCGCTA ATGTCTAATC TAGTGGGAGA ATCTGGAGGT TATGATTGTG
   38401  CAGGCAAAAG TTCGGTTTGG AATAAAGAAG GTAAATTAAT AGGACAGCTG GATGATACCA
   38461  ATCAGGGGAT TATTGTTTTT GATACAGCTA CACATCAAGT AATGAAGGTT AAGGATGAAT
   38521  GATTAAAATA TAAAAAGAGA CTGCCTTTTA TTAGACAGTC TCTTTTTCAT GTAACTTAAA
   38581  AACTTTTATA TGAATTAATC TATTATTAAT TTTAAAGAAG TACCAGTGTT AACTTGTATA
   38641  AAGTAAATAC CAGATGCTAA ATTAGAAGTA GGTATTACCT CCGTAGTATC TGTGGCAACC
   38701  ATGTTAACAA GTGCTGAACC TGTTGAATTT CGAACTATAA TAGTATCTCC TTGGTTAATT
   38761  CCTTCCAAGA AAACATCATT ACCTCCAAGT ACAGGGTTTG GATAAGCAAC CGTTTCAGTG
   38821  GCTTCGGTGC TTGATAATAT TTTACCACCG CTTTCTCTTC TCCAATCAAA TGTTTCCCAT
   38881  CCTAAAGGAG CATTTCCTCT AGGGAATAAT GCAGCATTAT TTTGATTCCA TGCTGCCTGC
   38941  ACCCATTTGT TAACTTGTAA ACTTCGTAGC GCTACTTTAT TGTTTCCAAC ATTTCTCCAC
   39001  TCAAAACGTT CCCAGCTTAA GTCACTGTTT CCTCTTGCAC GTACAATAAC ATTTTGGTTA
   39061  CTGTTATTGG TCTGTATGTA TTTACGCGCA GACAAAGAGT ATAATGCTAC AACTCCAGAA
   39121  CGATGTCTGT CTACTCTAAA TCTTTGACGG TTACTTTCAA CGCTAGTTTT ATTAGCATAC
   39181  AAATCATTGT TTAATTCTGT TACAGCAGAA ACAAATCTAC GATCTCCACC TGATTTCCTT
   39241  AATGAAATTA TACTTCCAAT TGGAGCACCA TCATTATTTG CTGTTGGAGG TGGGGGTGGT
   39301  GGAGTAGAGC CTCCTCCGCC TCCGTTGATG TTAGGGCGGT ACACACGTAC CCAGTCCACT
   39361  AACATCACAT TTCTATTGTT ATTATTTAAG TTGGCTACTG ATTCTACAGG TCTACCCGCA
   39421  TGTGCTTCGG TATCAATTAT AATATGTGTA GGATCGTTGA ATTGTCTGTT AGGATAAGGA
   39481  ACGCCTCCTC CGCTTTGTCC TTGTACATTT CTTAAAAGCG CTTCGGTAGT ACAGTTTAAA
   39541  ACGGCTGCAT TTGGACATTG TAATCTTGCG TCTGAAAACT TTCCAGTTAA ATTCCTGGCA
   39601  GCTCTACCTG GAACAAAATG TTGACCATCA AACCTTGGTT GACCATCAAT ATAAAATTCA
   39661  AGTTCAGTTG GACTAGCCCA ATACACTCCA AAAGTATGGA AAGCATTTCT CCAGAAATCA
   39721  TTATTACTTG TGGTAAAGAA TGTTTGGTAA GTAAAGTCGG TTAAATCCTG CCCACCACAG
   39781  TTGGTAGCAG TTTGAGCGCC AGCATGAGAT TGTCCCCCTC TACGATGCCA CAAGTGAAAA
   39841  TTTGTTGACA TTTGTTTTGA ATAGAATTCA TCTGGATCAC CTCCATAACA TTCCAAAACA
   39901  TCAATTTCTT CATTGTCACA CTTGTTTAAC ATCCAAAAGT TGGATGAATT ACGAATATTT
   39961  GACACTTTAA TTCGAGCTTC CATGTACACC GGATAACGAA TTGTTCTTTT AGAAGATACA
   40021  ATACCGCAAT TAACTAGGCC TCCTGATCCA GGACGCGCTC TAACTTCCAT TCGTCCGTTT
   40081  CGTACTTCAA CTAAATTTCC ACCTTGCCAA ACAGTTGAAC CAGGTCCTCT AAAGCCAGGA
   40141  TCGGGCAAAT AACTTTGTGC CCAAACATCT TGGAACTTTG CACTGTTTTT GTTGTTGTGA
   40201  TTAAAGTCAT CCGATAATCC TGTAATTAAA TCCCAAGAAG CAAAACTTTG TAGATTGTTT
   40261  GGTAAGGGAG TGTTTCCAAA ATTTAAGCCT CTGTCATTTC TTTGCGCATA AATGGCAGAG
   40321  GATAAATACA TCGCAAAAGC GAATAGTAAT AGTGATTTTA ATTTCATAAT GTGAGCGTTT
   40381  TTATAGGTTG TTTATAAAAA TAATACTACA AATATATACA AAAAACGTTT TCGTAGGAAT
   40441  TAATTTAAAT ATTTAACATT TGTCAATTTA TTAAGTTTAT TGTTGAGGTA TCTTCTTTTT
   40501  TTAACACTTT TTTGTGATAA AATATTAATA TAATTTAATT TTTTCATATC TAATATTTTG
   40561  TTAAAACATT GTTTTTCAGC TGTTTGTGTT TTTAGATGTA AAGATTGTGT TATTTTGATT
   40621  AGTTAAGTGT TAAAGTCGAT TAAGTGCAAT AAAAAAAGGT TATAATTATC AAGTGATAAT
   40681  TATAACCTTT TTTATAAATT TTAGATTTTT TACAATAAAA AAACTAAAAA GTCATTGAAT
   40741  ATTGACTTAT TTTATGCTTT TTGGACAACT ACCCAACCTT TTTCAAGTAA AGGGATGGCT
   40801  TGTTTAAACT TTAGAGTTTT GGTTTCGCCA TTCATTAAAT TCTTAATAAC AATTTTGTCA
   40861  TTACGACCAA TTTTAGGTTC TTCCCTAACA ATAGTTTCTA CTGGAGCTTG TTGTTGCTGA
   40921  TGTTGTGCAT CGGCAATAGC TCTATTTTGA TTGGTACGCT CTTCTAAATT TTGAATCTCT
   40981  TCCTTTTGAG TCTGCATTTC TTGCTGCTGG TGTTGCTCTG CAGCTTGAAC ATCATCGGGG
   41041  TTGGCAGATG GTAATTCAGC TTTAAATAAA AAGGATATTA CTTCTTTATT TAAGCCTTGA
   41101  AGCATGCTTT TAAATAATTC AAAGGCTTCA AATTTATAGA TTAACAACGG ATCTTTTTGT
   41161  TCATGAACTG CTAAACGAAC ACTTTGCTTT AACTCATCCA TTTTACGTAA ATGAGTTTTC
   41221  CATGCATCAT CAATAAGCGC TAATGTGATA TTCTTTTCAA AATCGGAAAT AATTTGTTTT
   41281  CCTTCACTGT TATAGGCTTT TTCTAAATTG GTACCAACGT TTAATGATTT AATTCCATCA
   41341  GAAAAAGGAA CTCCAATACG CTCAAATTGG TTGTTGGGAT CTTCGTATAT CTGTTTGATT
   41401  ACTCGGTATA CTTCTGCAGA AGTATGTTCC ATTTTGCTCT GATAATGTTT CAAGGCAGCG
   41461  TGATATACTT TTCCAGTTAA TTTTTCAGCG TTAAGCGAAT TAAATTCCTG TTCAGTTACT
   41521  GGGCTTGGCA TAGCAAAATA ACGGATCAAT TCAAACTCAA AGTTTTTATA GTCTTGCGAT
   41581  ATGTTATTAC CTTGAGCAAT ACTTTCCGAT AACTCATAAA GCATGTTCGC AATATCCACC
   41641  TTTAAACGTT CTCCATATAG GGCATGTCGT CTACGTTTAT AAACTACTTC ACGTTGGGCG
   41701  TTCATCACAT CATCATATTC TAATAAATGC TTACGTGTAC CAAAGTTGTT TTCTTCAACT
   41761  TTTTTCTGTG CACGTTCAAT AGAGTTAGAA AGCATTTTTG CTTGTAATAC CTCTCCCTCT
   41821  TCAATATTCA TTTTATCCAT TAGTTTGGCA ATTCTTTCGG AACCAAACAA ACGCATTAAA
   41881  TTATCTTCTA ATGATACATA AAATTGTGAG CTACCCACAT CTCCTTGTCG ACCAGCACGA
   41941  CCACGTAATT GACGGTCAAC TCGACGAGAG TCATGACGCT CTGTACCAAT AATAGCTAAA
   42001  CCGCCAGCGT CTAAAACTTC TTTCGAAAGT TTAATATCCG TTCCACGACC TGCCATATTA
   42061  GTTGCTATAG TAACCACGCC AGGATTACCT GCTTCGGCAA CGATATCTGC TTCCTTTTGG
   42121  TGTAGTTTAG CATTAAGTAC ATTATGTTTT ACTTTACGCA TGTTTAACAT ACGACTTAGT
   42181  AATTCCGAAA TTTCTACGGA AGTGGTACCA ATAAGTACCG GACGACCAGC TTGTGCAATT
   42241  TTTACAACAT CTTCAATAAC GGCATTGTAC TTTTCACGTT TGGTCTTGTA TATTAAATCC
   42301  TGGCGATCAT CCCTAGCAAT AGGTTTGTTA GTAGGGATCT CAATAACATC TAGTTTGTAA
   42361  ATTTCCCAAA ATTCACCAGC TTCAGTTACC GCTGTACCTG TCATACCAGA TAATTTGTGG
   42421  TACATACGGA AGTAGTTCTG TAGGGTAACG GTAGCTAAAG TTTGTGTAGC ATCTTCAATT
   42481  TTTACATTTT CTTTAGCTTC TAAGGCTTGG TGTAGTCCGT CGGAAAAACG ACGTCCGTCC
   42541  ATAATACGAC CCGTTTGCTC ATCAACAATT TTTACTTTGT TGTCCATTAC TACATATTCT
   42601  ACATCTTTTT CAAATAACGA ATAGGCTTTT AATAATTGAG TAATGGTATG AATACGTTCA
   42661  CTTTTTACGC TGTATTCACG GAAAAGTTCT TCTTTTTTAG CGGCTTCTTC TTCGGCGTTT
   42721  AATCCTAATT TTTCAATTTT AGAAATTTCA ACAGCAATTT CGGGTAAAAT AAAGAAATCG
   42781  GAATCTTCTT CTTTTGAAAT ATGTGCTATT CCTTTATCGG TAAGATCAAT TTGATTATTC
   42841  TTTTCTTCAA TAACATAATA CAAATCAACA TCAATAAGGT GCATGTCCCT ATTGTTATCC
   42901  TGCATATATT GATTTTCTGT TTTTTGAAGT AGTTGTTTTA CTCCTTCTTC ACTTAAATAC
   42961  TTAATTAAAG CCTTATTTTT TGGAATACCA CGGTAAGCTT GTAGTAATTT AAAACCACCA
   43021  TCTTTAGTGT TTCCTTCTTT AATTAATTTT TTGGCTTCGG CTAAAACACC AGTTAAAAAC
   43081  TTTTGTTGTA AGCTAACAAT GCTAGCAATA CCTGGTTTTA GCATATCATA TTCGTGAATA
   43141  TCTCCTTTAG GTACAGGACC AGATATAATT AGGGGAGTAC GTGCATCATC AATTAACACG
   43201  GAATCCACCT CATCCACAAT CGCATAATTG TGTTTGCGTT GTACTAAATC CTCTGGCGCA
   43261  TGAGACATGT TGTCTCTTAG GTAATCAAAA CCAAATTCGT TATTGGTTCC ATATACAATA
   43321  TCACTATTAT AAGCATTACG ACGTGCTTCA GAATTTGGTC TGTGATTGTC AATACAATCA
   43381  ATTGTTAATC CATGAAATTG GAATAACGGA GCCATCCATT CACTATCACG TCGTGCTAGG
   43441  TAATCATTTA CGGTTACTAA ATGTACTCCA TTTCCAGTAA GTGCATTTAA GTATACCGGT
   43501  AGTGTTGCTA CCAAGGTTTT ACCTTCACCA GTATGCATTT CGGCAATATT ACCATTATGT
   43561  AATGCTACTC CACCTATTAA TTGAACATCA TAGTGGATCA TATTCCAAGT CACTAATGTA
   43621  CCAGCTGCAT TCCAGCTAGT AGCCCAGTTT GCATTAGTAT CATTTATAGT AACATATTCT
   43681  TTTGTAGCAG AAAGTTCACG ATCATATTCG GAAGCAGTTA CTTCAACAGT TTCATTATTG
   43741  GTAAAACGAC GAGCGGTTTC TTTAACAACA GCAAAAGCAT CAGGCAGAAT TTCACTTAAT
   43801  TTTTTATCAG TAATTTCTAA CGCTTTGGTT TCAAGAGAAT CAATTTCTGT ATATATGTCC
   43861  TCGCGGGCAT CAATATCAGC TGTATTGTTT GCTTTAACTT TTAAATCGTC GATTTGAGCA
   43921  ACGATATCAG CTTTAGCATC AATAATAATT TGTTTAAAAG CTGTTGTTTT TGCTCTTAAT
   43981  TCATCGTTAG TGATATTAAC TAATGTAGCT TCTGCTTTTT TTATTTTATC TAAAATAGGC
   44041  TGTATGGCCT TAACGTCTTT TTTGGATTTG TCCCCGACAA ATACTTTAAG TACAGAATCT
   44101  AAAATTCCCA TGGTTATATT GTTAATGAAA CTTACCTTAT ACTATTTGTT AAAATAGGTT
   44161  AAGGTATTCG TTAGGTTAGT TCCAACGTAT GTTGGAAACT GATATTGCTT TTGTGGCGTA
   44221  ATTTACGCAA AAAAAAAGCC TCTATCGAGA CTTTTTGTGT TGTTTATTTA GGCTGAAGGC
   44281  TAGTATTCAT CTTCGTTCCA GAGATAATCT TCATCAGTAG GATAATCCGA CCAAATTTCT
   44341  TCTATGGAAT CATATGAATC ACCTTCGTCC TCAATTGCTT GTAGATTTTC TACAACTTCC
   44401  AATGGAGCTC CCGTTCTGAT GGCATAATCG ATTAATTCAT CTTTGGTAGC AGGCCAAGGT
   44461  GCATCACTTA AATAAGATGC TAGTTCTAGT GTCCAATACA TTTGTCTATG ATTTTTTTTG
   44521  CAAAAATAAA TTTTTACGTA ACATAAGCAA GTAAAAACTT ATTTTTTTAT TATATGTTTT
   44581  ATAAGAACTT AGTGTTGAGT GTTATACCTC CTTGTTTGTT TTTTTAGGAA TCCATTTGAT
   44641  TTCCTCAACT GTTAATTCTT TTGACAACTT TCGTGCCAGT ACAAATAAAT AGTCAGAAAG
   44701  CCGGTTTAAA TATATTAAAA CTTCTTTTTC CAAAGGTTCG TGATGATGTA ATGCATAGGC
   44761  TAAGCGCTCT GCTCGTCTAC AAATAGATCG AGCAACGTGA CAATATGACA CGGTGACGTG
   44821  TCCACCCGGT AAAATAAAAT GTGTCATTGG ATTTAAGCTC GTATCCAAGT GATCGATTTC
   44881  ATTTTCTAAA GCTTCAATTT CTTCAATGCT GATTTTTTGA ATATTTAATT TTTTCTTTTG
   44941  ATTATTATGT GGTGTAGCCA AAATAGAGCC AATGCTAAAT AGTTCTATTT GAATTTGGGT
   45001  TAAAAAGTTT TTATGCGTAA TTGAAATTTC TTGATCTCTT AATAGTCCAA TAAATGAATT
   45061  TAATTCATCA ATGGTTCCAT ATGCGTCAAT TCGATCATTA CTTTTAGGAA CACGTTTGCC
   45121  TCCATATAAA CTTGTAAAGC CTTCGTCTCC TGTTTTGGTG TATATTTTCA TTGTTTTTTT
   45181  CTGTGATTTT AGGCTTTTTT TTGGCTAGTG TAAATTCATA AATGCCAGTA GGTAATTATA
   45241  AGCACTACTA AATATACAAT TAATTCTATG TTTAAAAGCA AACTGTGATG CTATTTATAA
   45301  GCGGATAAAA AATTCTTCTT TAGCTTGTTG GTTTCTGTTA AAAATGAAAC CAAAAAAATA
   45361  AGTGTCAATT ACAACATGAG CATTTTTATG AGTTTTAATA GCATTCCATT TTTTTTTATT
   45421  CTCGTGTGGT AATTCAATTA TGGCAAGTGC ATTAGGTTGA AGTTCGTCTA TTTGTCTTGC
   45481  GATGTGTGTG TTTTTGGAAA TAAAAATTAA ATCGGCATTG CTACTAGAGG TAGTGTCTAT
   45541  TTTTTTTTGA TGCTTAATAA GGTGTGTTAT GGGGTGATTG TTTTTGAAAT CCCCGGCTAT
   45601  TTTGTTGATT TTAAAATAAC AAATGATACG ATCTAGTAAT AGTATGTGTT TTGATTTTAG
   45661  TTGTTTAGGG GTGTTTTTAA TGGTGTTTTT TGGGAGTGGG CTTGTTTTTA TGGGCTTGTA
   45721  AAAGCAGCGT GTTACTAAAT TATAAACAAA AGGAGAGTGT ACTCCATGTT CGTTTGTTGA
   45781  TTTTAATAAA AATAACCAGT AAGATTTTTT TAATAAAACA GACATTATTT TAATGTTTAT
   45841  TCTTTTTATT TGTACTAATA AATAATGGAG ATTAGTTTGT TAACCAACAA CCAACAACCA
   45901  ACAACCAACA ACCAACAACC AACAACCAAC AACCAACAAC CAACAACTAA TAGTTATCCC
   45961  ATTTTTTCGG CCAATTCCAT CCAGCGCATT TCTTTTTCTT CAATGGCATT AGTGATTTTT
   46021  CCTAATTCTT TTGATTTTTC AATAAGTGCG TCTCCTTCAA AATTTTCGGT TGCAAATTGT
   46081  TGTTCAATTT CCTTTTTTTG AAGTTCAAGT TTTTTTAATT CGCGCTCTAT TTTGTTATAC
   46141  TCTTTTTGTT CATTAAAGGA TAAAGAGGTG TTTTTTTGTT CCTTTTTCCA TGAATTTTTG
   46201  TGCTGTTTTA CCTCGGGAGT AATTGTGGCT TCGGGTTCTT TTTTTGTTTT CGGACTATTC
   46261  TCATAGGCGC GATAATCGGA ATAGTTTCCA GGGAAATCTT CAATCACACC TTTGCCTTCA
   46321  AAAACAAAAA GGTGATCTAC AATTTTATCC ATAAAATAAC GATCGTGAGA TACTACGGCT
   46381  AAACAGCCTG GAAAGTCCAA AAGAAAGCTT TCTAGTACAT TTAGTGTAAC AATGTCTAAA
   46441  TCGTTAGTAG GTTCATCTAG GATTAAAAAA TTAGGGTTTT GAATCAAAAC AGTGCATAAG
   46501  TAAAGGCGTT TACGTTCACC TCCGCTTAGT TTTTCGACAA AATCATGTTG TTTTTTACGA
   46561  TCAAATAAAA ATTGTTCCAA TAATTGACCA GCCGAAATTT GTCTTCCTTT TTTTAAAGGA
   46621  ATGTAATCTC CAAATTCGCG AATAACATCA ATGACCTTTT GACCTTCCTT TACTTTAATT
   46681  CCTTTTTGAG TATAGTAACC AATTTTAATA GTTTCTCCTG TAATAACTTT TCCACTATCG
   46741  GGTAATTCAA TCCCTGTGAG TAGATTTAAA AATGAAGATT TACCTGTTCC ATTTTTTCCA
   46801  ATAATTCCAA TGCGTTCACC GCGTTGAAAA ACATAGTCGA ATTTATTGGT AATAACCAAA
   46861  TCACCATAAC TTTTAGAAAC TTTGTGGAAT TCAATAATTT TACTCCCCAT GCGCTCCATG
   46921  TTGATTTCAA GGGTAACTTG GTGATCAGCT CGGCGTTGGT GGGCTTTTTT CTTTATTTCA
   46981  AAAAAATCAT CAATACGGGA TTTGGATTTA GTGGTACGCG CTTTTGGTTG GCGACGCATC
   47041  CAATCCAGTT CTTTTTTAAA TAAGTGTTTG GCTTTGCTTA GTTCGGTAGC TTCGGCGGTA
   47101  AGTCGTTGTT CTTTCTTTTC TAGGTAATAA GCGTAATTTC CTCTGTAATT GTATAGTTTG
   47161  CCATGGTCTA GCTCAACAAT TTCGTTACAT ACGTTTTCCA AAAAGTAACG GTCGTGAGTA
   47221  ATCATAAAAA GTGTAATCTT TTCTTTGGCA AAATATTCCT CAAGCCATTC GATCATTTCT
   47281  AAATCTAAAT GGTTGGTTGG TTCGTCCAAA AAGACCAATT CGGGCTTACT TAATAAGACA
   47341  TTTGTTAAAG CTAAGCGTTT TTTCTGTCCA CCAGAAAGTG ATGCTACTTT AAGCGATAAA
   47401  TTATCTAATT TAAGTTTTGA AAGTATTTGT TTGTATTCTG TTTCGAAATC CCATGCTTGT
   47461  GCTTGATCCA TACGGTCAAA GGCAGCTTGA AAAGCGTCAG CATCTTCGGG GTTTAATACT
   47521  GCTTTTTCAT AAGCTTCAAT GGCTTGTAAA CTTTCGTTGT CGCCAGTAAA AATGGTTTCC
   47581  TCAATACTAA GTTGAGGATC TAAATTAGGT TCCTGTGGCA AAAAAGCAAC CTTTAATCCT
   47641  TTGCGATACA CTACTTGCCC TGTATCGGAT GGGGCGCTTT TGGTGATAAT ATTTAATAGT
   47701  GAGCTTTTTC CAGTTCCATT TTTGGCAACA AAACCAATTT TCTGACCTTC ATTAATACCA
   47761  AATGAGATGT TTTCAAATAA AACACGCTCT CCAAATGCTT TGGAAACATT TTCAACAGAA
   47821  ACAAAATTTA TCAAAATCTA TAATTTTTGG TAAAACTAAG TGTTAATTAT CAAACTATGA
   47881  ATTATTAATT ATAGGTTTTT TTGTTTCTTA ACTAGAGGTT GCTGATAAAT ATGTTTGAGG
   47941  TGATAAGCTT GTAAATGATA GAAGTGTTTG TATTTGATAT TTTCTATACT ATGTGATGGG
   48001  TGTCAAATTT GTGGATGATA GTATTGAAAA AAATAGGCTA AAGAACATAA TAAGAAAACG
   48061  AAAAGCCTGT TACTTCTTTA CTCTTTACTC TTTACTCTTT ACTCTTTATT ATCTAAAAAG
   48121  GCTCCAGTCA ATTCGGAGTG AAAACACATT TGAGTACAAG GAAACACTTT GGTCTCCTAT
   48181  ATCTGTAAGA GCGTAATCCA CGGATACTCC TTTGTAGTGG AAACCTACAC CAAAATTAGG
   48241  TTGAAAGCCA AGTTCATTAG TGTTGTCAAA TTGTTTTACT TTTTGGAAGT TACCAACACC
   48301  TCCTCTTAGG AAAATAAGTT TTCTGAAATT AGCTTCGAAT CCGAAAGCGG GTGATATGCT
   48361  AAAAGAAGCA TTGCTAATTA CATCGTTAGT TTGAGCAAAG CGAAAATTTC CGTCAGCTTC
   48421  AAAATCAATA AAGATATCCC TATTAATAGT AAATGTTTTG TTAAGTCCCA TTCGAACACT
   48481  AGGCAGGGTG ATCTCAGTGG TTTCTGGAGC TTCTTGATTG TTTAAGGCAT TTATGGATCC
   48541  GTTTCCTCTG GGGTCATCAC CTAAGTCGTT GTCAAAAATA CCATCTTCAA TTTGCCATGA
   48601  ATTGTAAGTG GTGGTTAGGT CACGAACCAT TATTCCGAAT TTCCAAGCTT TATTTTTGCT
   48661  TGTAAGCAGA AGTCCAGCAT CCAATCCGAA TCCCCAAGCT GTAGCAAAAT CACCGATTAC
   48721  TCTTCGGATA ACTTTAGCAT TTACTCCATA GCTAAAATTT TTATTGAAGG GTTTTCGAGA
   48781  ATAGGATAAA GTAAAAGCGT AATCGGCGGT TGAAAATCGA GGTAATTCTT CAATGGGAGT
   48841  AATATCTCCG CCAGAGGTTA TTAAAGCTCT AGTGTCAAGA ATGTCATCTA CACCAAACCG
   48901  TATCACGGAG ACACCTATGG CACTCTTATC GTCAATAGGA GTGGCAAAAG CGGCATAATC
   48961  GTAATTTGCA ATATTTGCAA AATAAGAAGC GTGCATTAAA GCTAATTGTT TGTCTTTAAT
   49021  GTTAATTAAT CCAGCGGGAT TCCAATATCC TGAATTAACA TCATTGGTAG AAGCAACCAC
   49081  AGCATTTGAT TTTCCAAATG CAGCAGCATC AACCCCAATG TTTAAAAACT CGTTTGAATA
   49141  TTTACGAGTC TGAGATTTAA CAGAGATGAT TGTTCCTGTC AATAGCATGA AAAAAAATAT
   49201  GTTTCTCAAA GGCTGTTTTT TTTGCAAAGA TGTTACATTT TTGTAATATA TTAAACTTTA
   49261  TTTACATCTC CTTATTGTAT AAAGTATTTT AAGTAAATAA GTAAACACCT ACAGTGATAT
   49321  GTCGTTAAAA AAACAAATTC CTAATATAAT TACCTTGTTA AATTTATTTT CGGGCTGTAT
   49381  TGCGGTTTAC TTTGCTTGTA TGAATCAGTT GTTTTTAGCA GCTGTATTTA CAGCATTGGG
   49441  AATATTTTTT GATTTTTTCG ATGGTTTTTT TGCGCGTTTG TTTAATGCGA ATAGTGAGCT
   49501  TGGCTTGCAG TTGGATTCAT TGGCGGATAT GGTAACCAGT GGGGTAGTCC CAGGGGTGTT
   49561  TATGTTTCAG TTATTGTTAG AATCAAGTGC GATTAATGAT TCTTTTCCAA TAGAGAATAT
   49621  AGGGGGGAAT GTTATAGAGT GGGTTCCTTT TTTAGGTTTT TTTGTAACCT TGGCTTCGTG
   49681  TTATCGCTTA GCTAATTTTA ATATTGATAC GCGACAAACA AGTTCTTTTA TTGGTTTGCC
   49741  AACACCGGCA AATACTTTGC TTATAATAAG TATAGGTCTG GTTAGTATGT ATCAGTCTTC
   49801  GGGTATTATC GAGGTTTTGA TGGATAATGT ATGGGTATTA CTGTCAATAG TAGCTTTGAG
   49861  TTGTTATTTG CTTAATGCAG AAGTGCGACT GTTTGCTTTA AAATTTAAAA ATTGGAATAT
   49921  TAAAGATAAT TGGGTACGTT ATTTACTTAT AATTTCTTCG TTGGTTTTGA TTTTGCTTTT
   49981  TAAATATTTA GGTATAACTT TAACTATATT ATTGTATGTT CTTTTGTCTT TGATTTTCAG
   50041  TGGAGAAGAA ACCAATGGAG TTTAGGCTTG AAAAAAAGTT TAATTTTTTG CTTAAAAAAA
   50101  TTTGCCACAA GGGAATTAAG TTTTATATTT GCACCCGTGT TTGAAACACT GGTCTATGGT
   50161  GTAACTGGCA ACACGTCTGT TTTTGGTACA GAAGAGTCTA GGTTCGAGCC CTAGTAGACC
   50221  AACTTAAAAC CCCTTTAAAA CATTGTTTTT TAGGGGTTTT TGTTTTTTTA GGGGGCGAAA
   50281  TAGGGGGGCT AATAATAATT CTTAACAAAA TATCTAGATG TCAAATACTA TAGTTTACGA
   50341  AGACAGATCT AAACGGTTTG ACGAAAATAT GATAAAAGGG CGTATAGCTG AAACTATTGT
   50401  TGAGCAGATG TTTATACGCA TGGGTTATGA TATTTATCGT TACGGTATGG AAAACACAGT
   50461  TCCTGGTATA ATACAAGACT TATACAACTG TAAACCTAAA GAAGTATCAG ATGAAATTAG
   50521  GAAGATGCCT GATTTTATTA TAAAGAATCC AAATGATAAT TCTGTATACT ATGTTGAAGT
   50581  TAAATTTAGA GCAGATGGTA AATTTCTATT AAAAGAATTA GGTAAAAATT ACCCTTATAA
   50641  AAATGCATAT ATTTTAGTAG TTAGCAAAAA GCATATACGT TGTGTTCTTT ATTCGGAACT
   50701  TGAGGAGTCT GGTGAGCTAT TAATGAAAAA AGAATACCTA TTAGGTTACA GAGAGGACTT
   50761  CAAGACTAAT AGAGAAATTA TACTATATTT TTGTGAATTG GCTAAGAAAT ATTTTAGTTG
   50821  TCTAGAAAGT TAGTTCAACT GAAATATTTT ACTACTATTT ATGATTAAAG ATTTAATTTG
   50881  ATTTTACAGG AATGATCTGG AGAATATTTT TGTACTACCT TTTATTTCGT ATAAAATAAT
   50941  AGATTAATAG TACTATCGTA ACACATAAAG AAAGTAGAAT GGCTGATGTT TTAAGTGTAT
   51001  CCAAGAAATC TTCAAGCAGA TTATTTAAGT TTTCAAGTGG ATTTTTATTT GTTAGTAGAA
   51061  AAAAGAGTTT CATAATTATT TTTTAAGATT TGTCAAGTAT TTTTTGCCAT TTAGCATTGC
   51121  TTTTATGTTT TAGGTCTTCC ATTATCAAAT CGGCTCCAAC TAAACTTTTT AAATGAAATA
   51181  TAACTTTTAA AGTCTCTACG ATAAATGGAT TATAATAAGC ATTTTCAAGG TTTGATATTG
   51241  GGTTTAGAGT ATCACAAAAT AAATCATGTT CTGGAAATTC CTTAAAGGTT TCTGGGATTA
   51301  ATACTATTTC TTGATCACTA CAGTAATCAT CGAATTCATC ATCTTCTATT TTTACTAAAA
   51361  AAGGAATTAA GGAAAAAACA GTGTCATTAT TTTTGAAAAG ATTTCGATAT TCAATAAACA
   51421  AATCAAGTCG TCCTTCAGCT ATATGTTTTA AATAATCTTT ATTATTTTTA AAGGGCTTTT
   51481  TTAACATACC TCTACCTTTG AAAGGTGAAA TTACGAAATC ACTTTGATTA GTTATTTCCT
   51541  CTATATAATC AGGGATATAA AAAAACCTAG GTAAATCAAT TATGATATAG TCATAGTCTT
   51601  TCTTTTTTTG ATCTATATAT TTGGCTAATT CTTTTGTTTC TATGGACGCA ATACTATATA
   51661  GTGGTTTTAT ATTTGGAAAA ACTTCTAAAT CTAATGCTCT TTTATCATAG CAAGAATTTT
   51721  GATAATGTGA GTCGATAAAT AATAATTTAT AATCTTTGGA AATCTCATTT GCTAAGATTA
   51781  TTGACAAAGT AGAAACGCCC ATTCCTCCTT TAAAACTTGT AAATGATATT ACTTTGTTTT
   51841  TTAACTTTTT GTTAGAAGTT ATTTCTGAAT TATGAGAGAT TTTAATTTTG TTATAGCAAA
   51901  TTTCTAATAC TTCATCAATT TTAATGTTTA GATATTTACA TAACTTCACT ACCTCGAATA
   51961  CCTTTATTTC TCTTCGTCCA GATTCAATAT GACTAAAGGT AATTGGAGAT ATACCAATTT
   52021  TGTTAGCCAG GTGCGATTGT GTGAGACCTA ATTCTAACCT CTTTATTCGA ATTTTTGAGA
   52081  TCAGTAAACT ATTATACTCT TTGTTTGTAT CCATATCGTA TTATGTGTGA TTGTAAATAT
   52141  AGTAAAATAA TACAATATGT TATTTCGCTT AAGACTTTGT TATTTCTTAA ATCAAATAAA
   52201  TTATTATCTT AAAAATAGTT TGTTAACTTG GAAATAACCT TTAGGGTTAT TCTAAATTAA
   52261  CGAACGTGCG TGCAATAAGA CTATAGTTAT TGTATAAATT CATACCATGC GAGAAACCAA
   52321  TTATTATCTC CTGTGGTACA AATTTATACA ATAGGTTACA TTTAAAAGTC AGTTTTGACG
   52381  GTAACAGTCT TACTCACTTC AAAGCCAGTA TTATTAAATA CGGTAAAAAT TACTTCTCCA
   52441  GGAACTACAT TTCCTGAATA ATTTAGAGAA TACGAAAAAG TTTCATTTTG AATTCCTGAA
   52501  AAGTTATCTA GTAATATATT TTCACCAAAA ACTATCTTTC CATTGTTGAA TAAGATGTTT
   52561  TCGGTCGTAG TTGAAATTCG TAAATAATAA TCCAAGTCAT AAAAGTATCC TGTTGCAAAC
   52621  GAAGGTCTAT TTAACGTCAC ATTTATAAAG TCGTTAATAG AGCCTGAGTT TATAGTTATA
   52681  ACGGTCTTAG ATAAGCTAAA ATCGAATTCT ACGGGTTCTG CAGTTAAGCC ATCAAAAGTT
   52741  TTGGTTTTAG TAACTCCATT ACTAGCAACA ATAGTAACTG TAAAATTATT TTTTTCAATA
   52801  ACCTCTGTAG GTATATAGTC AAAAACATAA TTACCTTTTG AAAGATTCGA AATTGTCTCA
   52861  GGTAAATTTG AGTAGCCAAT CCAATTAATT TCTCCATTTG AGTTGCTGCT TATATTCATA
   52921  GTATAAGTTA AGAGCTCATC AGAAGTTTGT TCTATATTAA GGTTTAAACT TGTTCTTTCT
   52981  CCAAAAAGGA CCTCTTCTTT CAATGGAGTA AAGCTAAATT TAAAATCAGT TAATTCTTTG
   53041  GTAACAGAAT AAATAACTTT GGCAGTTGCT GAATGTTTCT TATTGTCATC AACGAAAATT
   53101  TCAATTTCAA TTTCTCCTTC TTCAGTTGGA ACAAATTCAA GAGTATAGTC TAGACTTTTT
   53161  ATAGATAAAT CATAGATTGT ATTTTCTTGA ATTTTAGTGC CATCAATTTT ATAGTGCCCT
   53221  TTATCATCAG CATTATATGA AAATGAAAAA ACAGTACTAT CGACTAAGTT TTCAGGTAAA
   53281  ATGATTAATT CATTTTGAAT TGTTTCAGAT AGCAGAGCTT CATTAGTTCC AGTAACTGAA
   53341  ATTTGAAAAG GAAAGCTATC TATAATTGTA CTTTCATCTT CACAAGCCAG TAAAAAAATA
   53401  GAAAGCGTTG CGATTAATAA AGTATTAAAA TGATACTTTA TTAAAATATT AAATTGTTTA
   53461  AATAATAAAT TCATAATTGT AAAAGTTTAA GATTAAAAGT GATAGCGTAT TCCGGCTCCG
   53521  ATAATGAACT TATGTAATGA AACATCGCTA GTAGTAAAGA AGTTTGAATT GCGGAATACA
   53581  GCAGATAGGT TATTGTTGAT TTTGAAAAGA GAAAATATTC CTGTATAACC ACCATAGATT
   53641  AGACCATCTT CGGTTTCTAG AATAGCACCG TTTGAGAGTT TGTCTTTTCC GTCGTTTAGT
   53701  AATTCAGCAC CTACAGCTCC ACCAATTGTA AATCTTGTAG TAATGGTGCT TGTTTTATTG
   53761  CTTAAAAAAC TAAGCTGTTT AGTGTATCCT AAATTCAAAA TAAAGACTTC TGAAGGTATT
   53821  TCTAATTCTT TGGCTAGTAA ATCATTGTTG TCATAATACA ATCCCATTTC AAGCCCCTTG
   53881  TTTTTATCAG TATCTATTTC AATACTGAAA TTCGCTTGAT AACCTAGACC TTCATTGTCT
   53941  GTTATACCAA TAATAGTTTC AAAGCTTGCA TATGTGGTTT TCCTTGATTT TTCTTTTTTC
   54001  ATTAGCCTAA ATGATCTAGT GCTATAGCTC TTTTGTAATA GTTTTAATTC ATTTTCGATT
   54061  TGCTTATTTT GCATCTGCAG ACGATTTAAT TGGAAGTGAA GGGTTTCTTC AGATTGCTTT
   54121  TGTAATTCTG TTTCGTTTTG AGCAAATGCT CCCTGTGCCA TAGCTATTAC TGCTATGGAA
   54181  AAAAATAGTT TTTTCATAAT AAAAATTTAA ATGTTAAAGA TTGAATTTCT TAGTTAGAGT
   54241  AGGTGTTGTA GTAGATTTTT TGAGTAAAAA ATTTATGTCA CTATAGACTT TTTCGTAAGC
   54301  TCTTTGCTCA TCAATATTTT TTTGAGGTTG GATAGGAATG GGCTTAATTT TTTTTAAGTA
   54361  GTGATTTCCA TTCAATCGTT TGCCTTCAAT AAGTCTTTCA TTACCTTCAG CAATGATGGC
   54421  AGTACACATA CCTGCTTTAT AATTAATAAC TTTTTCACGT CTTAAAATGT CTCTCTCGAT
   54481  ACTTGAATAA CTATGAGTTG GACCATCTAA ACTTAAACCT CCTTGTTTTT CTGAAATAGA
   54541  TGTTTTTTCG ACTTCTCGTT TGCCTAATGT TTTTTGAAAA TGATCTAAGG TTTCAGGGCT
   54601  TGTGGTTCTG AAAAGAAATT GAGAGCCCAT GTTGGCTATA ATTGAGCTAG CTTCCTCTTT
   54661  TCCGTACTTT AAAACTAGTT GACTAAAATC CTGTATGGCA ATACAAGTAG CTATTTTGTT
   54721  ACTTCTTGCT GTCTCAGGGA TATTGCTAAA ATTTGGAATA GATAATACTG TAAATTCGTC
   54781  AATAATTACA GCACTTTCGT GTTGGTCAGG GATATTCATC TTTTTTAGAA TTAGACCAAT
   54841  AATTGAACTA TAAATAGGGC TATAGATATC TCGCTTTTGT AAATTGAAGA TTAAGTTTAT
   54901  TATACTTGGA TTGTTTGGGT CGTTAGGTAA TGGTAAATCA GTATCGGAAA GTAGGTTTCT
   54961  AAATATTCGC GGTACATCTA ACGAAGCAAA AAAAGCAGTA AAAGTACTCA TCATAGAGCC
   55021  TAAGAGTTTT TTGTCTCCTG AAACACTAGA AAGTACCTGT GCACTTCTTT TAGCTTCTTC
   55081  GTCACTAAAA ATCAGCTTGA TAATTTGCTC AGGATTAGCA GTTAGAAATA ATGCAATAAT
   55141  ATGTGGGATA CTACAGAATT TTGGGTGCTT TTTTCTTAAG AAAAGAATTG TTCCAGTTAG
   55201  TATACTTTTT GCAGAATTAA AGAAGTACTT AGCTGCGTCG TTCTTTGGAA TACCCACGAT
   55261  ACCACTTAAA AAATAACTGC TGAATTCAAT AATGTCTGAT TTATCTTCAC ACAATGAAAG
   55321  CACGTTAATA GTATTAAAAT TGTTATCTAA ACTAAAATTG ATAATAGGTT TTTCGTTTTG
   55381  CTTAGCAATT CCATTTATTA GTGGTGTCAA TTCTCCTTTT GGGTCAAAGG TTATACAGCC
   55441  TTTGTGTTTT ACACAGTAAG AAAGTAATGG GTTTATGTAC GAATACGTTT TTCCACTTCC
   55501  TGCACCGCCT ACGGCAATAG CTCCACGATT CAGATTATTT ATTCTGTAGT GTTTTGAAAA
   55561  CCTACCGCTC TTTAAATAGA ATGGAGGTGT TTTTGGTTTT AAAAAATCTA ATTTCATCTT
   55621  TCGTAAATTT GAGTGTGTTG CGGTTTGTCC TTTTTCCAAA GTTGTTCGTG TTTGGTTTTA
   55681  CTGCCTGCTT CACCTCTTTG CATTCCATAT TTTTCCATTA ATTCAGCATA GCGTGTTTGT
   55741  TGTTCGGCTA AGGATTTTCT TCCATTAATA AATTCTTTAG CACTTAATCT TCCATCATTT
   55801  GTGATTGGTA CAATTACAGC ATGTAAATGG GGTGTTGTTT CATCAAGATG TAAATGCATA
   55861  CTCAAAACAT TTTCTTCGCC ATATGTTTCA GATAGGAATG TTTTATTATC TTTCATCCAG
   55921  CTTTGAACTA AGTTTTCGTC ACTAAAGATT TCAGCCATTT TTGCGTTATC AGAAGTCATG
   55981  ATATAGTCAA TAGCTTTTAC AGCATCTTTT CGAATGTTTT TTTGAATTTT ATATCGTGAT
   56041  TTTATTTCAT TTTGAATGCG GTCTTGAAAT GGTGTTTTTT TACAATAATT AGCCCATTCT
   56101  TTTTGTGTGT ATGACTGCCC GTTTTTGTCC CAATGTATAT TGTTTAAAAT GGCTCTATCT
   56161  TGAATATTTG ACGGATAGCA TAATTCTCCA TCACTTGTGC ATCGATCAAT ATGATTGCCT
   56221  AGTGATCCCG ACAATGATTT TATTTTGTTA AGTCTTAAAA TTGCATAGCT CATTTTGTAT
   56281  TATTTTTAAT TTTACTATTA AACTATCTCC CCCTCGGAGA GCAAACTTCA CCTTTCGGAG
   56341  AAAGTGTAGT TTGTTACACT TTACACAGGT TTGAAGTTTA GAAGTATCTA TTATGGATAA
   56401  TTTGGCCTCC TTTTTTGGTA TATAAAATGA AGTAATAAAT AGCTATCCAG CCTAATGGAA
   56461  TATACCAGGC ATAAAATATT TTATCCGTCT CAAAATAGAT CCGAAGGAGA TCATGTTCGC
   56521  CAAGAACAAT TCCTTGTTTT TTATTGCTCA TAGCAATAGA ATAACAACTA TAAATTATGA
   56581  GCTGTAAAAC CCCTAATAAT GAGGTTTTAT AAAAGGCGTC TTTCCAGTTG TATTTTTTTT
   56641  GGAATTTTAG GAACGAAAAC AAGACTATAT TACATAGTGA AATAGATAAA TTTTTGAGGT
   56701  TAAAATCCAG GTTCCTTAAG AGGAAATAAA AAGCTTTTTT TCCTCTTAAA TTTGTTTCTT
   56761  TTAGACATTG TAAAGATTCT GTTGTTAAAG ATTCAGCGAA CAGAAAAAAT AAACCGCTGA
   56821  TTATTGCTAT TGGAAAAAAT AAGATCATTA CATTTCTGAC TAATAGCTGT AGGAGCTGTA
   56881  ATTTCATTCT TGATGGTATC ATGTTTTGTT TTTTAAGTTG AGTTTCTGAT TTTTTAAAAT
   56941  CTACGATCAT TTCCTGTTAA AGGAATAATA TTGAACATTT CATATAATCT ACTTTTTACT
   57001  TGAGGGGAGT ATCTTTTTTC TAGTTTTTCA ATGCTAAGAT TTGTGGTAAC AAAAGTTTTC
   57061  TTTCCTAAAT TTTTGAAATT GTTATATCTA ATCTGTAAAA TGCGATCGAA AAGTTCTTCT
   57121  TTAATTCCCC AAGCTTGTAC TTGGTTTTCA GTGCCTAAAT CATCAAAATG AATAGTGCCT
   57181  CTGGAATATT TTTCAATTAC AGATTCACCA CCATTTCCAT ACGCCTTACT TTCTTTGTTA
   57241  AACTCAGTTA TCACAGTATG AACCGAAGTG TTTTTAAAAT AGATTTGCTT TAAATCATAC
   57301  TTTAGGCTTA TGCTTTGAAT AATATCAAAT ATTGAACTCT TTCCTGTTCC ACACTCGCCA
   57361  TAAATTAAAA GCCCTTTTCT AAGCTCTCCA TTTGTTATTT TTTCAAATTC GATATCGTCC
   57421  GAAAAGTATC GAGAGATGAT ATCTAAAAAG AGCTTATTTT CACTATCAAC ATTGAAGTAT
   57481  CTCCCCTTTG AAGCAAAATA TTTTTTGCCT TCTACCCAAA TTTGTTTTTT TATCCACTGA
   57541  GTTGGAATTG GTGTTAATGG TCTAGGTTTG TTTTTTTCTT TCAGAGAATC AAAATATTGA
   57601  TTGCTTTTTT TGGTTTCTTC TTTTTTGAGC TCAATTCTTT TTTTTCTTTC TTCCTCAGTT
   57661  TCCAAACCCA TTTGAATTTT TGCCTGTTGC CCTAGAGAGT TTTTCATTTT TTTCTTGGAT
   57721  TAGCATTAAT GAATTTTCTT TTTGAATTTT TCTTTTTTAA ATAATTATTA GATGTATTAT
   57781  TAATACTCGT ATTATTATCA TTCAAAATTT CTTGTATAGG TCTATTCAAA TTAATTTTAC
   57841  TAGGGTGGGA AAAAATTGTG ATATACCTAT GCAAAATTTC TTTACTACCA TCAGCACGAT
   57901  AAATAAACCT TTCAATGTAT CCGCATTCTT CCAATTGAAG AAGCCAGTTA TTGATAGTTT
   57961  GTTTCGAAAC TTGATAGAGT TCTTCAAAAT ATTTATTAGT AGACCAACAA ATACGGTGAT
   58021  TATTAGTAAG AGCGGTTATT TCGGCAAAAA GAATCTTTGC AGCCGGCGAT AACCTTTTGT
   58081  CGTATCTTAT TTCTGCAGGG AGTATTGCAT AATAGTTTGG CTTGGATTTT TCCATAGTAA
   58141  ATGATTTTGT AAATACAGTA TCTTTGTGCT GTATTAATAT GTTAGATGTT AATTAGAAAG
   58201  TCTAAAAGAA GTGTCAGAAG CTATTTTAGA CTTTTTTATT TTCTAGATGC TTTTACAAGC
   58261  TTTGAGTTTT TTCTTGCTTG AGTTAAAAGC TCTTTTTTAG AATAGAATAC AGTCCTGCCT
   58321  ATTTTATAGT AGGGTATGAG TTCTTTCTTT TTCCATTTAA TTAAGCATTG CACTGAAACT
   58381  CCAAGTAAGT CTGCTGCTTC TGTTTGGGTA AGTCTATCTT CTTCGGGATT AGCTGAGGAT
   58441  TCATCTATCA GCTCAGTTTT TCTAAGGCGA TTCACCACTA ATTCTATAGT GTGTTCTAAG
   58501  TCCTTTTTTG AAAAACCGTA TAATATTGGA TTACTCATGT TAATTGATTT TTAAATAATT
   58561  CATAGTTAAC TTTTGTTAAC ACATCAAAAC TATTTTTAAA ATCACATGAT AAATTATCGT
   58621  TTTTGAAAAG ATAATTTTAT TTGCTGATAA TCAGATTTTT ATATATTTAA TTTTTTTTAA
   58681  ATAGATAATT CTTTCCAAGA CATTGAGTAA TTTAATAAAG TGTTTTTTTT AGGATGGGTA
   58741  GTGCTTTTAT TGTAAATCTT TTTTAGCATA GGAATGGAAA GTTTAGTGTT AAAATAGCTA
   58801  TGTAGATTTC TTATAATTTG AATTTTCTTT GATTTTTTAA GAGCGTTTTT TTCGGAAAGA
   58861  AATAAGAACA TTTCCATAAT TTTTTCAAGT TGATCCCTAT TTAGGTCTAA TCTTTCATGA
   58921  TTAAAACTTT GTTTTACAAA TAGAAAATCA AAAAAATCGT TGCTGTTTAT TGGAAGTAGA
   58981  GTGCAATATT CCTCAAAGAA TCGTTTAATA AATTTTGATA GATTTTGTTT GCTAATTGTA
   59041  GAGGTGTCAA TATTGATTAT TTGAGTCAGA TAGTCTTGAT TTGATTTTAA GTCTTCGTTT
   59101  GATTGTAATT GAGTTAATAG TTCCCAAATT GTAGATTCTG TTAAATCAAG CAAACTTTTA
   59161  TTTGTTATTT TTTTATTCTC CAAGGTTAAA AAATCATTAG CAATTGTGGG ATGCATATAT
   59221  TTGCTAGAAT GGTTTACTAT GGGTTCTTTA TACTTTTTCA GTAAAAATTT TCTATACTGT
   59281  AATCCAGTAG TAATTCCATA TAGTATTTCT AAAATAGAAT CTGGGTCTGT TTCTCCATTA
   59341  TTAAAATTAT TTCCTGTTAA ATAGATTTTA CTTACGATTT TTTGTTGAAT TCTAACATGG
   59401  TAATTGTTGA TTTCAAGATG ATCTATGTTT TCAGGTTGAT GAAGCCAATT AAAAGCTTCT
   59461  AGTGCTGAAT CATCACCTTG GGAATAATTA TAATTGGCTT CATCTAGCAT AAGTTTATCA
   59521  TATATCAGTA ACTCATTAGT ATGCGGATGT ATTCTGCAAT ACTCTAAATC AAAAAACAGG
   59581  TTAAAATGTC CTGGAGTGAA TGGTAATGAT AGAAGATCGT TGTCTTCAGG CATACCTAAA
   59641  ATTGAACCTA ACAGTTTAAT TCTATCCAAA AAAGGCAGAT TAGCTATCAT ACCTTTAACG
   59701  AGATAAAATT CGGGAGTTTC TTTTTCAGAG TTGGTATCTA ACCATTCTAA ACTAGTTACC
   59761  ATTTTTTTAA TGTATTCTAT ATTGTACATA TTCAAATTTT ATTCCAAGTA TTATCCATTT
   59821  CGTTTTTCTT AAAATCATCA GCAATTTCTA CATAGCGTTT AAACGACGAT TCATCTTTAT
   59881  GACCAGTAAT ATTGCGTACT ACCATTTCTT TCATTCCAAG AATTAAAGAG TTTGTCACAA
   59941  AAGTTTTTCT AGCTGTATGA CTAGTAATTA ATTGATGTTT TGGAAACACT TTATCAACTC
   60001  TTTTTTGACC AATATATCGT GTAGTGTTTA CAGGAGTATC AATGCCAACT ATTTTGCAAC
   60061  ACTCTTTTAT ATACTGATTA AATTTTTGAC CTGAGATTTT AGGTATAGGC TCGTAAAGAG
   60121  TGTCTTTATA CTTGTTTAAA ATGGCTTTGG AAAAAGCATT TAAAGGTATT TTGTGGTCAA
   60181  TGGTCTTTGT TTTTTGAACA TTAAGTTTTA GGTAATCTTC ATAAATATTT GAAGGTTTAA
   60241  GCTGTTTTAT ATCGCTAAAT CTCAATCCTG AAAAGCAACC TAAACAATAA AAGTCTTTAA
   60301  CGTGTTCCAG GCGTTTAGAT TCAAACTCGT AATTATAGAG TTTCATCAGT TCATCCATGG
   60361  TTAAATAAAT TACCTCGATT GTATTGCTTA CGGTCTTAAA TTTTTTGAAT TCTAAATTTT
   60421  CATGGTATTT TCTTTCGTAA GACCAATTCA TGAAAGTTTT AAGCACTGAT ATTATTCTGC
   60481  CGTAATAATT ATTGAGCGTG TTTCTTTCTT CAAAAGCGTA ATCTCTAAAA TCTTCGTAAA
   60541  AATTAACGTC AACATTGTCA AATCTTAAGT TATATTTTTT TGCTACATCA AAATCCTTTA
   60601  TGAAATTTTT ACAGGATATA TATTTTTTAA TTGTACCGTT TGCCTTAGTT GATTTATTGG
   60661  TGTCAATAAA TTCTTGGAAT GATTCAAAAA AACTTGGAGC AATACTATTT GAATTTATGC
   60721  TGTCGTTTTC AAGCTTGTCA ATTACATATT CCTTAGTTAA TGGAATGTTG TTTAGCAAGG
   60781  CATGCCTATG AATTAGCTTA AGCTTGTTTT CAAGTTCATC AAGCTCCTTA TTGAATTCAA
   60841  TATGGAAATT GTAATCTTCA TTTTTAAGAT TGGCTTTAAC TCTTTGGTTT TTCCAGTCCT
   60901  TTTGCTTGGT TCTTACGCTC TTTACGTTCC TACGAATCCT TTCACCGTTT AGAGTGATAA
   60961  TCATACGAAC AGGAATAAAT CCGTCTTTGT TTATTTTATC TTTTCGTAAT GTGAATGAAA
   61021  CTTGCATAAA ATTTTAATTA TTACCTGCTA AAAGCTATAA GTGCTAGTAA GGATAGATTA
   61081  GCTAAACTGC TTGTTTTGTA TAAGGTTGAA TTTTATTAAT GTCATCTTCT TTTTCAATTT
   61141  GAGCTTTCCT AATTTCGTAG AAGGATTGTA AGTTTGACCA AAATTCTGGG CTGTTTCCAA
   61201  AAAATTTGCT TAATCTTAAT GCCATTTCGC CACTTATACC CATTTCTTCA CGTACAATTT
   61261  TACCTACTCT AGAATCACTT ACGCCAATAC TTTTAGCCAA TTTATAGGCT GTTATTCCCA
   61321  TGGGTTTTAA AAAATCCTCT CTAAGCATCT CTCCAGGGTG TACGTTCATT TGCTTTTCCA
   61381  TTTTTACATC TTTTTAGTGA TAATCTATAA TTTCTACATC GTAAGCATTG TGATTATTCC
   61441  ACTTGAAAAT AATTCGCCAT TGCATATTTA TACTAATTGA GTGATATTCT TTTAAATTTC
   61501  CTTGTAACTG GTGTAATCTA TTGCCAGGCG GAATCGTAAG ATCATTTAAA TCTTTTGATG
   61561  AATGAATTTG TACGAGCTTT CTAAAAGCTT TTTTTTGAAT TGATGCATCT ATCTTTTTAG
   61621  ATGAATGACC CGCAAACAAT TTTTCTGTTT CTTTATCGCC AAACGATTTT ATCATTTCAA
   61681  TTATATGTTA GTAAATATAC ACAACAAAAA GTTAGTAAAC AACAAAAAGT TTGTATGTAA
   61741  TTTTTTTTGT AATGTTTCAT TATATTTATT GAAGTTTAAC TTAAGCCTTA TTAATATTGA
   61801  TTGTTATTAA TTAATTAGGG GGTTAAAAAG GGGGATAAAA ACTATGTTTA ATACATTAAA
   61861  TAGTATTAAA CATAGTTTGT GTAAACCCTT ATGTGTTCAA ATATAGGGAA TTAAATGACA
   61921  TTAATAGGAG TTAAAAAAGT ATGGTGGTTC TAGTAGACCA ACTTAAAAGG AGCTTTCATT
   61981  TTTGAAAGCT CCTTTTTTTT GTTTATATGT GTAGGTTTTT TTGGGTGGCC TATGTTGAGT
   62041  AAGTTTTTGT CATATGTTAA GCTTATAGTT TGTAGGTGAG TATGGGGATT TGGGTATGGT
   62101  TAATAAGGTC TTCACTAATA CTTCCGTTTA TAAAGTGCGA TAGGCCTTTT CTTTCGTGTA
   62161  CGTCAACACA TATTAGATTG GCATTTATGT CGTTGCTAAA ATTAAGTACG CCTCGTTCAA
   62221  TGGTAGTATC GTTATATATG TGGAGGTTGT CTTTTTTAAA TGGGGTTTTG CTTAGAAAAG
   62281  CTTTCATTTC TTCTTCAATA GCATGTGTTG TTTTGAAATT TCTAGGGGTG TTAATATATA
   62341  GTAAGTGAAT TTTAGCATTC ACTTCTTCTG AAAATTCGTG TAATGCATTA AGTGAACGAA
   62401  CTTCCTCATC TTTGAAATTA CAGGCAAAAA CAATGTTTTT TACATTCTTT ATGTTGGTGG
   62461  GTTCTTTTAC TACTAGAACA GGAGTGTTGG CAGTTCTAAC AATTTTTTCT GTATTTGATC
   62521  CAACGAACAG ATCAGAAAAA GCTTCTTTTC CGTGGGATCC AACAACAATG AAATCGATTT
   62581  CGTTGTCATT GCAGCTTTTT ATAATTCCTT GAGGGATGGG TTGTGTGTTT ACGTCTTCAT
   62641  GAGTTTTTAG GCCTTCAAGT AATGGGGAAT CAATAAGTTC TTTGAATTTA GAGTGAATGT
   62701  TTTTCATGAA TAAAATGGCT TCGGGAAAAT TGCCGTTAGA GCCAAGTATG GGGTCGTTAA
   62761  TGTGGGATGG AAGCTCCAGT AAATGAAGCA AGTGAATGGT GCTATCGTTT TTTCTTGCGA
   62821  GTTGCGCCGC AACCGATAGT GCGTTGTAGG CATCTGATGA AAAATCAGTG GGTACTAGTA
   62881  TGTTTTTCAT AACTAATTGA TTTTTAATTG AATGTATCTA ACAAGTTAAT AAAAAATAAT
   62941  GAAAACTTCA AGCTTTTTAT TTATTGAATA TAATTAGCTA TATTTGCACT GTTGAAAATG
   63001  AAAAACAAGG GTGAGGGGAC GGGAAGTCCC CTCTTTTTAT ACTAAAAAAT GTTCAAACAA
   63061  AAAGTAGAGA GCTTATTAGA AGAAGCTTTA GTTGAAAGGT CTAATTTGTT TTTAATTAGT
   63121  TTCCAAATAA CTGGAGCAAA TATTATTCAA GTGATTCTTG ATGGGGATGA AGGAGTGAGT
   63181  GTTGATGATT GTATTGAGAT AAGCAGGGCT ATAGAGCATA ATTTAGATCG AGAGGAAGAA
   63241  GATTTTTCTC TACAAGTAAT GTCAGCAGGA ATTACAGAAG GTTTAGTGCA TATTAGGCAG
   63301  TATCCTAAAA ATATAGGACG AACTTTAAAT GTAGTAACTG AAAAAGAAGA AATAGAAGGG
   63361  GAACTTATAG CTACAACAGC GGATGATTTT ACACTTCAAT GGAAAGCCAG AGAACCTAAG
   63421  CCGGTTGGTA AAGGGAAAGT AACTGTTCAA AAAACAAAGG TTATTCCTTA TGGAGAAGTA
   63481  AAAAAAGCGC ACGTAGTCGT AAAATTTAAT TAATACAGAG TATGGAAAAC ATTGCGCTAA
   63541  TAGACTCGTT TTCGGAGTTT AAGGACGATA AGTCTATCGA CCGAGTTACG TTAATGTCTA
   63601  TTCTAGAGGA AACCTTTAGA AGTGCCTTGA AGAAAAAATA TGGTTCAGAT GATAATTTTG
   63661  ATATCATTGT AAATCCGGAT AAAGGTGATT TGGAAATCTG GCGTAATCGT ATTGTTGTCG
   63721  ATGATGGTGA AGTTGAGGAT GAAAATCAAG AAATTTCAAT TTCTGAAGCG CGTAAAATAG
   63781  AGCCTGATTT TGAGGTGGGT GAAGATGTTT CTGAAGAGGT GAAATTGATA GATTTAGGGC
   63841  GTCGTTCAAT TTTGGCATTG CGTCAAAATT TGATAGCTAA AATCCATGAG CATGATAATA
   63901  CAAACCTGTA TAAGCAATTT AAAGAGCTTG AAGGGGAAAT GTATACGGCA GAAGTGCATC
   63961  ATATTCGTCA TAGAGCAGTA ATATTATTGG ATGATGATGG TAATGAAGTG ATTCTTCCAA
   64021  AAGAGAAGCA AATACCATCT GATTTTTTCC GTAAAGGAGA AAACGTAAGA GGGGTGATTG
   64081  AAAAGGTGGA GCTAAAAGGG AATAAGCCTT CAATTATAAT GTCAAGAACA GCTCCTTCGT
   64141  TTTTAGAAAA ATTATTTGAA TCAGAAATCC CTGAAGTTTT TGATGGGTTG ATTACAATAA
   64201  AAAATGTAGT ACGTGCGCCA GGTGAAAAAG CAAAAGTAGC TGTGGATACT TACGATGATC
   64261  GTATAGATCC TGTAGGAGCA TGTGTTGGAG TGAAAGGATC TCGTATTCAC GGTATTGTTC
   64321  GTGAATTAGG GAACGAAAAT ATTGATGTCA TTAATTATAC AAATAATGTT CAGTTATATA
   64381  TTACTAGAGC ATTGAGTCCT GCAAAGGTAA CTTCGGTTAA AATTAATGAA GAAACTAAGC
   64441  GAGCAGAGGT AATGTTGAAG CCTGAAGAGG TGTCGCGTGC CATTGGTCGA GGAGGGCATA
   64501  ATATTCGTTT AGCAGGAATG TTAACAGGGT ATGAAATAGA TGTATTTAGA GAGGGAGTTG
   64561  AGGAAGATGT AGAATTAACT GAATTCTCAG ATGAAATAGA TGCATGGATT ATTGAAGAGT
   64621  TTTCAAAAAT TGGTTTGGAT ACTGCTAAGA GTGTATTGGA GCAAGATGTG GCTGATCTTG
   64681  TAAAAAGAAC GGACTTAGAA GAAGAAACCG TAAATGAGGT AATGCGTATT TTGAAATCGG
   64741  AATTTGACGA TTAAATAACA GACTTACCTT ATAATAGTAT TACATTAGAT ACAGAATAGA
   64801  ATAGGCATTT ATGGCTGGAG TTAACAACAT GAGATTAAAC AAGGTTTTGC GCGAATTTAA
   64861  TATTTCGTTA GACAGGGCTG TGGACTTTTT AAGTGCAAAA GGTCACGAAA TAGACGCGCG
   64921  ACCTACTACC AAGATTTCTG CGGAAATTTA TCAGTTATTG ACTGATGAAT TTCAGGGAGA
   64981  TAAATCTAAA AAGGTGGCCT CAAAGGAAAA AGGGGAAGAA AAGCGCAAAG AAAAGGAAGC
   65041  GATCCGTATT CAAATTGAAA CGGAGCAAGA AGAGAAGCGT AAAAAAGCAC AATCCAATGA
   65101  GGTTGTTAAA GCGAAAGCAA AACTTGATGG ACCCAAACAA GTTGGTAAAA TTGAGTTAAA
   65161  CAAACCAAAC CAAGAAGCTG CTCCAAAAAC AAGTTCAAAG CCCGAACCTG TGACAGAAAC
   65221  TGAAAAAGAG GCTCCTGTAA AAAAAGAAGT CCCTGTTAAA AAGGAGGTAG CTACTCCTAA
   65281  GAAGGAGGTT GAAAAAGCTC CGGAAGAACC ACAGGTAGTT TCAAATAGGC CTAAAAAGCA
   65341  AGGGATAAAA ATTACTGGTC AAGCACCAAT TGCAAAACCA GTAAAGCCTA AAGTTGCAAA
   65401  AGTTGACGAA GAAAAAGCGA AGGCGGCACC GGCTGCCAAG CAAGCTGCTG CTTCTCCAGC
   65461  TGCGACATCT GGTCCTAAGC ATGCCGAAGT TGGTGATGCA CCATCTGAAA AGGTGAAAAC
   65521  ACAATATAAA AAACTTGATG GTCCTAATTT TACAGGTCAA AAAATTGATT TGTCTCAATT
   65581  TAAAAAGCCT GAAAAGAAGA AGGATGATAA GTCGTCTTCA AACGATGCGA ATAAGCGAAA
   65641  GCGAAAGCGT ATAAGTAAAG GGCCTAACCA AGGTCAAGGT GGAGGCCGTG GTGGTAATAA
   65701  CCGAGGTGGT GGTAAATTTC AACCACGTGG AAAACGTGCG CCAATTGTTA AGGCAGAACC
   65761  AACAGAAGAA GAAGTACAAA AGCAAGTACG TGAAACTCTT GAAAAACTTC AAGGGAAATC
   65821  AGGTAAAGGT AAAGGAGCTA AATACAGAAG AGATAAACGA GATCAACACC GTCAAAAGAC
   65881  AGAGGAGGAT CAAGCAGCTC AAGCAGCAGA AAGTAAAGTA ATTAAGGTTA CTGAATTTGT
   65941  TACTGCAAGT GAGGTGGCAA CTATGATGGA TGTGAGTGTT ACTCAAATTA TATCGGCATG
   66001  TATGTCGCTT GGAATGATGG TGACAATGAA TCAGCGTTTA GATGCCGAGA CATTAACTAT
   66061  TGTTGCAGAT GAATTTGGAT ATACAGTTGA TTTTGTAACA GCTGATATAG AGCAAGCAAT
   66121  TGAAGAAGTT GTTGATGCAC CAGAGGATTT ATTAGAAAGA GCGCCTATTG TTACGGTAAT
   66181  GGGACATGTT GATCATGGTA AAACATCGCT TTTAGATTAC ATTCGTAAAG AGAATGTAAT
   66241  TGCTGGAGAG AGTGGAGGAA TTACACAGCA TATTGGAGCC TACGGGGTGC AGTTGGATAG
   66301  TGGTCAAAAA ATTGCCTTTT TAGATACTCC GGGTCACGAA GCCTTTACGG CGATGCGTGC
   66361  ACGTGGGGCT CAGGTGACTG ATATTGCTAT TATTGTAATT GCAGCGGATG ATGATATTAT
   66421  GCCTCAAACA AAAGAAGCAA TTAGTCATGC GCAAGCTGCT GGAGTGCCTA TCATATTTGC
   66481  AATTAACAAG GTAGATAAGG AAACGGCTAA TCCAGATAAT ATAAAGACAA AATTAGCGGC
   66541  AATGAACTTG CTAGTTGAAG AGTGGGGTGG TAAAATCCAA TCTCATGATA TTTCAGCTAA
   66601  AACAGGTTTA GGTGTTAAGG AGTTGTTGGA AAAAGTATTG CTAGAGGCTG AATTATTAGA
   66661  GTTAAAAGCA AATCCAAATA GAATAGCAAC TGGAACAGTT GTTGAAGCCT TTTTGGATAA
   66721  AGGACGTGGA TATGTATCTA CAGTATTGGT ACAGTCGGGT ACATTAAAAG TTGGTGATTA
   66781  CTTGTTAGCT GGTAAAAACA GTGGTAAGGT AAAAGCAATG CAGGATGAGC GCGGTAATCG
   66841  TGTTTTGGAA GCTGGACCTT CAACGCCAGT ATCTGTTCTT GGATTAGATG GAGCGCCTCA
   66901  AGCGGGTGAT AAGTTTAATG TGATGGATGA TGAGCGTGAG GCTAAGGATA TTGCTTCAAA
   66961  AAGAGCGCAG TTACACCGTG AGCAATCTGT ACGTACACAG CGTCATATTA CACTTGATGA
   67021  AATTGGTCGT CGAATTGCAC TTGGAGACTT TAAGGAGTTA AATATTATTC TTAAAGGTGA
   67081  TGTGGATGGT TCAGTTGAGG CATTAACAGA TTCATTCCAG AAGTTATCTA CCGACGAAAT
   67141  TCATGTGAAT ATTATTCATA AAGCGGTAGG AGCAATTACA GAAAGTGATG TATTATTAGC
   67201  TTCGGCATCT GATGCAATTA TTATTGGATT TAATGTACGA CCAGCAGGTA ATGCACGTAT
   67261  GGTTGCTGAC AAGGAAGAAA TTGATATCAG AATGTATTCA ATCATTTATG ATGCGATAAA
   67321  TGACTTGAAA GATGCTATGG AGGGAATGCT TTCGCCAGAA ATGAAAGAAG AAATTACTGG
   67381  TACAGCAGAA ATTCGTCAAA CATTCAAGAT TTCAAAAGTT GGTACAATTG CAGGTTGTAT
   67441  GGTGCTTACT GGTAAAATCT TTAGAAATAA TCAGATACGC TTAATTCGTG AAAGTGTAGT
   67501  GATCTACACT GGTGAATTAG CAGCCTTGAA ACGTTTTAAA GATGATGTTA AGGAAGTGGC
   67561  TAAAGGATAC GATTGTGGTA TGCAAGTCAA GAATTATAAT GATATTAAAG AAGGTGATAT
   67621  TATTGAAGCT TTCCAAGAAG TGGCTGTGAA AAAGAAGTTG AAATAACAAT TTTACAGTAA
   67681  AATAAGTATA AACCGAAATC ACATTAATGT GGTTTCGGTT TTTTTTTTTT TTTTGCAAGT
   67741  CAAAGACAGG GCAGTACGAT AGTGATGAGT CAGTTGATGC TTGAAGGTAG AGGGAAATAG
   67801  CTTTAGTTAT TGTTTCATTT TTTAACGCAT GAATTGTAAA AAAGAAACAA GATATATGTG
   67861  AAATATTTAT TCGCAAATCC TATAATTTAT TGTTCAAGGG CTAGGGTGTA GTATATATGT
   67921  GGTGTTCTTA TTTGTATCTT AATATTAGCC AATATTTTGA CGCAACCTTT CTTCTGATTA
   67981  TTCATCTTAT TGAGGTGAAG TCTAATTTAG GTATTCTGGT ATTGAATAAT GAAGAATTTT
   68041  AAATGAAAAC ACAACATCAA TATAAACTAA ATATAAAAAA TGAAAAAAAT CAATCTATTA
   68101  CCCTTGGTAT TACTAGCCTT GTTGCTTTCA AATTGCTCTA ATGATGATGA TAATTCCAAT
   68161  TCAAAAGAAA TGGATTTTAG TGGGGATTGG ATAGGAACAA AGTTTCTGGT TAATGAAGCT
   68221  TATGATTTTA ATAATGATGG AATTCCAAGT AGGGATTATA AGATAGAGTT GCCGTGTTTA
   68281  ATTCAAAATA TAACTCTTAA TCCAGATGGA ACAGGTTTGT TTAAAGCTAA TATTCATGGA
   68341  CAGGCAGAAG GGCAGACAAC TCCTTTTCCT TTAACTTGTG TTGAGTACGA AGAGAATCCC
   68401  ATGACTTGGT CTTTAAATGA GGAAGAAACA AAAATACTGC TTAGGTTTTC TGAAACAGTT
   68461  GTTGAGGAAT TTCCAATTGT TAGTGAAGTT GTAATAGAGC GGTTTTCTGA ATCGTTATTA
   68521  GATGATACGA TCGGTATTCC TGGAAAAGTA GTTTATGAAA AACAAACTAA ATGATAGAGG
   68581  AGAAAACAGC TGAGTTTTTA AGTTGAATGC AAAAAAAAAT ACCATAATTA GATATTCTAA
   68641  TTGTGGTATT TTGGTTTCTA TACTTGTGAT TTTATAGGGA TTTATTTCTC GGGTTTAAAA
   68701  ATAAAAGCAT GGGGGAAATT TTTGCTTATT TTCATTAGGG CTCTATCTGC TTCTAATCTT
   68761  GTTTGGAAAT TGCCTACCCA GACTTTGTAG TTGGGAGTTT CGTATTCTAT TTTTCCAGGC
   68821  CAATCGGTAA ATTTTGTGTT GAAATTGCTT AAAACAGCGT GTGCTTTATT CAGGTTCCCG
   68881  TAGTACAATT GTATTTTGTA ATTGTCTTTA TTGTTTTCAG AAAATTTAGT TTTGACTAAT
   68941  TTTTCAATAT TTGGATCAAC ATTTATGTTA ATTGTGGCGG GGCTATTGGT TTCAGAATTA
   69001  GCGTTGTCAG AGCTATTTTG AGCTTGACTT GCTATGCTTA ATAGTAAAAA AAGGAATGAA
   69061  AAAAAATTAA ATCTGTCTTT CATTGGGTTG TAATTTATGA TGTATACAAA TGTAAAAGAA
   69121  AAGCTTATAC TCTTATAGGA AATCTTTATT TAGAATTTTT ATAAATTAGG TTTTAAGCTT
   69181  TGGCTAACAT TTTGCGAACC GACTTTATGT AGTACTTTTG CTCTGCAAAT TTATGCATGC
   69241  TTTTTTGTGA TTAATAACTA CAGAATTCAT GCCAAAAATT AGATGATAAC TCTATAATTT
   69301  AATATGAGAC AGGTAAAACA CCGAAATTCG GTTTCTAAAC TACTTCTTTT AGGTCTTGCG
   69361  TTTCTACTTA CGTTTTCGAC AACAACAACT GCTTTCGCTC AAGCCGATGC GGGAAAAGGT
   69421  AAAGAGTTGT TTAATTCATT ATGTGCAGCT TGCCACAAAC GTTACAAAAA AGCAACAGGT
   69481  CCAGCGCTAT TTGGTGTTAC GGAGCGTCAT AGTACGGAGT GGCTTTATAA ATGGATAAAA
   69541  AATAGTACTG CTTTGATTGC TTCGGGAGAC GCTGAAGCTA TTGAGATTTA TGAGCAATAC
   69601  AATAAGACGC CAATGAATTC ATTTCCGCAA TTATCAAATG CGGATATTGA TAATATATTA
   69661  GCTTATGTAA TGGAGCCAAA AGCAGCTCCT GCTCCAGGTG CAGTTCCTGT GGGTGGAGCT
   69721  CAGAAAGCAA CAGATGACTC GGGTTCAGGT TCTGTGAATT CTTGGGTTTT AGGTTTGTTG
   69781  GCTGTTGTGT TGCTTGTTTT GGTAGGGGTG TTGTTTATGG TGAACAAAAC ATTGCGTCAA
   69841  TTTGCGAAAG CTAACAATAT TGACTTGCCA GTTAAAGAAG AAAGAAAGCC AATTTGGAAA
   69901  GCTTTTATTG AGAATCAATT TCTATTATTG GTTTCTGCGG TATTTTTACT TTTGCTAAGT
   69961  GGCTATTTTG TGTATGGGTA TTTGATGCAG GTTGGCGTTG ATCAAGGGTA TGAGCCGGTG
   70021  CAGCCAATTC ATTATTCGCA TAGGATTCAC GCGGGTGATA ATAAGATAGA TTGTAAGTAC
   70081  TGTCACTCGT CTGCTAGAGT ATCTAAGCAC TCAGGTATAC CTTCGTTAAA TGTATGTATG
   70141  AACTGTCATA AGTCAATTGG CGAGGTTGCT GAGGCGACAC AAGCAGAAGG ATTGGCTGAG
   70201  TATGGAGTGG ATTATAACAA ACAGATTCAG AAGTTGTATA AAGCTGTGGG TTGGGATGCG
   70261  GATAAGCAAG CTTACACAGG TAAAACAGAA CCTGTAAAGT GGGTGCGTAT CCATAACTTG
   70321  CCAGATTTTG CATATTTTAA TCACTCGCAG CACGTAATGG TAGCTGGAGT TGCATGTCAA
   70381  AAATGTCATG GTCCTGTGGA GGAAATGGAG ATTATGTATC AGCATGCGCC ATTAACTATG
   70441  GGTTGGTGTA TAAACTGTCA TAGAGAGACT AATGTAAAGG TGGAAGGAAA TGCTTATTAT
   70501  GAAAAAATTC ATGAGGAGCT TTCGAAAAAG TATGGTGTGG ATAAGCTTAC GGCTGCTCAA
   70561  ATGGGTGGTT TAGAGTGTGG AAAGTGTCAC TATTAAGAAG GTTTTTATTC TTGCCGAGAA
   70621  GTCGGTCTAC TCTTGAGATT GTATTGAGAG TTGGAAACTT TAAAAATAAT TTAAGAAGCA
   70681  AATAAGTTAT ATATATGTCA TCAAACAAGA AATACTGGAA AAGTGTTGAG GAGCTAAGTG
   70741  ATAGCTCTAT GGTTGAGGCG CTCAAGCAAA ATGAGTTTTC TGAGGATATT CCTGTAGAGG
   70801  AGTTTTTGGG AGATAAAGAA ATGCTTGATG AATCTTCTAC ATCACGTAGA GATTTTTTGA
   70861  AGTATGTTGG GTTTAGTACT GCTGCTGCTA CATTAGCGGC ATGTGAAGGC CCAGTTGTAA
   70921  AAGCTATTCC TTATGTAGTG CAACCGGAGC AAATTGTTCC TGGGGTTGCT AACTATTATG
   70981  CAACTACTAT TGCAGATGGA TTTGATTTTG CAAATGTACT TGTGAAAACT CGAGAAGGTA
   71041  GGCCAATTAA AATTGAAAGC AATCGTTTAG CGGGTGCAAA TGGAGCGGCT AATGCACGTG
   71101  TGCATGCTTC GGTATTGTCA ATGTATGATA ATACGCGTTT AAAAACTCCT CAAATTGGTG
   71161  GTAAATCTAC TGATTGGGCT AAGTTTGATA AACAATTAGC ATCAAAGTTG AGTGGGGTTT
   71221  CTGGTAAAAT TGTGTTATTG ACACAGACTT TTGCTAGTCC TTCAACGGAT AAATTAATTG
   71281  GTGAATTTGC TTCTAAATAT CCAAATGTTT CTCATGTAAT TTATGATTCA GTTTCTAATT
   71341  CTGAAGCCTT AGCTGCTTAT GAGCAGGTGT ATGGTGTTCG TGGATTAGCT GATTATGACT
   71401  TTGAAAAAGC GTCAACTATA GTAAGTGTTG GTGCTGATTT TGTGGGTGAT TGGCAAGGTG
   71461  GAGGATATGA TGCTGGATAT GCAAAAGGAC GTGTTCCTCA GCATGGAAAA ATGTCACGTC
   71521  ACGTACAGTT TGAAGCTAAT ATGACATTGT CTGGAGCAAA TGCTGATAAG CGTATTCCGA
   71581  CTACGCCATC ACAACAGAAG CAAGTATTGG CTGCGTTGTA TGGGTATGTA ATGGGGTATG
   71641  CTGTAAATGC AAGCTTACCA GCTCCAATAA ATGAAGCGGC TAAAAAAGCG GCACAACAAT
   71701  TAAAAGCTGC TGGTAGTAAA GCAGTGGTTG TTACGGGTAT TCAAGATAAA GATGCACAAG
   71761  TAATTGCTTT AGCAATTAAT AATAAATTAG GGAGTAAAGT ATTTAATGCT GAGCGACCTA
   71821  AATTAACCAG TCAAGGTGAT GCTGCTAAGG TAAACGCTTT GGTTGCGGAT ATGAATGCTG
   71881  GTAAAATTGG AGCATTATTA ATAGCAGGAG TGAATCCTGT GTATTCATTA CCAAATTCAA
   71941  AGGAGTTTGT TAGTGGATTA AAAAAGGTAG GGGTGACAGT TTCTTTTGCT TCAAGTAATG
   72001  ATGAAACTGC CGCTTTATGT GAATTTGTTG CAACAACTCC ACATTATTTA GAATCATGGG
   72061  GTGATGTTGA AATCAATAAG GGGGTGTATA GTTTGGTGCA ACCTACTATT AGACCTTTAT
   72121  TTAAAACACG CCAATTTCAG GATACATTAT TGCAATTAAT TGGTTCTGGT TTGACGTATG
   72181  ACGCGTACAT GAAAAATGTA TGGAAGTCTT CTATTTTAGG TGGAGCTTCG TTTAATAAAG
   72241  CCTTGCATGA TGGTGTGTTT AAAACAGCTG TTGTGTCTAG TGTTGCCGCT GAAGGTGATG
   72301  TTGAAGAAGG TGCAGAGGCA GCTGCTTTTA CAAGTTCGTT TGCTACATCT GTTAGAAGTT
   72361  TAACTTCAGC GAAAGCGAAA GGTTTAGAGC TTACATTATA TACAAAAACA GCTATGGGTA
   72421  GTGGTAATCA AGCTGTTAAC CCTTGGTTGC AAGAATTGCC AGATCCATTA ACAAGAGCTT
   72481  CTTGGGATAA CTACTTAACA GTTTCTAAGG CTGATGCAGC AAGCTTAGGT TTGGAAAACA
   72541  AAAATGTAGC TAACGGAGCA TTAAATGGTA GTTATGCTAC AGTAACTGTT GGTGGTGCTA
   72601  CCTTAGAAAA TGTACCAGTG ATCATTCAGC CAGGTCAAGC TAAAGGATCT GTAGGTTTGG
   72661  CCTTGGGGTA CGGAAGAAAG CAAGGATTAA AAGAAGAGAT GCAAGTTGGG GTGAATGCTT
   72721  TTTCATTGTA TCAAAACTTT AATAATGTAC AATCGGTTAA GGTTGATAAA GCTGGAGGAG
   72781  AGCATGAATT TGCTTGTGTA CAGTTGCAAA AAACATTAAT GGGTCGTGGT GATATTATAA
   72841  AAGAAACGAC TTTAGAGATA TTTAATACTA AAGATAAGCC AGTTTATAAT CCGACTCCAA
   72901  TGGTTTCATT GGATCATGAG GAAACACCAG TAACTTCTCC AGATGTGGAT TTATGGGATG
   72961  AGTTTGATCG AACAATTGGT CATCACTTTA ATTTATCTAT AGATTTAAAT GCATGTACAG
   73021  GTTGTGGGGC GTGTGTAGTA GCATGTCATG CAGAAAATAA TGTGCCTGTT GTTGGTAAGT
   73081  CTGAGGTACG TAGGTCTCGT GATATGCACT GGTTGCGTAT TGATAGGTAT TATTCTTCGG
   73141  AAGAAACATT TGAAGGGGAT AACGAAACTA AAGATGGATT TGATGGTTTA GGTGATAGTT
   73201  TATCTGGATT TGGAGAGCTT GAAGTAGCTT CAGAGAATCC TCAGGTAGCT TTTCAGCCTG
   73261  TAATGTGTCA GCATTGTAAT CATGCACCAT GTGAAACAGT TTGTCCAGTA GCGGCAACTT
   73321  CTCATGGTAA GCAAGGTCAA AATCATATGG CATATAACCG TTGTGTAGGT ACACGTTATT
   73381  GTGCAAACAA CTGTCCTTAT AAAGTGCGTC GTTTTAACTG GTTCTTGTAT AACCAAAATG
   73441  ACGAGTTTGA TTTCCATATG AATAATGATT TAGGTCGTAT GGTGGTTAAT CCAGATGTAA
   73501  CAGTGCGTTC TCGTGGGGTA ATGGAAAAAT GTTCAATGTG TATGCAAATG ACGCAGAAGA
   73561  CTATTTTAGA TGCTAAGCGT GATGGACGTG TCATTAAGGA TGGTGAATTC CAGACTGCAT
   73621  GTTCAAATGC ATGTGTTAGT GGCGCTATTA CATTCGGAGA TATTAATGAT AAGTCAAGTA
   73681  AAGTGGCAAA ATCATTAGAA GGAGATCGTA TGTATCACTT GTTAGAGCAT GTTGGAACAA
   73741  AACCAAATGT GCAGTATCAA GTAAAAGTAC GTAACACAAA AGAAGCTTAA TTAATTAACA
   73801  AAGAAACTAA TAGATAGTAT ATTATGTCTC ATTACGAAGC ACCTATACGA AGACCTCTTG
   73861  TAACAGGCGA TAAAAGTTAC CACGATGTAA CTTTGGACGT TGTCGCGCCT GTGGAAGGAA
   73921  AAGCAAATAA ACAATGGTGG ATTGTGTTTT CAATTGCCTT TGTAGCTTTT GCATGGGGAT
   73981  TGGGTTGTAT GACCTATACC ATTTCAACTG GAATTGGTAC TTGGGGATTA AATAAAACAG
   74041  TAGGATGGGC CTGGGATATT ACCAACTTTG TATGGTGGGT AGGTATCGGA CACGCAGGAA
   74101  CATTAATTTC AGCAGTATTA TTATTATTCC GTCAAAAATG GCGTATGGCA ATTAACCGTT
   74161  CTGCGGAGGC TATGACCATA TTTTCGGTAA TGCAAGCAGG TTTATTTCCA ATTATACACA
   74221  TGGGGCGTCC ATGGTTAGCA TATTGGGTAT TACCGATACC TAACCAATTT GGTTCGTTAT
   74281  GGGTAAACTT TAACTCGCCA TTACTTTGGG ATGTATTTGC AATTTCAACT TACCTTTCGG
   74341  TTTCATTAGT ATTTTGGTGG ACTGGTTTGT TACCTGATTT TGCAATGATA CGTGATAGAG
   74401  CGGTAACACC ATTTACAAAA CAGATTTATA GCGTACTTTC TTTTGGTTGG TCTGGTCGTG
   74461  CTAAAGACTG GCAACGTTTT GAAGAAGTAT CATTGGTATT GGCAGGTTTA GCAACTCCAT
   74521  TAGTACTTTC TGTACATACC ATTGTATCCT TTGACTTTGC TACATCGGTG ATTCCAGGTT
   74581  GGCATACGAC AATTTTCCCT CCTTACTTTG TGGCAGGGGC GATTTTCTCA GGTTTTGCCA
   74641  TGGTAAATAC CTTACTTATA ATCATGCGTA AGGTGTGTAA CTTAGAAAAT TATATCACAC
   74701  TTCAACATAT CGAGTTAATG AATATCGTTA TTATGTTAAC GGGATCTATT GTGGGTGTGG
   74761  CATATATTAC TGAGCTTTTT GTAGCATGGT ATTCTGGAGT AGAGTATGAG CAGTATGCTT
   74821  TCTTAAACAG AGCAACTGGA CCTTACTGGT GGGCATACTG GTCAATGATG ACTTGTAATG
   74881  TGTTTTCACC TCAATTTATG TGGTTTCCTA AGTTGAGAAG AAGTATTATG TTTTCTTTCT
   74941  TTATATCAAT TGTGGTAAAC ATAGGAATGT GGTTTGAGCG TTTTGTGATT ATTGTAACAT
   75001  CACTACACCG TGATTATTTA CCATCATCAT GGACTATGTT TTCACCTACA TTTGTTGATA
   75061  TCGGAATATT TATTGGTACC ATTGGTTTCT TCTTTGTGTT ATTCTTGTTG TACTCGCGTA
   75121  CATTCCCTGT AATTGCTCAA GCGGAAGTGA AATCGATACT TAAATCTTCA GGTGAGAAGT
   75181  ATAAGAAATT AAGAGAGGCC GGAAAGCCTA CTTATGAAAG AGCTGAAGGA ATTGTTGAAT
   75241  TATTAGCGGA TAGTCAAGAC GACCATCACT AAACTATAAA AGTAACTATA GATGGCTTCA
   75301  AAAGTTGTTC ATGCCTATTA CCTTGATGAC GAGGTACTGA TGGATGCAGT AAAAGCATTA
   75361  AAAATTAAGC ACTACCACAT TGAAGAGGTG TTTACACCTT TTCCAGTGCA CGGATTAGAT
   75421  AAATTGATGG GCTTGCCACA CACACGTTTG GCTATATGCT CTTTTTTATA TGGATTAGTT
   75481  GGTTTAACTG TAGCCGTTAC CATGATGAAT TACATCATGA TTGAAGACTG GCCACAGGAT
   75541  ATCGGAGGGA AACCAAGTTT TAGTTATATC GAAAACTTGC CTTCGTTTAT TCCAATTATG
   75601  TTTGAGCTTA CGGTATTTTT TGCAGCTCAC TTAATGGTAA TAACATTTTA CATGAGAAGT
   75661  AAATTGTGGC CATTTAAAAA AGCTGAAAAC CCAGATGAGC GTACTACTGA TGATCATTTT
   75721  TTAGTAGAGG TTGATGCAAG TCATACAAAT GTCGATGAGT TAACAGCATT TTTGAAGGAT
   75781  ACTGGTGCTG TAGAAATTAA TTTAAAAGAT AAGGAGTAGC TTTATGAGAA CATTAATTAA
   75841  TTCACTATTT GCGTTTGCAG CTGTTGCATT GGTTACTTCT TGTAATAGTA AGAAAAAGCC
   75901  AAACTATCAG TATTTTCCAA ATATGTATGA GTCTGTAGGC TATGAAGCTT ATAGTTCTCA
   75961  CGAAGTATTT GCCGATAATA ATACATCCGA AGCTTTGTTA CCTGTCGAAG GTACAGTTAA
   76021  AAGAGGATGG TTGCCATATG ACTATACAAA TTCTCCAGCA GGTTATGCGT CTGCTAAAGC
   76081  AGGATTGAAA AATCCACTGC CTTACACCAA GGAGAATGCA GCTAAAGGAA AAGCATTATA
   76141  TGATATTTAC TGTGCTATTT GTCATGGTGG TAAAGGAAAC GGAAAAGGAA CTTTAGTAAA
   76201  AAGAGAAAAA ATATTGGGGG TACCTAGTTA TGATGACCCA GGACGTAATA TAACTGCTGG
   76261  TAGTATATAT CATGTAATGT ATTATGGTAT CAACTCTATG GGGTCATATG CTGCTCAAAC
   76321  AAGCATTGAA GAGCGTTGGC AAATTGCTCA GTATGTGGAG TCTTTAAAAG CTTCATTAGA
   76381  GGGTAAAAAA CCAAGAATAG ATAAAGTTTC TGGTAGTAAA TCAGATGTTT CAATAGTTGA
   76441  CGCTTTATTA GCTAATACAG AAGGATATTA TAGTTCCGAT GTAGAGTTTG AAGGTGAATT
   76501  TGATGAGCAT TCAGAGATTA AAGAAGATGT AAAAGATAAA GTTTCTTATA GTAAGAAAGA
   76561  TCTATTGGGA GGTAAATCAC ATCATTCACA CAAAGAAGCT GGTAAAAAAT AATTAAGCAC
   76621  GATTAACGAT TTTTTTAAGA TATGTATACG TTATCAAAAA ATTTAAAATT AATTCCTATC
   76681  ATATTGATGG TTGTAGGAGC TATTGGGTTA GCTATAGGTT TTACTACTAC ACCTAGTACA
   76741  ATAGAGGAAG TAAAAGAGCA ATTAGCAAGT CATCATGATG CTCATGGAGC AGCTCATGCA
   76801  CCTGCAGCAG CTCACGGAGC TCATGACAAA GCAGAACATG GGCATGGTCA CGACACTCAT
   76861  AAAGCAGCAG ATACGCATGG TGCACACGCT GCTAAATCTC ATGATGCGCA TGATAGCGAT
   76921  AAACATTATG AACATGTATT GCATCAATTA CAGAATAAGC CTTGGGCTGC ATTATATGTA
   76981  GCAGCTTTCT TTTTCTTTAT GATTGCATTA GGGGTATTAG CATTTTATGC GATTCAATTT
   77041  GCTGCCCAAG CTGGTTGGTC ACCATTGTTA TTAAGAGTAA TGGAAGGTAT TACTGCTTAC
   77101  TTATTACCTG GAGGGATTAT ACTATTTGTG ATTCTAGCAT TGTCTGGTTT CCATATGAAT
   77161  CACTTGTTTG TTTGGATGGA TCCAGAAGTT GTTGCTCATG ATGAGCTAAT ACAAGGGAAA
   77221  TCGGGATGGT TAAATGTACC TTTCTTTTTA ATTAGAGCAG CTATTTACAT TGGAGTGTGG
   77281  AGTTTATATC GTCACTTTGC AGTAAAGTAT TCTCGTAATC AAGATGAAAG TCCAGAAGGG
   77341  AATGTATGGT ACAAAAAGAG TTTTAAATTA GCAGCCGTAT TTTTGGTATT CTTTATTTAT
   77401  TCAGAATCAA TGATGTCATG GGATTGGATT ATGAGTTTTG ATCCTCACTG GTTTAGTACA
   77461  TTGTTTGGAT GGTATGTGTT TGCAAGTTTA TTTGTAAGTG GAATTACTGT AATTGCATTA
   77521  GTTACTATTT ATTTGAAATC TAAAGGATAT TTAGAGCAGG TAAATGATAG TCATATTCAC
   77581  GATTTAGCTA AATTCATGTT TGGTATTAGT GTATTTTGGA CGTATTTATG GTTTTCTCAA
   77641  TTTATGTTAA TATGGTACTC AAACATACCT GAAGAGGTAA CGTATTTTAT AACACGTATA
   77701  AATGACTTTA AATTACCATT CTTTGGTATG TTAATAATGA ATTTCTTATT CCCAATATTA
   77761  TTATTAATCA ATTCAGATTA CAAAAGAATC AATTGGTTAG TAGTTATGGG AGGAATTGTA
   77821  ATATTATTAG GTCACTATAT TGATGTGTTT AATATGGTAA TGCCTGCTAC AGTTGGTAAA
   77881  TCATGGTTTA TTGGAATTTC TGAAATAAGT GCAGTATTAT TATTTTTAGG AATTTTCATT
   77941  TACGTTGTGT TTAATGCACT AACAAAAGCA CCATTAGTAC CTAAAGGGAA TCCATTACTT
   78001  GAAGAGAGTA AACATTTCCA TTATTAATAG AATTTAGACA TTAAATTAAG ATAGATTACA
   78061  ATGACGATTT TTTTAATCTT ACTAGTAGTA GCCCTTTTGG GTATCACTTT TTGGCAACTT
   78121  TCTAAAATAT TAGAATTGTC TCAAGGATCA GCCGATAATT CACAAGTGGC TAATGATAAA
   78181  GACAATTCCA TGCAAGGAAA GCTCATGCTT GCATTTGTAG GTTTTTTATA TTTTTTGACA
   78241  GTTTGGTGTT TTGTAAAGTA CGATAGTTAT TTTTTACCTG AAGCTGCCTC TGAGCACGGA
   78301  ACAGATTATG ATAGATTAAT GATGATCTCG GTAGTGTTGA TCATGTTTGT TCAAATCATT
   78361  ACACAAGGTT TATTACACTT TTTTGCTTAT AAATACCGTG GAAAAAAAGA AAATAAAGCT
   78421  ACCTTTTTTG CAGATAGTAA TTTACTTGAG ATTATTTGGA CAGCTATTCC AATTGTTACA
   78481  TTAGCAGCAT TAATTATCTA CGGATTGTAT ACATGGGTAG ATATTATGAG TATTGATGAT
   78541  GATGAAGATG CTTTAGTAGT TGAATTATAT GCTTATCAGT TTGACTGGAG AGCACGTTAT
   78601  GCTGGAGCGG ATAATGAATT GGGAAAAGCA AATGTCCGTT TTATTGAGGG CGTAAATATT
   78661  TTAGGTGTAG ATGCTTCTGA TAACTATGCT CAAGATGATA TTATTGTTAA TGAATTGCAT
   78721  TTACCAGTAG GTAAAAAAGT GATTTTTAAG ATGAGATCTC AGGATGTATT GCATTCAGCT
   78781  TACATGCCTT TCTTTAGAGC ACAAATGAAT GTGGTACCAG GAATGATTAC TGAGTTTTCA
   78841  TATACGCCTA CAAAAACTAC TGAAGAAATG AGAACTTCTG AGTTTATGGT AGAAAAAGTT
   78901  GAAACAATTA ATACAATCAG AAAAGCTAAG AGTAAAGATT TGTTAGCTAA AGGTGAAGAA
   78961  GCATTAGAGC CTTATGAATT TGATTACTAT TTATTGTGTA ATAAAATTTG TGGAGCATCG
   79021  CACTTTAATA TGCAAATGAA GATTATCGTT GAATCTGAAG AAGATTATAA TAATTGGATA
   79081  GCAGAACAAA AAACATTCAG ACAAGTAGTT TCTAAATAAA CATAGGAGCA ATTTAACAAG
   79141  AGAAGTATAA TTTTATAATT TGTTCGATAT ATAGTATCAA TAATTTATAA GATATTTATA
   79201  ATAGAAAACA TACAAAAGGT TTTAAATTAT GTCAGCAGAC GGACACGGAC ATCACAAAGA
   79261  AACATTCATC ACTAAGTATA TTTTTAGTGA AGACCATAAA ATGATTTCAA AGCAGTATTT
   79321  AATTACTGGT TTGCTTATGG GTATTATAGG TATTGCAATG TCGATATTAT TCAGAATGCA
   79381  AATTGCATGG CCTGAACAAT CTTTTGCAAT TTTTGAGGTA TTGTTAGGGA AATGGGCTCC
   79441  TGATGGAGTG ATGGATCCTA ATGTATATTT AGCTTTAGTA ACAATTCATG GTACCATTAT
   79501  GGTATTCTTT GTACTTACAG CAGGATTGAG TGGTACATTT AGTAACCTAT TAATTCCATT
   79561  GCAAATTGGA GCACGTGATA TGGCTTCAGG TTTTTTAAAC ATGGTGTCTT ATTGGTTATT
   79621  CTTTTTGAGT AGCATTATCA TGGTCTTTTC TTTATTTGTA GAGGCTGGGC CAGCAGCTGC
   79681  AGGTTGGACA ATATATCCTC CATTAAGTGC TTTACCACAA GCAATGCCAG GATCTGGAAT
   79741  GGGAATGACA TTATGGTTAG TGTCTATGGC AATATTTATT GCTTCTTCAT TATTAGGATC
   79801  TTTAAATTAT GTAGTAACTG TAATTAATTT ACGTACAAAA GGAATGTCAA TGACGCGTAT
   79861  GCCTTTAACA ATTTGGGCAT TCTTTGTTAC TGCAATTATC GGTATTGTTT CTTTCCCAGT
   79921  ATTATTATCG GCAGCATTGT TATTAATTAT GGATAGAGGT TTTGGTACTT CATTCTATTT
   79981  AAGTGATATT TTTATTAAAG GTGAAGTGTT ACATAATCAA GGGGGGTCAC CAGTATTGTT
   80041  TGAACACTTA TTTTGGTTCT TAGGTCACCC TGAAGTATAC ATTGTATTAT TACCAGCTTT
   80101  AGGTATAACT TCTGAAATTA TTGCGACAAA TTCTCGTAAA CCAATTTTTG GTTACCGTGC
   80161  CATGGTAGGA TCAATCATTG CGATTGCTTT CTTATCTACA ATTGTATGGG GTCATCATAT
   80221  GTTTGTATCT GGAATGAATC CATTCCTAGG ATCGGTATTT ACATTTACAA CATTATTAAT
   80281  TGCAATACCA TCTGCTGTAA AATCATTTAA CTATATTACT ACATTATGGA AAGGTAATTT
   80341  ACAGTTTAAT CCAGGTATGT TATTTTCAAT AGGTTTAGTA TCTACATTTA TAACAGGAGG
   80401  TTTAACAGGA ATTATTTTAG GAGATAGTAC ATTAGATATT AACGTGCATG ATACTTATTT
   80461  TGTAGTTGCA CACTTCCACT TAGTAATGGG GATATCTGCA TTGTATGGTT TATTCGCAGG
   80521  GGTTTACCAT TGGTTCCCAA AAATGTACGG TCGTATGATG AATAAGAACT TAGGATATGT
   80581  ACACTTTTGG GTAACGGCTA TAGGTGCTTA TGGAGTTTTC TTTCCAATGC ATTTTGTAGG
   80641  AATGGCTGGA TTACCTCGTA GATATTATAC GTATACTAAT TTCCCATACT TTGATGATTT
   80701  AGCTGATACC AATGTTTTGA TTACTGTTTT TGCAATCATA ACTGCAGCAG CTCAATTGGT
   80761  TTTCTTGTAT AACTTTATAT CATCAATTTT TTATGGTAAA AAAGCAACAC AAAACCCATG
   80821  GAAATCAAAT ACCTTAGAAT GGACTACACC AGTTGAGCAT GTACACGGTA ACTGGCCCGG
   80881  TGAACTGCCA ACTGTGTATC GTTGGGCATA TGATTACAGT AAAACAAATG CTGATGGTGA
   80941  GTATGTAATA GCAGGTCAGG ATTATGCGCC TCAAGTAGTT CCTTTACAGG AAAACGAAGA
   81001  AGAATTGCAT CACTAGGATG TACTTATATA TTGAAAGCCC TCTTTTAGAG GGCTTTTTTT
   81061  GTTTTTGTTA ATTCCTTATT TATGAAGTTT ACCTATTTTT ATAATCTACA TTAGATACAG
   81121  TTATTTTGAA TAGTAATTTA GACGCAACGG GAGAGAATTT TACTCCACAA GAACATGATA
   81181  TTGAAAGAGC TTTACGTCCA TTAAGCTTTG GTGACTTTGC GGGACAATCT CAAGTACTCG
   81241  AAAACTTAGA GATATTTGTA AAAGCCGCTA ATATGAGAGG GGAGTCTTTG GATCATACGT
   81301  TGTTTCATGG ACCTCCAGGA TTAGGAAAAA CAACACTTGC TCATATATTG GCAAATGAGC
   81361  TTGGAGTGGG CATTAAAATT ACTTCGGGTC CTGTATTGGA TAAACCGGGT GATTTGGCAG
   81421  GATTGTTAAC TAATTTAGAG CCCAGAGATG TGTTATTTAT TGATGAGATT CATCGTTTAA
   81481  GTCCCGTAGT AGAAGAGTAT CTTTATTCGG CAATGGAGGA TTTTAAGATT GATATCATGA
   81541  TAGAAAGTGG CCCTAATGCT AGAACAGTTC AAATTCATTT AGATGAGTTT ACTTTAATTG
   81601  GTGCTACTAC ACGTTCCGGG TTGTTAACTT CTCCTATGAG AGCACGTTTT GGAATTCAGT
   81661  CCAGATTACA GTATTATACT ACTGAATTAT TGGCAGGAAT TGTAGAACGA AGTGCTTCGA
   81721  TATTAAATGT ACCTATTGAT GAACGAGCTG CATTCGAAAT TGCAGGTCGT AGTAGAGGAA
   81781  CACCTAGGAT AGCTAATGCA TTATTGCGTA GGGTACGTGA TTTTGCCCAA ATTAAAGGGA
   81841  ATGGATCTAT TGATATTGAA ATATCTAGAT TTGCGCTTAA AGCGCTTAAT GTAGATGCTC
   81901  ATGGTTTGGA TGAAATGGAT AATAAGATTT TAACCACACT TATTGATAAG TTTAAAGGTG
   81961  GACCTGTTGG AATCACTACA CTGGCTACCG CAGTTAGTGA AAGTGCCGAA ACTATTGAAG
   82021  AGGTTTATGA GCCTTTTCTA ATTCAGCAAG GTTTTATTAT GCGTACACCT CGTGGAAGGG
   82081  AAGTAACGGA ATTAGCCTAT ACACATTTAG GAAAGACAAG AGGTTCTGTT CAAGGGGGCT
   82141  TGTTTTAACT AGTATGTTTA AAGCATTAAA AGTAGGGTGT AAAAGTAAGA CACCCTATTT
   82201  TTAATGCTTT AAACTAGTTT TAAAGTTTAA TTAGCTGAGT AGTAAATAGA CCTTTATTAG
   82261  TTTGAATTTT TACAAAATAA GTATTAGGAA ATAAATAGCT TATGTTCATT GTGCGCATAA
   82321  TTCCCGGGAA AAATCCTACT ATATTACCAT TAATATCATA TAGGGTAATT GTAGTAGGTT
   82381  TTATATTTGT ATCCAATAAC TCAAGGTTTA TTATGCCTGT TGTGGGATTA GGAGTTAAAG
   82441  AAAAGTAATC GGAAAATGTA GGGACTTCAA TAACTTCTCT TTTCACTGTT ACAATTTCAT
   82501  CTTCGGTGAT TACAGGAGGA TTAAAATCAA AATAAATACC AGCCCCATTA ACAATTTGAT
   82561  CACCTTCAAC TAAGTTATCT TTTGATTTAA TTTTAAATAG CACATAACCA TCATTATTAG
   82621  CATCATCAAA AGGGAGGTTA ATATTGTTGA AATGGAAATT TACAACCTTA TTATTAGTCA
   82681  CAGTAGTAGT AAATAAATGA CTAGAATTTA AAGGGCTAAA AGATTTAATG TCAAGTTTTG
   82741  TGGTATCAAT ATCATCCTGA ACTCTAATGT TAACCGCTTC AGCTGTTCCT TTGTTTTCAA
   82801  AACGAATTAA ATAATGTAAA TACTCACCTA CATCATCAGG GTCTAATATG TCCCCTTCAA
   82861  GACAAGTTTT ATCATTAGGA TCGTATGAGT TAACAACAGT TTGAGTTAGT TTAGCGATGT
   82921  TATTTTCTGG AGTTTCTTCA TCTAGAGATG CTGTTACTTT AGCTGTATAA TTGAGTATAT
   82981  CTCCATTGTT TAAAGCAGGA CTATCAGTAG GAGTGTTTAA CCTATAAGTA ACAATAATAT
   83041  CTTTGGATTG CATAGGAGCA AGGTTTGTGA AACTCCAAGT TAATAAGCCA TTAGTATTAC
   83101  TATCTATTGT TGGGCTTGCT GTTGAGTAGG TTAACACGTC ATTTTGATAT GTCAAAGTTA
   83161  CCTCTCCCGA CTGAGTTGTT GTACCAATAT TTTTATAAGT TACTTTGTAT ATGGCACTAA
   83221  AACCAGGTCT AGCTCTTGTA AGTGGAATAA TAGAAATTTC AAGGTCATTA AAAACACCTA
   83281  CAGGTTGAAT ACAAAAATCA GTAGTAATAG AATCAATTTG TTCAGGAATA TTGAAAGAAT
   83341  CATTTATTGG ATCAAAAATG ATAGTAGGAA AAAAAGTAAA ATAAGCCGAA TTAGCTATGT
   83401  TGTTAAACAT TAAATAATTA TTTCCATCAG GGACGTGAAA AGTGTATTCT CCTTCTCTAT
   83461  CAGGGAAAAC AGTATAAAAG CCTGCTGGTC CAGCCAATGA AAAGCTAACA CTTTCGGTAA
   83521  AAGCTTCATC TTGGTTATCA CAGCCATCAC TTTCATTATC GTAAGTGACA CTACCAGAAA
   83581  TTCTATTGTG AGGGGTTTCA CAATCGTTTG ATAATAACAC ATCAGTTTGA TTAGCTTCTT
   83641  TTAAGAGCTC ATATATAGCG CTTAAATATT GTTGATCAGC ACAAATGAAT TCTAAGTTTT
   83701  GTCGATTATT ATATAGTCTG ATATTAATTT CACCATTTGC TCTAAATTGA AAAGGTTGTC
   83761  CTGTCATATA AACTTTTTTT AAGTTTCTGT TAGAGTCAAA ATGAAAATTC AGAAGTTGGC
   83821  ATTTGCGTAC ATCAATTGTT TCTAATAAGT TACTATTTAA ATGTAAGTAC TGAATTTTAG
   83881  TGTTTTCTGA AAGATTAATA GTATTTATTT TGTTGTTATT AAGATATAAA TAAATTAGTT
   83941  CTTTGTTATT AGTAACATTA ATAGTTGATA TTTGGTTTTG TCCCGCAGAT ATAAGTTCTA
   84001  ATAAAGTATT GTTGTTTACG TTTAGTTCTG TTATTTGGTT GATTCCAATA TTTAATCGCT
   84061  CTAACTTTGG ATTGTTTGTA ATGTTAATGT TAGTCAATTG ATTATTTCTA ACATATAGTG
   84121  TTTTTAGTTC TGGATTCTGT GAAACATCTA ATTCAGTAAT AATATTATTG CTTAAAAATA
   84181  AACTTTCGAG TTTTGAATTA TTTGATACAT CTATTTGAGA AAAATTATTA CTAAATAACG
   84241  ATAGATTTTT CAATAAGATG TTTTTAGATA AATTTATAAC ACTCAAATTG GCTTCGTGTG
   84301  CAGCCAGTTC TTCTAATTTT ACATTTTTAG TAATATCAAT AGAAGAAATT TGGGTTATAG
   84361  AAATAATTAA TTCTTTTAAA TTAATATTTT GGCTAACATC TAAGTTGGTA ATAGGGTTTT
   84421  TACCTATATT AAATTTTTGT AATAGTTTAT TGTTCGAAAT ATCAATTTCT TGAATATTAT
   84481  TACTAAACAG AGAGAGTTCT TCTAACTTAG TAAAGTTCTC TATTCCTTTA ACGCTAGTTA
   84541  AGTTTTTTAG ATTTAAATTG ATTCTTTTTA TATAGCTAGC TTCTTGCGAG TCAATTTGTC
   84601  CATCATTATT CCTATCTAAT GAATACCATG TACCATTATC ATTATAGGTG ATTTCTAATA
   84661  GCGCAGCTTT AAAGTTAGGA TCAGGGAAAT CAATAATTTG TGCATTTCCG GTAGTAAATA
   84721  AGCATACTGT CATGCTCAAA AATAAAAGTA AATTTTTCAT AAGAATTTAG TTATTAAAAT
   84781  AGATTTAAGT TTAAGTGAAG ATACCTTTGA TTTGTAAATG TTTAGTTATC AATATGTTAA
   84841  ATGTTGTTGT GTTGAGTTAC AAAGATTTGT TAATTCAAGG TTTGAATGAA TTTAGAGTAG
   84901  AGAAAAAATG ATGGTTATGG TGTTATATAG GAAAGCAAAT TAAAGAAAAA CAAAAGTTAG
   84961  ATTGTTTTAT ATCAAAATAG AGTGGAGTTA GTTTAGAATA GTAAAAGGAA ATTACATATG
   85021  TAAATTGATT TTAATGTGGA TAGGCTTAGA TGTGTTAATA TTTTATTGAA AAACTAGTTT
   85081  TTGATTAGGT GAGTTTGTTG TAAAATTTAA AACATTTACT AGATATTTAT CATTTTGTAT
   85141  AGAGCTTAAA AAGCAGAATT TATATTTATT CTTTTGTAAA GAAATATTTC CTGAACCATA
   85201  TAACAAGTAC AAAAAAATAG GAACTATAAC ATACTAAATA CCCAATGGCA GCACCTTCGT
   85261  ATCCGTAATT GTTTATAAAA TAAATACTAG AAAAATACCA TATTACCGCA GATAATATTT
   85321  CGGTAAAAAC GTAACTTTTC GTCATTTTTT TTGCCATAAA TTGATAAGCA AGTACCGAGG
   85381  ATAAAATTCT AAAAAAATCA CCTGTTAATT GCCAAGAAAA TAACCGTTGC ATAGGTAAAA
   85441  ATTCTGATGT CAATAGGAGC TTAATAAAAA AGACTCTAAA GAAATAGAGT ATAAGCAGTC
   85501  CTATAATTAC TAGTGGCATT AATGTTTTAT AAAAGCTAAA AATTTCTTGT TTAAATTGTT
   85561  TTGTAGTTTT TACAGCCGAT AGTTTAGGAA ATAAATATAA ACTGAGTAAT GAAGTAACAA
   85621  ATACTAAATA ATAATTAGAA ATTCGATTCA TAGCTTCCCA ATAACCCATT TGGGTTAAGC
   85681  CTTCAACATC TACAATATGA TTTCTGATAG CAATAATAGT TGGAGGAATA ATAACAGCGG
   85741  TTAACAATGC CATTAAACTG TATTCTATTA GCTTTTTAGA GTAGTCCCAA CTTATATTAG
   85801  ATGCTTTTAA AAGTTGTACG AAGCTTTTTT GCTTAAATAT GATGATCAAA GTAATAAATA
   85861  ATGCAAGGGC AGGGGTGATT ACTATAGCAT AAAGCATTCC CTCTAGTCTG TATTGCCATA
   85921  GTAAAATAAC AGTTACAATT AGACTAAAAA CTGTCGTTGT AATATTGAGT ATGGTATATA
   85981  CTTTATAACG GGAAAAACCA TTTATAATAG CCAAACAAAA ATAGTCGACA ATCATTAATG
   86041  AAATTCCTGC AGCTAATATT TTGATAACAT GTGCATAATC CGAAGAATTT AATACATAAC
   86101  TACTCCAAAA TGGCGCAAAA AAATATAAAA TCATAGATGT GCCTAACATG GCTATAAAGC
   86161  CTAAATAATA GCTAGTAGAT AAGATTTTAC TTAATTCTTT GATATTATTT TTATGTTCTG
   86221  CAACATATTT AACAACGCCG TTATAAAAAC CTAATGAAGC GATGGTTTGA ATACTATTTA
   86281  TAAAACTACG AAGGTTACCA ATAATGCCTA AACCTTGTGG TCCTATAAAA ATAGCAATAG
   86341  CTTTTGATAA AATAAAGCCT GTAACTAAAC GGACAAGAAC GGCAATCGAA TTGATTGACA
   86401  TTACTTTTAG TAATTGTTTA TTAGGAGTGT AATTTTTTAT TCCTGGCATG TATAATTGTT
   86461  TAATACCTGA ATAATATAAT CAATTTCTGA CACCTCTAAA ATTGGATTTA GTGGAATGCT
   86521  AACTATTTCG TTACTTATTT TTTCGGTTAT GGGAAATGAT TGATTTTTAA ATTCATTTGT
   86581  AAGTGCCTTT TGTTTATGAG GAGGAATTGG GTAATGAATC ATATGACCTA TTTGGTTTTC
   86641  ATTTAAATAG TTGCAAAAAT TAATTCTATT TTTTACCCTT ATAACATAAA CATAAAAAAC
   86701  ATGATTTTTA CTACCATTCC AAAATGGCAA TTTTATGTTT TCATTTGTTA TTTCATTTGA
   86761  ATATCTAAGG GCAATTTCTC TACGTTTGTT ATTGTCATCA TCTAATAAAT TTAATTTTTC
   86821  AATTAAAAAG GCAGCCTGAA GTTCATCCAA ACGAGAATTG ATCCCGATTA ATTCATTTCT
   86881  ATATTTTTCC GATGTACCGT AGTTCCTTAA TTTTTTTATA CAATTAGCTA ATTCGGTGTT
   86941  ATTGGTAGTA ATAGCGCCAC CATCACCTAA AGCACCAAGG TTTTTTGAAG GATAAAAGCT
   87001  AAAAGCAGCT GCATGAGCAA TGCTTCCCGC TTTATTTCCA TTTTGATCAA TAGCTCCGTG
   87061  TGCTTGAGCG GCATCGGCAA TTAAAAGTAA TTGCGCATTT GAGCAAAATT CTTTCAATTC
   87121  ATCCATTCCA TAAACTTGAC CGTACAAATG GGTTGTAATT ATTGCCTTAA TTTTAGGGGT
   87181  GATTTTTTGT TGCACATTCC TCACATTAAT AATAAAAGAG TCTTCATCTG GTTCAATTAA
   87241  AACAGGAATG AGTCCCGCTT GTTTTACAGA AAGTAGGGTT GCAATAAATG TGTTTGCGGG
   87301  TACAATTACT TGATCACCTA TATTTAATTT CCCTAGTTCG ATATAAGCTT TTAATATGAG
   87361  CGTAAGTGCG TCTAATCCAT TGCCCGTACC AATACAGAAA GAAACATTAC AATAACTAGC
   87421  AAAAGCATTT TCAAATTCAG TTAGTTTAGT GCCTAAAATA TAATGTCCAC TAGTTAAGAA
   87481  TGTATCAAAT TGTGATTTGA AATTGTTTTC AAATCGTTTG TTGAGTTTGT GTAGATTTAA
   87541  AAAAGGTATT CTCATTTAGT AAATGAATAA AGAAATTATC AACTATTTTT TGAATAGTTT
   87601  TTTTTCAATT ATTTGATGTG AAAATTCAGA TATTTTATGT TCAAAATGTG TACTATCAAT
   87661  AATTACTTTA AATTCAGAAC TAGGGCTTAA CTTTTTAACT TTTTCTTCAA CAAAAGAAGC
   87721  ATAGCTTTTA TACATATAGC CTGAGCAGCA TTTCGGGTCG TATAAATTCA AAATTTGATA
   87781  CTGTTTTCTG TTTTCTCCTA GACACGATAA AATATACATA TCTAGATAAT TTACTTTTTT
   87841  AAATAAAGCG CTATGGGCTC CTTCGAAATG GCCATAATTT AAATAAGGAT CTTGAAATCG
   87901  AATATACATT GGATAAGTTC CAGCAACGGG AAAACTATTT TTTATTCGTT CATCTATTGC
   87961  GGCAGCTATG GTAGTTGCCC ATCCTCCTCC ACTAATACCA ATCATATTAA TCTCATTGTA
   88021  CCCTTTTGAT TCAAGTATAT CTAAAATGTT AATAATCGGA TTGATAAAAA AACTAATAGG
   88081  ATCATCTAGA TGTTCCATAA ATTTGTGGTT ATTTAAAACT ACATTACCAA ATTTTTTTAA
   88141  ATAAATGCTG GGAGTATTAT TAAAGCCTAC CAAAGGTAAA TCAAGTGCTG CTACTGTGAA
   88201  ACCTTGTTTA ACTAAAAAAT GAATAGTTTT TTTTCCTAAC AAAAAATTTC CTCTATGACC
   88261  TTGATGATAG ATAAAAGATT TGCCATTACT TTTTTTTGGA TAAAAAATAT AAGCTATTGA
   88321  ATTTATATGA TATGATTGTT CAATATAGAC TTTATCAATG TTTGCTAAAT TTTCTAAATT
   88381  ATTATAATCT TTGTCAAAAA TGTTTTTTTT GATCTTATAT GATGAAGTTT TATTACCAAA
   88441  AATAGTTTTT CTTAGTTCAG CTCTTATTTC GGTATAATTA TCTTTTGTAA CGGATAATAT
   88501  ACTATCTAAG TTTGGAACGT GTAAGTCTGT AACATCGTAT GCATTTTTTT TTAGAATTTT
   88561  TAATTTAATA TTCTGATTTA TATTTCTTAA TTGGTTGTAA GGAAATAATT TATATTGAGT
   88621  GATGATCATA CCTAAAAAAA TAGATATAGG CACAATTAAA GATATATGTA AAATACTAAA
   88681  TTTAAACTTC ATTAGTTTGG TCTATTGAAA GTTGATAAAA ATCTTGAAGA TACTGATTAC
   88741  AACCCAATTC TTCTTTTTGT TTTAATAAGC TTATATTTCC AGCTATAATA CCCATATCGA
   88801  AAAACTTATA TCCTTCACTT TTATATTTTT TTATTAAATA GATAAAGAGA AATTCTAAAG
   88861  CCCTTAGCTT TTCTCCATCG TTAGTTGTTG CTCCATATTG AGACTTTACA ACGGTATCTG
   88921  TTTTAAAAAT AGTAATTCCA GCTAGTAATT TATTTTCTAA AAAAATATTA AACTGTTTGA
   88981  TGTTATTAGG GAATTTACTT TTTAAAAATA ATATTTCGCT TTCTGTATGA ACAGGTTTAG
   89041  CATTGTGTTT TGTTTTTAGT CTAGGTTTTA AAATTTCCTC CCAAAAGTCA GTAAAATTAT
   89101  CTGTTTCTAT AATCTTAAAA TTTAAGTGTT GATTTTTCTT ATAATTTTTA AGTTTAGTTT
   89161  TATGTATTTC AAATGGCAAG TTATAGTCAA TGGCAAAATT TTGCTCCCTT CTAAAAATTT
   89221  TAGCTCCAAG CTTGAGGAAT AATGATTCTA ATTCAAAACT AGGCGCTTTA TGATAAAATA
   89281  CAGGAAGTGT TTTTATCCGA ATTGTTGAAA ATTGATTCCT TTTCAAATAT TCTATAATAG
   89341  TCAAAAAAAT AGTTTCAACT TTTGTTACAC CAATACTTTT TAAAAGTAGT AATCCTCCAT
   89401  AAGTAAGCCC TTGGTGGGAA TAGAAAGTAG TATCATTTTT ATTCGCAGGA ACTAAAGCAA
   89461  CAATAGTTTG TTTTCTTAAT ACAAGTAAAG AATGATCTTC AAAACGATCA TTATGATACT
   89521  CCATAAAATC TCGATGGAAT AAAAAAGTGC TGTTTTTACT ATTTTCAATA AAAGTATTCC
   89581  AGCTTTGATA ATGTGTTTTA TTGTATTTTT TTACGGTATA TTGTTGAATC ATTTTTTGGA
   89641  ATAAATAATT TTAGATATTC TTTACGAGAA TAGTATTTTT TAATATAAAA TAATCTAATG
   89701  CATAACTATA TTATATATAA TTTAGCCAAT ATAGAAAAAT ATTAGTACGA TTTACCGTTG
   89761  ATATGAGCAG AATTATCACA GTAAATTTTT ACTGTGATAA ATTAAAATTT GATAAGGCTG
   89821  CTCCATGTTT AAAGTTATGA TTAAAAAAAT TACATTCCTT TTTTATATAC TCTTTTTTAT
   89881  TTTTAATGTT GTTGTAGTTA TTGACAAAGG TTATGTGTTT ACTTATGATA CTGCTAGTTA
   89941  TTTGTATATC CGTCCCAATG TACAGCCTGC GTACTCCATT TTTCTAAATA TAGTGAAGCG
   90001  TATATTTGGA ATAAATTATA AGGAAGCAAC TATTGGTATT CAATTGCTGA TGTCTTATTT
   90061  GACAATGCTA TACTTTAGTG AGGTGTTAAA AAAATATTTT AAGTTTAATT CAGTAGTTAT
   90121  GATTTTATTA TTCATGCTTT TAACATACCC TATTTATGGT TCGTATGGCA TGTGTAATAA
   90181  GTTGGTCACT AAATCATTGT CAACTACTTT TTTTCTTTTT TTTATGGCTT CTTCTGTAAA
   90241  ATGGTTTTTT ACAAAGAAGA ACAAGCATAT TTTTTTTATG ATTACTTTTT TAGTTCTTTT
   90301  ACAATTAACA AGGGCGCAAT TTTTAAGTAT TTCAATAGCA TTGGTTTTGT TTGTCTTTTA
   90361  CATGTGGAGT TTAAAAGAAC TTAAAAAAAA GATGATTTTA GTTGTCTTAA TATTGAGTAT
   90421  TCCTCTTATT TCAGGTTTAT TAGAAAAGAC AATTTATGGA GTGTTTCATG GGCATTACAC
   90481  TTCTAGGCAG TTAGGTAATG TGAGTATAAG TACATTGCCT TTTTATTTGT CTGAATTACA
   90541  GGATTATAAA TTGATGCCTG ATGAAGAGGT AGTACAATAT TTTAGATGTG TACATGGCTC
   90601  TTTAGAAGAA AAGAAATTAT TATTATGTCA ATTACCCAAA AATTCCTCTT TAAAAGAAAA
   90661  GCACCAATTT TATCATGATA ATTATCCTAA AATAATGAAT CAAACCATAG AGTATGAGGC
   90721  CAAGTCTATG TACAGAGGTA AAGAGATGAG TTATGCAGCA TCCTATAAAA ATGTTGATAG
   90781  AATTGTAGGA AAAACTCTTA TCCCATTATT TATGGCTAGG CCTTTAGCAT GGAGTGAAAT
   90841  GTTTTATATG AATTTAGCGT TCCCTTATTA TTCAATTATC CCCGTTATTT TTCTTATTCT
   90901  ATTGGTGAGC TATCTTTTTT TTAAAAAGAA GTCTAAAATA TTACAATTCC AAGGATTAAT
   90961  ATATTTCTTT TCATTATTGA TTCTAGGTAA TTTATTTCTT ATTAGCATAT CGTTGCATTG
   91021  TATACGAAGG TATTTTATGT ATTACGATAT TGTATTTGCT CTTTTGGCTT TATTGCTATT
   91081  ATGTAATTTT AGACCCATCA AAAAATATAT TATGCAGGTA TAGTAATTAA AAAAAATGAA
   91141  AAAAGAGGTT CGAACAATTG TTCGAACCTC TTTTTTGTGA ATGTATAAAT TGTAGTTTAT
   91201  ATTTTTTCTA AAGTAACAAT AATTTGTCCT TTTGGGTTAG TAGTTGTAAA TCCATTTAAA
   91261  TCAAAACCTT CTTCTATTAT CGAAATAAAG CTAGTTTGTG CGATGTCTAG TTTATACTGA
   91321  ATTTCGTTTT TAGTAAATTT AATGATTTCA GCTTTTGAGC CAGCTATAAC GGAATCCCCT
   91381  TCGCTAATAG ACCAATCGTT TAGTGTCGAA GTGCCCCCTA AAATTTTGCT TGATTCAAAC
   91441  GTATCTTCGC GAGTTGTAGG CTGGTTTATC ATTAAAGGTG TTACAAAGTT TGTATTTGCT
   91501  TTAAAAGTAC CATCAAATGT TACTTTATTA GGAGTAGTTT CAAATAAAGC AGTGGTGTTA
   91561  AATTCAGAAC CTTCAGTGGT AAAAGGAATT TCTATAGTTG TTTCGTCAAC TTTTAAGTCG
   91621  ACAGTACCAT TACTAACTTC AAAATTTGTA AGTTTCCATT TTCCAACTAG GTTTTCATCA
   91681  ACTAGGTCTA TTACGGGTTT AATTGGTGCT CCGGCATCAT CCCCAGAGCA AGAAACTATA
   91741  AATAGGGTAA CTAGGGTTAA TAAAGAGCTA AAAAAAAGAT TTTTCATAAG TTAAAGTTTA
   91801  GGAAAGTAAA AAGGTATCAT ATTCTATGAA TATAACACCT TTTTATTGTT TTTATTATTT
   91861  TTTAAATGAA TTAAGCTATT TTGTTGCGCT TACGTTCATT TTCTGTTAAA TATATTTTTC
   91921  TTAATCTTAG GTAATTAGGT GTTACTTCAA CATATTCATC TTTCTGTATA AATTCTAAAG
   91981  CTTCTTCTAA AGAGAATTTA ATTGCAGGAA CAATTTTAGC TTTGTCATCT GCTCCAGAAG
   92041  AACGGACATT AGATAATTTT TTTGTTTTTG TAATATTTAC AGTCATATCA TCACCTCGAG
   92101  AATTTTCTCC AATAACTTGA CCTTCGTAAA TATCTTCACC TGGATCAACA AAGAAACGAC
   92161  CTCTGTCCTG TAATTTATCA ATAGAATAAG GAATTGCTTT TCCTAATTCC ATAGAAACTA
   92221  ATGATCCGTT TTGACGTTCT GGAATACCGC CTCGCATTGG TTGGTATTCA GTAAATCTAT
   92281  GTGCCATAAT AGCTTCTCCG GCAGTGGCAG TTAATAATTG ATTACGCAAA CCAATAATAC
   92341  CTCTTGAAGG AATAATAAAT TCACAAATCA TACGGTCACC TTTAGTTTCC ATACTAAGGA
   92401  GTTCTCCTTT TCTAAGCGTA ACCATTTCAA CAGCTTTACC TGATACGTTT TCTGGTAAGT
   92461  CAATAGTTAA CTCCTCAACA GGTTCGCATT TAACACCATC AATTTCCTTA ATGATTACTT
   92521  GTGGCTGACC TATTTGTAGT TCGTAACCTT CTCTACGCAT AGTTTCTATA AGTACAGAAA
   92581  GGTGTAATAC TCCACGTCCG AAAACTAAAA ATTTATCGGC ACTATCGGTT TCATTTACAC
   92641  GTAAAGCAAG ATTTTTTTCA AGCTCTTTTG TTAAACGATC TTTAATATGG CGTGATGTTA
   92701  CAAATTTTCC ATCTTTTCCA AAGAAGGGAG AGTCATTAAT GGTAAATAAC ATACTCATAG
   92761  TTGGTTCATC AATGGCAATA GTTTTTAAAG CCTCAGGGTT TTCTATGTCA GCAACGGTAT
   92821  CACCAATATC AAAACCTTCT AAACCTACTA ATGCGCAAAT ATCACCTACT TGAACCTCAG
   92881  AAACTTTTTT ACGGCCTAAA CCTTCAAAAC TATGAAGTTC TTTAATTTTT GATTTTAAAA
   92941  TAGAACCATC CCTTTTTACT AAAGATACTT GCTGTCCTTC AACTAAGCTA CCTCTTTGTA
   93001  AACGTCCAAT AGCTATACGA CCAGTAAACG AAGAGAAGTC TAATGAAGTA ATAAGCAATT
   93061  GAGTGGTCCC TTCATCAAAT TTTGGTGCAG GAATATGTTC CAAAACCATA TCTAATAATG
   93121  GTTCTATGTT TTCAGTTTGG TTTTTCCAAT CGGTACTCAT CCAATTGTTT TTAGCAGAAC
   93181  CATAAACCGT TGGGAAATCT AATTGCCATT CTTCTGCGCC AAGCTCAAAC ATTAAATCAA
   93241  ATACCTTTTC ATGGACTTCA TCGGGAGTAC AATTTTCCTT GTCCACTTTG TTTACAACTA
   93301  CGCATGGTTT TAAACCAAGA TCAATAGCTT TTTGCAATAC AAAACGAGTC TGAGGCATTG
   93361  GTCCTTCAAA AGCATCAACA AGTAATAAAA CCCCATCGGC CATGTTTAAT ACACGCTCAA
   93421  CTTCACCACC AAAATCGGCG TGACCCGGAG TGTCGATAAT GTTAATTTTT GTTCCTTTAT
   93481  AAGTAACCGA AACGTTTTTA GACGTAATGG TAATACCACG TTCACGTTCT AAATCATTAT
   93541  TGTCAAGAAT TAAATCTCCT GTGTTTTCGT TTTCACGAAA CAATTGACAG TGATACATGA
   93601  TTTTATCAAC CAAGGTGGTT TTTCCGTGGT CAACGTGTGC AATAATGGCT ATGTTTTTAA
   93661  TCGTATTACT CATAAAAGCT AATTTATTGA TACTAAAATT TGGCGCAAAG GTACGTTTAT
   93721  TTGGTTAATT ACTGTGTAGT GAAGTGTTTT TGTTGTCTTC TTCTTTATTT AAATAAGGAT
   93781  TTTACAAATA AGAATAGTAT TTAAATTAAA AAATCTAAAC AATTTTTAGT TGGAAATGAA
   93841  GGGCATTTCT GTAGACTGAT TACCCTGATT TAGGTGAGTG CAGTTGCACA GAATACTGTT
   93901  TTATAATGTT GGTATAGTTT TTTAATTAAA TTACTTTTGT GTAAACTGAA ATAAAATGCA
   93961  ACTAAACAAT ATTCCTAAAA TAAAAAATTT AGATAGTAAT AATTTTTTTT TACTAGCTGG
   94021  TCCATGTGCG ATAGAAGGGG AAGAAATGGC GCTTAGAATT GCTGAAAAAG TAGTTCAAAT
   94081  AACATCGGAT TTAAATATTC CTTATGTGTT TAAAGGCTCT TTTAAAAAAG CAAATCGTAG
   94141  TCGTGTAGAT AGTTTTACCG GAATAGGTGA TGAAAAAGCC TTGAAAATTT TAAGGAAAGT
   94201  ATCAGAAACA TTTGATGTTC CTACAGTGAC AGATATTCAT ACTAATGAGG ATGCTGCTAA
   94261  GGCGGCAGAA TATGTGGATG TGTTGCAAAT TCCTGCTTTT TTAGTGCGTC AAACAGATTT
   94321  AGTGGTAGCA GCAGCAAAAA CTGGAAAAAC GGTAAATCTA AAAAAAGGAC AATTTATGAG
   94381  TCCTGAAGCT ATGCAACATG CGATCAGAAA AGTGCACGAT AGTGGTAATG ATAATGCTAT
   94441  GATTACAGAT CGAGGTACGA TGTTTGGATA TCAGGATATG GTAGTAGATT TTAGAGGGAT
   94501  ACCTACCATG AAACAGTATG GAACTACGGT GTTAGATGTT ACACATTCAT TGCAACAACC
   94561  CAATCAATCA AGTGGAGTAA CTGGAGGAAG GCCAGATATG ATTGAAACCA TTGCTAGAGC
   94621  TGGAATTGCA ACAGGAGTAG ATGGTTTGTT TATCGAAACT CATTTTGACC CTTCAAAAGC
   94681  AAAAAGTGAT GGTGCTAATA TGTTGCACTT AGATTATTTG AAAAATTTAC TAACTAATTT
   94741  AGTGGCTATT AGGCAAACTA TAAATAGTTT GTAAATTGGA GTTAGTCTAA ACTCCATGCT
   94801  TTTAGGTATT TTTTTGCTAC TTCGGTACAT TCGTGATGTT GCTCAATAAA TTTTCGAGCT
   94861  CTTTTCGAAA TAGCTAACAT TTTATCAGGG TTTTCAATAA GCTCTGATAA TTTGTTTACT
   94921  AAATAATCTA CATTAGGCCT AGCTTCAACT AATGGCATGG TTGCTTCAGT GAGGTTGTAA
   94981  TAATTTTTAA AATCCTCATT AGCTCCGCTA ACTACGACTT TCCCTTTAGC CATAGCTTCT
   95041  CTACCATTAT AGCCTTGATC GTAACTCAAA CATTGGTCTA GTAGAATATG GGATTCATTA
   95101  TACACTTTCA TATACTCGTT ATAGGGTAAA TTTCGAGTAA TTTTTACAGT TACTTTGCTT
   95161  GGGTATTTTT GTTTAATAAT ATCAAGCGCA TCTAAAAAAT AGGGAATTCC TTTGGCCAGT
   95221  TGATTAGTAG TATTAATGCC ACAAAAAATA TTGATTTTAT TACTCAAGTC TAAAGCTGTA
   95281  AATTTTAGTT TTGATAGATC AATAGGGGTA GGGATCATGT TTAGGGCCTT AGGAGTGCCT
   95341  TTGTAAACAA TTTCATAATC AATATCGCTT GGTATTATCC CTTTAATATG GTTTAATAAA
   95401  TAATTGAAAT GGTTTACATG ATTTGTTTCA AGATATTTTA AGGCATATTG AAATTCTTTT
   95461  TTTAAGCTCT TATCTTTTAT GTAAGGAGTT AAACTAGAAA AACTTATATG CTTGTTAAGC
   95521  ATATAATCTA CCCATGGAGT TTCCATACTA CCTCCATGTA AATAGATGTT TTTATTATAT
   95581  GCTGTAATAC TATTAAATAA TACTTTTTCA GTTTTAGGAG TTCCTAAAAA AGCGATGCTA
   95641  TTTATAAATT GAATAGCGTC GTACTTTTCA AGTAATGGAA CTGTTTTTTT AAATTGATTT
   95701  CTTAATTCAA GCATTGAAAG ATCAATTTTA AAAAATGTAT AAAACCCATT TTTTATAAAA
   95761  TTTAATAAAC GGTTTTTTTT AAAATATTTG ATGCCTAAAT TAATATCTAC AGGATAATTT
   95821  TTAAATCCAT CTCCATGAGC AATAATAGTA ACTTCGTGAC CTAAATTTGT AAGGCCTTTT
   95881  TTTAATGAAT TATGGAAACC ACTGTATTCT CCAACTAAAA GTATCTTCAT TAATCTTCTT
   95941  TTTTATCAAA ACGGAGTTCT AAAGCAATTC TTGTAACATC GGTATTTTTA TTGATAGCAG
   96001  CACCGTGAAT TAAAAATGGA GAAAAAATTA AAGCTTCATT TTTTTTGGGA TTTGGTCTAA
   96061  ACATTTTGAA AGGACCATTT GTTGTTTTGA TAATACAAGG AACATAGTAT TGATTACCAT
   96121  TTATATATGC CCCCTTAGCT TTGGTGCGAA TAATTTGATC TTCAGGAATA AGGTGGCTTC
   96181  CTTCAATTAC AGGTAGGGAA GAGTGTTCAT TGCAACCTGC AATAGGAATC CAAATATTTA
   96241  AAATATTCTT CCAATAATCA AGGTAGCCAT CTCTATGGGG AGGATTGATG TCTAAGCTAT
   96301  TTGGGCGACT TATTCGTATT TGAATATGAG AGCTTTGTAA TTGTTTAATA TATGGGGTTA
   96361  GTTTTGTATT TGTGTGTTTA CTAAATTTTA AAGCTAATTT TTCAAAATCA AGATCGAAAT
   96421  CTTCATTTCT TAAGTTTTTG GTGTGATTAA TTACCTTTAA ATGATTCTCT TGATTGGTTA
   96481  TATATTTATG GTAATCTCCA ATGTTAAAAT CGTTTTCAGT AACGGTTATA CCTGCTAATT
   96541  TGATCCCTTT TAATATATTT TTTTTAATTG AATTACTTAA TAATTTAAAT TCGATATCAG
   96601  AAAAAGCAGA AATTATTTTA AACCCTTCAG ATTCCCATTC AGTATTTTCT AAAATATTGC
   96661  CTTGAGATTG ATAAAGCACT TCTGGCTTTC CTTTAAAAAA TGATCCAGAA ACATTAAATG
   96721  AAAATGGCTC ATTATCAATT AAAAGAGCGC AAGTGTGTTT TTCTAGTGAA TTATCCAAAA
   96781  TTAAAATAAC TAAGTTGGTT TGTGTTGAAA ATAATAAATT GAAATATTAT TCGATATATT
   96841  AGTGCAAAAT ACTAATAATT TACATTAATG ATATCATCCA AAATGAATAA GCTAAACGTA
   96901  GCAGTCATTG TTATTTCATT ATCAAGAGGT GGAGCAGAGC GTTCAACGGG GACCATTTCT
   96961  AAAATTTTAG AAAATTTAGG TCATTCTGTT ACTTTGATTT CGATTATTGA TGAAAATGAA
   97021  TTTGAGCATG GGGGTGAATA TTACGCTTTA GGGAGTACTA AAAATTATAA AACAGTTTTT
   97081  GGAAGAAAGA TCAGTAAGTT TTTAGATGCT TATCAACTAT TCCAAAAAAT AAATTTTGAT
   97141  GTTGTTATTG ATGGAAGAAC ACGACCACTT TTTTTAAAAG AATTGATTTT TAACAATTTA
   97201  ATATTTAAAA ATATTCCTGT TGTCAGAATT ATGCATAATT CATATTTACC TCAAAGTTTT
   97261  CCAAAATTAA AATGGCAAGC AAGATATTTA TATAAGAATG ATTCTTTAAT TGCTGTTTCT
   97321  AAAAAAGCCC AACAAATTGT GGAGGATACT TATGGCTTTG ATAATGTAAG AACAATTAAC
   97381  TACCCGGTTT CTCAAAAAAA GATAGTTGAA AGTGCTCAAG CCGAATTAAA TATTTTGGAA
   97441  ACCAATTATG TTTTATTTTA TGGAAGATTT GATAACGAAA GTAAAAATCT ACTTTTTTTA
   97501  TTGGAAGCTT ATTCTATGTC TAAATTATCT GAATTGGGGA TACCACTGAT TTTGGTGGGA
   97561  AAAGGGCCAG ATAAACCGAC TATAGAAAAT AAAATAAAGG AACTAAATTT AATTTATCAT
   97621  GTTATATTTA AAAATTACAC ACCTAATCCA ATGCCATATG TTAAAAAGGC ATTATTTACA
   97681  GTAATGACTA GTAATTTTGA AGGTTTTCCG ATGACGTTAA TTGAGTCGCT AACTTTAGGA
   97741  ACACCTGTAG TAACACTAGA TTTCATTTCT GGGCCTTCAG AAATTATAGA AACAGGGGTA
   97801  AATGGTATTT TAGTGACAAC AAAAACAACT AAAGCTTTTA GTTTAGCTTT AAATAAAATG
   97861  GTTGAAGATG TTGAGTTTTA TAATAAATGT GTACAAGGTA CATTTGAAAG CATAAAATAT
   97921  TTTGATAATT TTTATATTGC CAAAAAATGG GAGACTTTAT TAAATGAATT ATGAAAAAGA
   97981  CAAGAATTAA TGATTGTCAC ATTATTGAGC TCGATAAAAT AGAAGGAGAC GATAGTAGAG
   98041  GGAGTCTCTC TGTAATTGAA AAAGATAGTA TTCCTTTTGA ATCGAAGCGG ATCTATTATT
   98101  TATATGATGT TCCAAGTGAT GCTAGGCGTG GTGGACATGC CCACAAAGAA TTGCATCAAT
   98161  TTTTAATTCC AGTTAGTGGT AGTTTTGATA TAATTTTAAA CGACGGAAAA AAAGAGCAAA
   98221  CCTTCACAAT GAATAAGCCT AACAAAGGTT TATATTTATG CCCTGGGATA TGGCGCGAAA
   98281  TTGAAAATTT TTCTTCTGGA GCTGTCTGTT TAGTATTAGC TTCCGAAGTT TATTTGGAGG
   98341  AGGATTATAT TAGAGATTTT CATACTTTTT TAAGATTAAA ATTACCTAAA ATTCAATAAT
   98401  AACTTTATCA ACCAATGAGG TAAATGTAAT AGTACTAATC TTTTAAAAGA TAGATTGCTT
   98461  AAGTTGATTT GTGATTTAAA TTCTTTGAAT TTTCTTTTTT TTCCTAAAAT TTTGTATTGA
   98521  TTAGCAATAG CAAACCTATT TTGGTCTAAA TAAGATTTTA AATAAGGTGT ATTGCCTTCA
   98581  GAATTTTTAT TTTTTGAAAT TAATAGCGCT TTATTGTCTA TATTTTTTGA GTCGGATAAA
   98641  GAATCAAAAA CAAATAGTGC ATAAATTGTT GTTTCTCTTT TGTTAAATAT AAATGAATGT
   98701  TTTATTCCTA ATCGAGTCCA TAAGTCGATA TCTTGTATGG ATATAATATC TGGATCAAAA
   98761  AAGAAATCAT TATCAAGTAT TAATTTCTTT TCAATACAAA CTGCAGAGGT CCATGCGATA
   98821  TCGGCAATTA AACTGCTTTT AAAGTAATTT TGAATAATGT ATAAGTCTTC AAATTCTGGT
   98881  TTAGGTAAAT AACTAAAACG GTTTTCTTTA TACGTGTTTT TCTTAGTTTC TACTTTATAA
   98941  TTGTTACAGA AAATTTTATA CTCTGGATAT GCGGAAATAG CTCTATTTAA TTCAGAAAGA
   99001  TGATTAGGAA ACCAATAATC ATCAGCATCT AAAAAAGCGA TGTATTTTCC ATTAGCAAAT
   99061  TTTATCCCAT TATTACGTGC TGTTGAAACA CCGCTATTTT TTTGAGAATA AATTTTAATT
   99121  TTTTTATCAT TTATTTTTTC AACAACAGAT AAGCTGTTAT CTGTTGATCC ATCATTTATA
   99181  ATTATTATTT CATAATCAAT GAAATTCTGT TTTAAAGCAG AATCTAGTGT GGTCTTTATA
   99241  AAATCTTCTT TATTGTATAA TGGTATTATT ACTGAAAAAA ATGGTGTCAT AAAAATTAAA
   99301  AATATAAGTA AATAAAAGTA ATTTTTTCTA GACAAAGAAA ATTACTAATA TTTGTTTTAA
   99361  TTAAGATTTA AGTTTTGGCA TCAAAAAAAA TTCAAATTAT AGCATTTAAT AATCCTTACC
   99421  CTGTAAATTA TGGAGGGGTT ATTGATGTTT TTTATAAGAT AGAGGCACTA AAAGAAATAG
   99481  GTTATCAGGT ATATTTGCAT ATTTTTTATG ATGATAGAGT TAATATCTCG GTTTTAGAAA
   99541  AACTATGTGA AGAGGTTTAT CTGTACAAAA GAAACAAATT ATTTTATAAT TTTTTTAGTT
   99601  TAATACCTTT TAGTGTTAAA TCAAGAAATT CAAAGGAGTT GTATGCAAGG ATAACAAATA
   99661  AGACAAATAT TCCTGTGCTT TTTGAAAGTA TTCAAACTAC ATATATTCTT AAAAAGTTTC
   99721  ATTTTAATAA TGAAACTTTA GTAAGAACTC ACAATATTGA GCATGAATAT TATTTTGGTA
   99781  TAGCTAAGAG TGAGTCTTGT TTTTTTAAAA AGCTTATTTT TTATATAGAA GGTTGGAAGT
   99841  TAAAAAGATA TCAGTCTGTG TTGAAAAAAG CGGATATAAT ATTGACACTT TCGGAAAGAG
   99901  ATACGAGTTA TTTTAATTCG ATTTTTAAAG GGAAAACACT ATTCCTGCCT GTGTTTCATG
   99961  GAAATAAAAA GGTGAAAGAA ACTATGAATT CTAAAAGCAA ATTCGCTCTT TATCATGGTG
  100021  ATCTTTCAAT TTCAGATAAT GTAGAGTCGG CAATTTTTAT ATGCTCACTT TTTTATAATT
  100081  TAAAACAGGA ACTGGTTATA GCTAGTTCTG TTTTGCCAAA TCGTATCAAG AAAATTATAA
  100141  AAAATTATTC AAACATAAAA TATATAAATA TTAGAGAAGA AGAGGTTTTA GAAGATCTGT
  100201  TGGCAAAAGC ACATGTTAAT ATATTAGTAT CACTACAAGA GTCTGGAACT AAATTAAAGG
  100261  TGTTTAATGC TTTGTATAAA GGGAAATATT GTATTGTGAA TGCTAATATA GTTGATGATA
  100321  AAAATATACT AAAACTATGT TATGTAGCCA ATACAAAATC TGAATTCCAG AAAAGTATAC
  100381  AAGAAATTTT TGGTAAGGAT TATCAATTTT CAAGTGAACG AGCTCGCGTA TTGAAAAATT
  100441  ATGAATCGTT GAACTTGGTT AAAAAGTTAT CCTACTACCT TGAGACTAAT AAAATCACAT
  100501  AGTTTTGTTA GTCTTGAATA AATTAACGTT AATATTTTTA TAATAGAAGC ATGATTGTTA
  100561  TGAAACTATT TAAAAAAAAG ATAAACGTTT TTTAGTGTAT TATGTATGAA TTTAACCTTA
  100621  GTTCGTGTTT TTTGAAACAA AGCGATCTAG AGTTTTTATT GAATACAAAA TGATTTAAAA
  100681  TTAATTTTTT CTTTGTACCA CCTCAAAAAT CTTTTGATTT TCGCACTTTA AGGTTTTTGA
  100741  AGGATATTTT AAAAGTAATG CATAATCATG TGTGGCCATT AAAATAGTAT TCCCATTGGC
  100801  ATTAATTTCT TTGAGTAGGG CCATTACTTC CAGGGAAGTT TGTGGGTCTA AGTTTCCAGT
  100861  AGGCTCATCG GCTAAAATAA GTTCGGGATT ATTTAATAAA GCCCTAGCAA TAGCAATACG
  100921  TTGTTGCTCA CCGCCCGAAA GTTGATAAGG GTAAATAGTA CCCTTTGATT CCATGCCAAC
  100981  TTTTGTGAGT ACTTCCTTAA TGCGGTTTTC TATTTTGTCT TTTTCTTTCC ATCCCGTAGC
  101041  TTTTAGAACA AATGCCAAGT TATTATTAAC AGTACGATCA TTAAGTAATT TGAAATCTTG
  101101  GAAAACAACA CCAAGTTTTC TTCTTAAAAA AGGGATTTTT TTTTCTTGTA GTCCATTAAG
  101161  TTTAAAATTT ACGATTTCTC CTTCACCTTG GACAAGCGCT AAATCTCCGT AAAGTGTTTT
  101221  TAAAAAACTA CTTTTTCCAG AGCCAGTTTT TCCGATAAGA TACACAAAGT CACCTTTTAA
  101281  GACTTGTAAG GAAACGTTGG ATAATACTGC TTTTTCACGT TGAAAAATAG TAACATTAGT
  101341  TAATTTTAGC ACTGCTTCAC TCATAATACT CCTGTAAATT GTAATGGTAA AATTATAAAA
  101401  CTAAATCAGT TTGCAAAATA AAGTAAAGGT TTTAGTGTTT TTAAAATAAG GAATAGGTAA
  101461  GTATAGGGTA AACTGAAGCA ATTTAATTTT AGAAAAGTAT GTTGTTATTG AGGATGTTTT
  101521  ATCAATTTTA AGCTTGTATT TTGTGAATTT GATAGCTGCA GAAGGCAAAA TATTTCAAGA
  101581  ATTTTTAAGT TTTACTTATT TAGTAATTAT TGTAAATTAA TTCCTTCATA GTGGGAGTAT
  101641  CTTAATATAT TTGGAATAGG GTTTATTTTT TTAATTTCAT GAAGAAAAGT TCGATTATTA
  101701  CCTGTTTTTT TGTGTTGATA TCATCATTGG TTTTAGCACA GCAGACCGAA ATTTATAACA
  101761  CCACCAACGG GTTATATCAA AGAGCAGTTG ATTTATACAA CAATAAAGAA TTTGCTGCAG
  101821  CTCAAAGTTT TTTTAGAAAA GTACAAGCTA CAACTGTTGA TCAAAATGTA AAAGCAAATA
  101881  CTTCTTATTA CATTGCTCAA TCTGCCGTGC AAATGCAACA GAGAGGAGCC GATGTTTTAA
  101941  TGACAAATTT TGTAACTGAT TACCCTACGC ACCCCAAACG TAATAGTGCT TTTTTTGGAG
  102001  TAGGGAGTTA CTATTTTAGT GTCGGAAAGT ATGCGCAAGC CCGTAAATGG TATCAAGATG
  102061  TTGATGAGCA GCGTTTGAGT GCACCAGCAC TTGAAACCTT TTACTTTAAT AAAGGATATT
  102121  CATTGTATCA TTCAAAAAGA TATGATGATG CTAAAAAATC ATTAGAGCGC GTTGTAGGCT
  102181  CCGAAAAATA TGGAGAGCAA GCAAAGTATT ATCTGGGGTA TATAGCTTAC AAGGCTAATG
  102241  ATTATGACCA AGCAGATACT TATTTTAATG AAGTAAGTGA TTCTGAAAAT TACAATAAGA
  102301  GCTTATCTTA TTACAAAGCA GATCGTAATT TTAAAAAGGG GGAGTTTCAA AAAGCGATTG
  102361  ATAATGCAGA ACCTCGCTTG GTGAATGCAA ATACCAAAGA TAAATCACAA CTAAATAAAA
  102421  TTATTGGGGA AAGTTATTTT AACCTTGAAG ACTATGAAAA AGCAGTTCCG TATTTAGAGG
  102481  CTTATAAGGG AAACAAAGGA AAATGGAGTA ATACCGATTA TTATTTATTA GGGTATTCAT
  102541  ATTACAAACA AGGGGAGTAT AGCAAAGCAG TTTCTCAATT TAATAAAATC ATAGCAGGTA
  102601  AAAATGCAGT AGCTCAAAAT GCTTATTATC ACTTAGCGGA TGCCTATTTA AAATCGGAAC
  102661  AAAAGCAACA GGCTTTAAAT GCATTTAAGA ATGCTTCGGA AATGAATTTT GAAGCTATTA
  102721  TAAAAGAGGA CGCCACTTAT AATTATGCAA AATTAAGTTA CGAAATAGGG AATTCTTTTG
  102781  AAAGTGTGCC CGCAGTGTTA AAAACATTTT TATTAAAATA TCCAGATTCA TCGCACAAGC
  102841  AAGAAATAGC CACGTTGTTG GTAGATTCTT ATTTGTCAAC AAAAAATTAC AAGGAAGCTT
  102901  TAGTAGTTTT AGATTCAGGA AAAGGAACGG AAAATAAAAA AGTATTTCAA AAAGTGTTGT
  102961  TTTATAGAGG GTTGGAGTTG TTTAAGGAAA AAGATTTTAA AGAAGCGATT CTTCTTTTTG
  103021  ATAGGGCAAT TTCCACAGAT GCCTTACCTG ACTTTACACA ACGTGCTCAG TTTTGGAAAG
  103081  GAGAAAGTTA CTACGCGTTA GAGGATTTTG TAATAGCAAT TTCAAATTAT AAAGCGGTAA
  103141  AAGAAAGTGG TGATAATACT TGGGAAGAAT TAAAGTTAAC AACCTACCAG TTAGGTTACA
  103201  GTAACTTTAA AATTAAAGCC TATGACAAGG CAATTGATTA TTTTAAGAAA TTTATAGCTT
  103261  CAAATCCAGA GCAGTTTTAT TTACAAGATG CCACATTGCG TTTGGCAGAT AGTTATTTTG
  103321  TGACGGCTAA TTATTGGCCA GCAATGGAAA CATACAATAA ATCCATAGCT CAAAAGCACA
  103381  AGCGTGCAGA TTATGCTCAT TTTCAAAAAG CAATTAGTTA TGGTTTTGTA AATAAGCATG
  103441  ATCGGAAAAT ACAGGATTTA GAGGCTTTTT TAATTAACTT CCCAGATTCG GGTTACAGGG
  103501  ATGATGCTTA TTATGCTTTA GCTAATGCAT ATGTGGCTAA AAATAATATC AATAAGGGTT
  103561  TAGAAAATTA CAAGCAACTT AGAAGTGAAT TACCTAAAAG TGCATTTGTT TCTAAAGCAC
  103621  TTTTAAAAGA AGGCTTAATT TTTTATAACG ATAATAAATC ACAAAAGGCG TTAGATAAGT
  103681  TTAAACTTTT AGTAGCAGAG CATTCAAATA CTACAGAAGC TTTGCAAGCC GTTAAAACAG
  103741  CCCGCTTGGT GTACATTGAT TTAGGAAAAA CAGATGAGTA TGCGGAATGG GTTAAATCAT
  103801  TAGATTTTGT TGATATTTCT AATGAGGAAT TGGATAATAC CACCTACGAA GCAGCAGAAA
  103861  AGCCCTACCA GGAAAATAAT ATAAGTAAAG CAATTGTTGG TTTTGAAAAA TACTTGAAAC
  103921  AATTTCCTAA AGGTTTACAT AAGCTGAATA GTCATTTTTA TTTAGGACAA TTGTATACTA
  103981  AAAAAGGGGA TAAACAACAA GCTTTGCCTC ATTATTTGGC TGTTGCTGAA ATGGATAAAA
  104041  ATGAATACAC AGAAACGGCT CTTTATAAAA TTTCGCAAAC CTATTTGGAA AACAAATCTT
  104101  ATGATAAAGC TATTTCATTT TTAAAACGTT TAGAAGAAAG TGCTGATTTT ACTCAAAATA
  104161  GCATATTTGC CCAATCTAAT TTGATGAAAT CATATTATGA ACAAAAGCAG TTTGAAGAAA
  104221  CATTAGTTTA TTCGGAAAAA GTACTAGTCA ATTCAACTAT TGAAACGAGT ATTAAGGCCG
  104281  ATGCTCAAAT TTATAAAGCT AGAGCAGCAT TGGCACTTCA AAAAACAGGA ATAGCAAAAA
  104341  AAGCCTACGC AGAAGTAGCA AAAATAGCTA CGGGTAAATT AGGTGCCGAG GCGATATATA
  104401  ACTTAGCTAA TTTTAGTAAT CAAAACGGAG ATTACGAAAT TTCAAATAAT TATGTGCAGC
  104461  GTTTAGCAAA AGATTATTCG GCTTATAAAG AGTTTGGAGC TAAAGGACTA GTACTTATGG
  104521  CTAAGAATTT TTATGGATTA GGGGATGCCT ATCAAGCTAC TTATTTGTTA GAATCAATAG
  104581  TAAAGGAGTT TACAAGCTAC CCCGAGGTTA TAAGTGAAGC TAAAGAATTA CTACAAAAAA
  104641  TTAAAGCAGA GGAAGCTAAA ACAAATTCAT CAATCAAAGA ATAAGTAACG TATTTATGAG
  104701  TTTATTTTTT AATAATAGAA GTGTACTATT TGTTGTGTTT TTTATTGGAG TATTAGGTTA
  104761  TTCCCAAACA AAAAAAGAAG AAAACGATAC TTTGAGTACC GAAAAGGTGG TGATAGTAAA
  104821  AACATTTAAT CCTACGATTA ATGATGCTTT TAAGATTCAC CCAGAGCCTA ATTTTGATGA
  104881  AAAAGAAGCA TCTATTAAGG AACCCTTAAA GTTTCAGATC AATTCCGTGC CAGTGGCAAG
  104941  TACTTTTGTG CCCGAAAAAA CAAAATCAAT TGCTGTAAAA AAAGAAGCCC CAGAAGCCTC
  105001  ATTTAAAAAT TATGCGTTAT TAGGAGCAGG AAATTTTGGA AATGTTTTAG CTGAAGTATT
  105061  TAGTAGTATT GATATAAATA AAGAAAGTCA ATTTACAGCT TTGTTGGAGC ATCAATCATC
  105121  TCAAGGCGGT ATCAAAAAGG TAAGGCTTGA CGACTTTTTT TATGATACGG GGGTACAACT
  105181  AAGCTTTGGA AAACAGCAAA AACGTAAACA ATGGACAATA GACTTAGAAG CACAACATCA
  105241  ATTGTATAAT TGGTATGGTT TATCCAGTAA TTTAGAAATT CCCGAAGAAC AATTTAATGC
  105301  CATTGATCCA TCACATAGTT TTATTGATGT TAATTTAGGA GGGAATTTAC AGTTAGATCA
  105361  TGAGGTGTTT AATACGGCTA ATGTTAGGTT TAGACATTTT AGAGATGATT ATGAGAGTAC
  105421  AGAAAATAAC TTAAAACTGA ATCCTAAATT TACAGCACCT TTGGATGATT ATCCTATTTC
  105481  GATACCCATA ATTTTTGATT ATTTAAGTGG TGAGTTTGCA GATAATAATG TGTTTCAAGG
  105541  TTCGAAATAT AGTTTTTTAA TATTAGGAGT TCAGCCTACT ATAGCATTAA ATTTTAAAGG
  105601  GGTAGATGTC AAAATTGGAG TTTCAGGTTT TTTAAGTAAT GATTTTGAAA ATAGTGAGTT
  105661  AAAATTAACA ATCCATCCTA ATTTAACCGC TAATTATAAT TTTAACGCTT ATAATTTAAG
  105721  TGTTTTCGGA GGAGCTACAG GTGGTTTAAA ACAAAATACA TATCATGAAG CCATTGAAAA
  105781  AAATCCGTTT GTTGCTCCTG GAATTGGAAT CACTCCAACA AATCAGGTAT TTAATGCATT
  105841  TGGAGGCGTG CAAGGACAAT GGCAAGAAAA ATTTTCATAC ATGTTAAAGG GAGAAGCGGA
  105901  GTTTGTAAAA GACTATGCCT CTTTTATTAA AAATCCGATA TTGAATTCAG CAACAGAAAA
  105961  TTTGAATTAT GGGTTTAATA ATTCTTTTGG ATATTTTTAT CAAGATTATG TAGCGGCAAA
  106021  AATTACTGCC GAAGTTGGTT ATGAGGAGCA AGGTTTATTT AATGTACTTT TGCAAACAAC
  106081  TTTTGCTAGA TATAATGAGA CACCAAGGCA GCCTTTAAAT ATACCCGCTT TTACAACAAG
  106141  TGCTAGGGGG AATTATATTG TTAATAGTGC ATGGAGTATT GGAGCTAATA TTTTTTATGT
  106201  GGGAGTTAGA GAAGACCGTG ATAGATTAAA TAGTGATTTA TATACAGAAT TAGACGGTTA
  106261  CTTTGATCTT AATTTACGTG CAGATTATAA AATTACAGAT CAATGGTCGG CTTTTGCATT
  106321  AGGGAATAAT TTAACAGGAC AAAATTACGA ACGTTGGTTA GACTACCCTG TACAGGGAAT
  106381  TCAACTTTTA GTAGGTGCTA AGTATAAATT TTAGCTATGT GAACTTGGAT GCTGAGTTTG
  106441  TTTATTGCCA ATATTTATTA AGGAACTCTT AATTTAATTG TTTAATTAGC GACCTCCATT
  106501  GGCTTGTAGG TCTTTTACAC ATAAAGGATC AAGTTCTAAT GCTTTTATGT TTCCCATTAA
  106561  ATTGCTTTCA AAAAGTGCGT TGGCTTGCAT AAGGCAACCT CTAACATTGC AATGTTTATT
  106621  AGGCTTACCG TTTTCGTCTG TGTCTTCATG AGGTGTTTGC ATTCTAGTTC CTAAATTAAC
  106681  TAAACCAAGC AAATGGCAAA ATTCATGCTG TAATGTAAAA GTTTCAACTC TAGCTAAAAC
  106741  TTCATCGGGG ATAACTGAAT TACTTTGATT AACTATTTTT TTTAAAGTAT TTTCGTAAAC
  106801  AACCATAGAT GTATTTCGAT AAGCAGAGCC TAAAACCAAA CTAGACATAG AATCGTTATC
  106861  ATTATTCATT TCTCCTTCAG AGTTTTCTGG ATTAGCATCG GCATCACTAA AGTAAATGAA
  106921  AATAGCATGT TGGTTAGGCG TGCTTAATTG TGTGCGGTTT TTTTGTTCAA TGCTATCAAT
  106981  TTGTTTTATG CTAAGCTTTT TTTTATTGGT GCTAGCAATG CTACGTTGAA TAACTTGAAC
  107041  ACCGTTTGAT TTAAATGTTC TTTTTTCAAT AAAATTAACA AGATTTTCTA CGGCTTCTTT
  107101  TTTGGGTTCA AAACCTTTTA CAGCAACTAA TTCTAAAATC AATTTGTTAT GCGTTTTTGA
  107161  ACTTAATAGT TCATTTGCAG AGTTTCCTGT ACTTTGTAAA TTTAGTATTC GAGGATTCCG
  107221  ATTGCCGTTT GAATCGTCAT CACTTGCACA GGCTACAATG AATATAGTTA GTGCAATTAC
  107281  TTTGAAAAAA GTTTTAATAG ATATCATTCT TATGATTTTA TTACATTTGT CTAACGCAAA
  107341  AAATACTTAT TTATGAAATT CAAATGTTTT AGTTTAGTAT TATTTTTAAT ACTCTCCTTA
  107401  CAATCCACAG CGCAACAATC CACATTAACT GAGTCAATAA CTCAGTATTT AAATATTAAT
  107461  GGGACTACAG AACAATATGA ACATGCTGTA AGTTCGTTGT TAGTGATGTT AAAACAACAA
  107521  TACGTATCAA AGAATGTTCC AGAAACGGTA TGGGAGGAGT TAAATCAGCA AAAACCTACA
  107581  GCAATTAATC AAATTAAAGC CATGTTAGTT TCGGCTTACC GCACACATTT TGATCAAACG
  107641  GAAGTTAATG ACATGATTGA GTTTTACAAA ACGCCAACGG GTCAACAAAT GATAACGGAT
  107701  CAAACAAAGT TGACTCAGGA TGATCGTGAT AAAATGTCAT TTTTTTATAA TTCACCAACC
  107761  GGTAAAAAGA TTTTAGAAGA AAGTGATGCA TTAAATCAAT CCGTAAGTGA AATTAGTGAG
  107821  AATTGGAGTA GAGCATTATA TAAGTCTATG ACAGCAAGAC TTACAGAAAA AGGTTATGAT
  107881  CTATAGTGTT AATCTAGCTA AATAGTCATA ATGTGCTCCT TCAATAATTA ACTCGCAGTT
  107941  AAAATTATTA AATGCTGCAG CACGTTGTAA TGTATTGTAA TCTACATATA GCCAGTCAAA
  108001  TTTTTGACTG GTTTTGTTTT TATATTCCAA TTGGTATTGC ATTTCACCAT AATAGCCTTG
  108061  TGCAGCATCT ACCCAATATT CGCCATTTTC ATCTTCAAAT AAATAAATGA GATCCGATGA
  108121  ATCTATAAGG ATTTGTCCAT TGGAGGTTAG TAAGCTTTTT AATTTGTTAA AAAAAGAAGC
  108181  AAAATTAGTT AATGTTCCTA CAATACCACT ACCATTCATT AATAGTAAAA TGGTATCATA
  108241  CGTGCCTTGA TGAATATAAA AATCTTCATT TAAAACAGTA GTAACTCCTC TTTTTTTGCA
  108301  AATTTCCACA GCTCCAGCTG AGGTGTCAAT AGCAGTTAGG GTTAATTTTT TTTCGTTTTG
  108361  AAGGTGCAAT GAATGACTAC CAGCTCCACA GCCTACATCG AGTACTTTTC CAAAAGATAA
  108421  ATCAAGCGCT TTTTGCTCAA CTTTTGGCAT TTCATTAAAA GTTCTAAACA AGTAAGGAAT
  108481  AGGAATTTCA TCATCATCAA ATTCATTTGA TTTTACAATA ATTGAATTTG GAATGCGAGT
  108541  TTCAAAGTAG TCCGTTATGG CGGCGCCAAA AATGTCATTT TCCATGGTGG GTGTAAAGTT
  108601  ATGTTTTACA TTTGCTGTAT GCAAGAGGAA ATTGATAGAC TACCAAAAGA GGCAAAAGAG
  108661  CAATTTAAAG AGAATAAGAA GTTTTTAGAG CGTTTGAGGC AAAAACCTCC GAAAAAATTG
  108721  GATGTTATAA TGCAAGATTT GCATAACAAA ACATTTGATC AAATAGATTG TCTGGAATGT
  108781  GCCAATTGTT GTAAAACAAC TGCGCCCATT GTTACTGATC GAGATACAGA ACGTATTGCG
  108841  AAACATTTAA AAATGAAAGC AGTTGATTTT GAACAAAAGT ATGTTAAAGT GGATAGTGAT
  108901  GGAGATCAGG TTTTTAAAAC TACTCCTTGT GAATTTTTGG CTCATGATAA TTATTGTTTA
  108961  ATATATGATG TACGTCCAAA GGCATGTTCG GAATATCCAC ATACAAATAG GAAACGTTTC
  109021  CACCAACTAA ACAAAGTAAC TTTAGCAAAT ACATCCATTT GTCCGGCTAC ATATAGAATG
  109081  GTTGAAAAGC TTAAAGCACA GTTTGGAGTG CTAAATAAAA AAGAAAAACA ACGTTAATTT
  109141  TTTAAATATT TTTTATCGGC CCAAAAAGTT CCAAAAGGAA TAATAGAGCA TAAAAGAATA
  109201  ATAGCCGTTT GTTTGTTCGA CCATTTTAAT TCAGTCTTTA GGAAAATAGC AAAAACAACA
  109261  TAACCTAAAA ATAAAACACC ATGTACCATT CCTATAATTT TATTGGGCAT GGGATTTTCA
  109321  AATAAATATT TTAATGGCAT GGTTATAAAA AGAATGATTA GGAATGAAAT TCCTTCGAGT
  109381  AAAGCCAGTA TTCTAAATTT TTGAAGCATG TTTGTTTTTT GTGGTAAAGA TAACTTCCGA
  109441  TAAAATATTA CGGGTATAAT AAATACTTTT TTCTAATCAA ATTAAATTGA TCTAAATCCT
  109501  TTTGCCAAGT AGCCTTAATT TGTTTAGCAG TCATTCCGGC TTCAATTTGT TCTTGTAGTT
  109561  GATCTGTACC AGCTAATTTT TTAAAAAATG AGGTAAAGAA TTCATTTTTA TTAGGGCTTT
  109621  GTTTGTAAGC CTTAAGTAAC CAATTTAAAT GTAATTGGTC CAGTTTTTTA TGCTGTTGTA
  109681  AATTTTCGCC ATAACATAGT TTTGCTTCAA ATTTAGGGTG TTTAGCACCG GGTTTAGGAG
  109741  TTGGTGTAAA GCTAAAATCT GTTTTAGAAA AATTTGGAGC TCCGTATAGT TGAAATTGTA
  109801  AATCTGTGCC TCGACCTACA CTTACATTAG TGCCCTCAAA TAGACACAAA CTTGGATATA
  109861  AATTTATTGA TTGATCATTG GGTAAATTTG GTGAGGGTTT TATGGGCAAG GAATAGGCAG
  109921  TGGTATGGGT GTAATTTTTT AAAGGGATAA CGCTAAGTTC ACATGTTAGT TTGTTGGCTA
  109981  ACCATTGTTC GCCATTAATC ATTTTGGCAT ATTCACCAAT AGTCATTCCA TGTACTATAG
  110041  GTATAGGGTG TAAGCCAACA AAGCTTTTAA ATTTCGGTTG TCGGATAGGT CCATCCACAT
  110101  AATGTCCATT TGGATTGGGT CTGTCAAGCA CAATAACTAG GATGTTGGCC TCAGCAGCAG
  110161  CTTCCATAAT ATAATGCAGT GTCGAAATGT AAGTATAAAA ACGAGCGCCA ACATCTTGGA
  110221  TGTCAAAAAC AATACAATCA ATGTCCGAAA GCATTTCGGG ATTAGGTTTT TTATGCTTCC
  110281  CGTAAAGGGA AACAATAGGC AGGCCAGTAG CAATATCTTT ACCATTTTTG ATCACTTCAC
  110341  CGGCGTCGGC AGTACCTCTA AACCCGTGTT CGGGAGCAAA AACTTTTTTT AAATTAACCC
  110401  CCCTGCTTAG TAAAGAATCT ACTAAATGTA TAGGTTGTTT TTTTATGTTA AAAATAATAC
  110461  TGGTAGGGTT TGCGACTACG GCTATTTTTT TTTCTTTAAG AAGTTTTAAA TAGGAAGTTA
  110521  TTTGTTGCGC GCCTGTTAAG ATACTTGTTG TTTTCTTTTT TTCTTTAACA GAAGAAATGA
  110581  CTGTATGATC AATTTTAGAA GCCGTTTTTA TTGAAGGATT TGGTTTTCCA CAAGAAAATA
  110641  AGGGGAAGAC TAGTATTAAA AATGTATTTT TGAAAAAGGT CATTAACCAT GAAAAATATC
  110701  TTTTTCGAAG ATTAAACGGA TTAGTATACA TTGAATTTTG AGTATTTCAT AGCCCAAAGG
  110761  CTGATTAAAG AAAAGGCTTT TGCCAAAAAT ATATCATCAC CTATTGTAAA AATAGCCATT
  110821  ATAGCTATTG CTTTAGGGAT CATAATGATG CTTATTGCGA TCGCTACAGG TGTTGGTTTA
  110881  CAACGTAAAA TTCGTGAAAA AATAGCACTT TTTAATGGGC ATATTGAAAT TTCTAACTTT
  110941  GATAATAATT CAAGTCAAGT TTCTATAAAA CCGATTACCA CAAATCAAAC TTTTTATCCT
  111001  AATTTTTCTG AAGTGCCCGA GGTCACCCAT ATACAAGGAG TAGCTACAAA AGCAGGAATT
  111061  GTTCGCACAG AAACCGATTT TGAAGGAGTT CTAGTAAAAG GAGTTGGGTC GGATTATAAA
  111121  TGGGATGTAT TTGAAACCTA TTTGGAACAA GGAAGGTTGC CTAATTATAA TGAAAAAATA
  111181  AATGAAGAGG TGCTTATATC TAGTTATTTA GCCAATAGAT TAGGCTATAA GCTAGGAGAT
  111241  AAAGTAGTGA CTTATTTTTT AAAAAATGAT AAAGCGCGTA CCAATTTACG TTCCTTTGTA
  111301  GTTACTGGAA TTTACAATTC GGGTTATGAA GAATTTGATA AAGCCTTTGT GATAGCGGAT
  111361  GTGAGACACA TACAGCGTTT AAATAAATGG AAAAAAGATG AGGTAGGTGC TTTTGAAGTT
  111421  TTTGTTACTG ATTTTGATGC AGTAAATCGT ATCAATGCGG CCGTTTATAA AAACATTCCA
  111481  TCTAATTTAG ATAGTACATC CATTTCTCAA AAATATGGAA ACATTTTTCA ATGGTTGAAT
  111541  ATGTTCGATT TTAATATTGC GGGTATTATT GGTATCATGA TATTAGTGGC GGGGATCAAT
  111601  ATGATTACTG CGATTTTAGT GCTTATTTTA GAACGAACAC AACTCATAGG AATGCTGAAA
  111661  GCCATGGGGA GCTCTAATGT GAGTATTCGT AAAATATTTA TGTATAATGC TACATACATT
  111721  ATTTTAAAAG GGCTCTTTTG GGGTAACTTA ATTGGGCTTG TTTTAATAGG GATTCAGTAC
  111781  TTTTTTAAAG TGATTACGTT AAACCCTTCG GATTATTATG TGAAATACGC GCCAGTGCAT
  111841  ATCACCATTC AGCAAGTTTT AGCTTTAAAT ATAGGAACAT TAGTATTATG TGTTTTAGTA
  111901  CTTTGGATAC CATCTTACGT AATTACAAAA ATAGCTCCTA TAAAAGCAAT TAAGTTTCAA
  111961  TAGTTGTTTG TACGATATAA TTTTTTAATT TAATGAAGGC AAGACTGGTT GATAATGATG
  112021  CTGATTTACA TCAGATTTTA GCTATTCAAA AAGAAAATCA CTTAGATAAT GTCTCCATAA
  112081  GTAATAAAAA AGAAAGAGGT TTTGTGACTG TAAAACATGA TTTTGAAGTG CTAAAAAAGT
  112141  TGAATTCAAA AGCACGTCAA ATAATAGTTA GTGATAAAAA TGAAGTAATA GGCTATGCTT
  112201  TAGTAATGCT TAAAGAATTT AAAGACTTGA TTCCTGTACT TATTCCCATG TTTACACTTT
  112261  TTGAAAGTAT TCAATACCGA GGAAAAAAAT TAAGTGAATT GAATTATTAT GTAATGGGAC
  112321  AAATATGTAT TGCAGATGGG TATAAACGTA AAGGTCTATT TGAAAAGCTA TATTTAAAAC
  112381  ACAAAGAAGT TTATTCTGAG CAATTTGAGT ATTGTATAAC TGAGGTGTCA TCAAGTAATA
  112441  TTCCATCCAT GAAGGCACAT GAAAAAGTTG GTTTTAAAAC TATTTCTACC TTTTGTGATA
  112501  CTACCGATGA GTGGAATGTT TTGTTATGGG ATTGGCATTA GTAATAGGGT ATAATTCAAT
  112561  TTTAATATTC AATGTGCTAT TGATAATTAA TGTAATTTTG CTTTTTTTCT AATTAATTGA
  112621  AATGAGGAAT GAGTAAAAAA CACTTTTATA GACCCGATAT TGATGGATTA AGAGCTATAG
  112681  CAGTAATGCT TGTTATTTTA TTTCATGCAG GTTTTACAAG TATTAGTGGA GGTTTTGTAG
  112741  GGGTTGATAT CTTTTTTGTG ATATCGGGTT TTTTGATTAC AAGCTCAATT AATAAACAAA
  112801  TGAGTCAGGG AACTTTTTCG TTCCAAAATT TTTACTTGAA ACGAATACGA CGTATTATTC
  112861  CAGTATTGGT TTTTATCATG TTTATTGTAA CAATACCTGC TTATTTTATA TTGTTTTCAG
  112921  ATGATTTTGA AAATTATTCC AGAACTATTA TTCATACTAT TTTAAGTACA AATAATTTTC
  112981  ATTTATGGAT TAAAAGTAAT GATTATTTTG CCGAAAGTAC AGAATTAATC CCCTTGTTGC
  113041  ATACTTGGTC GTTATCTGTT GAAGAACAGT TTTATATCAT ATGGCCTCCA CTACTATTGT
  113101  TATTGCACAA AAAGTTCAAT TTAAAAAATA GGTTGTTAGG AGTGATTGTG TTACTGTTTT
  113161  TAAGTTTTAT GCTCTCGGTA TTTTTAACAC ACATAAATAT GCAAATGGCT TACTTTTTAT
  113221  TGCCGGCACG ATTGTTTGAA ATGTTAATGG GAGGGGTGTT AGCAATTTTT TGGTACAAAT
  113281  TACCTGAGTT TTCTAAAATT CAAAACCATA TAATTTCCAG TGTGGGATTT TTTATGATGC
  113341  TGCTTCCTGC ATTGTTACTT ACTCAAAATG ATAGTTTTCC TGGGATTAAT GCTTTATGGC
  113401  CATGCTTAGG TGCTAGTTTG TTTATTATTT CTGGAAAAGA GGCATCAAAA ATGGGAGTAT
  113461  TTAATACTAT ATTAAAAATT CGTGTTTTGG TCTTTATTGG GTTAATTTCT TATTCTATGT
  113521  ATTTGTGGCA TTGGCCATTA TTAGTTTATG TAAAATATTT AGGTTTTGAG TTGACTAAAC
  113581  CGATAGCATT AGGAGTAATT ATTTTAACTA TTTTACTATC CTATTTGTCA TGGAAATTTA
  113641  TTGAGCAACC TTTTAGGTAT CGTTACATTT ATGATTTTAA AAACACATTA TTAAAAGTGC
  113701  TATTACCTAG TGTTATCATT TGTGTAAGCT TATATGGAGT CATAGACCAT TTTAATGGTT
  113761  TTCCAAATCG TTTTACAGCG CTAAGTGAAT TTGATAAGGA TGCTAATTTT CCAAGTAAAT
  113821  TGAGACGTAA TTGTTATAGG AAGTTAAGGA TTGGAAATAT TGAAGAGTGT GGTTTAGGTA
  113881  CTCCCAAAGA TCAATTAGAT GGTATGCTTA TAGGTGATTC ATTTGCCAAT CATTCCGCGG
  113941  CATTTTTAGA GGTGTTAGCA AACGATGCCC ATATGTATTT TCATGATAGT GCAGCAGGAG
  114001  GCTATCCGGT GTTAGCAGAT GTTGACGATA TTACAGGGGA ATATAGATAT GATCCAGAAT
  114061  TTGGAGAAAA AAGATTAGCC TTAGCAAAAA AATATGAATA TGTAATTTTA GCAGCAAATT
  114121  GGGAGCGTTT CTTAGATAAA AAATCTAAAA ATTACCAGTT GGTACTTAAA ACTGTAGGGG
  114181  AGTTAGTGGA AACGGGAAAA AAAGTAATTG TAATAGATCC ATTACGAAAA ACCACTCCTA
  114241  TGGATCTACA TAAGATGAAG ATGTTTAAAG TAAGGAATAT TGCTAAGATT AAAAAAGAAG
  114301  ATCTTTTGGT GCCTTTTTAT AAAAGACCAG ACGATTATAT AGTATATGAA TTCAAAAGAA
  114361  AATTCCCAAC TATAAAGATT GTTAATCTGA ATACAGTAAT GTGTAACGGT AATTATTGTG
  114421  ATTATGAAAT TAATGATAAT ATAGTATACC GTAATAGTAA TCATTTAAAT ACAAGTGGAG
  114481  CACGTTTACT TGGAGAACGA TACTTGAAAC AATATGGAAA TCCATTAAAA AAATAACAAT
  114541  TAGCCACTGT TATAGTAGGG GCATTACACG GTAATGAAGG ATAAATAGAT AGGGTTCATT
  114601  TTTTTTTAAA ACTTACTAAG TTTAAATTGT TGCAGATCAG TATATTGTTA ATTTTTTACT
  114661  TAATGAATTA AGTATGTAAT AATTATTAAT TAAAATAGTT CAATCTGGTC AGAAACAATT
  114721  ATATTTGCAT GCAATTAAAT CCTTAATTGC CATGATAGCA CACGAATCAA AAATTGTTGG
  114781  AGAAGGTTTA ACCTACGACG ATGTCTTATT AGTTCCAGCA TTTTCAGAAA TTCTTCCACG
  114841  CGAAGTTAGT ATTCAAACAA AATTTACTAA AAACATAACC ATAAATGTTC CGATTATTTC
  114901  GGCAGCAATG GATACGGTTA CAGAGTCGAG TATGGCAATT GCTATGGCTC GTGAAGGTGG
  114961  AATAGGAGTG TTACATAAAA ACATGACTAT CCAACAACAA GCTAGTGAAG TTCGAAAAGT
  115021  AAAAAGAGCT GAAAGTGGTA TGATCATAGA TCCAGTTACT TTGCCATTAA CTGCTGTAGT
  115081  AGGTGATGCA AAAGCGAATA TGCGTGAGCA TAGGATTGGA GGAATTCCTA TAGTAGATGA
  115141  ACAAGGTAAA TTGGCAGGAA TAGTAACTAA TAGGGATTTG CGTTTTGAAA AAGATGTTGA
  115201  CAGACCTTTA ATAGAGGTAA TGACAAGCGA AAATTTAGTT ACAGTGTCCG AAGGGACTAG
  115261  CCTTAAAGAT GCTGAGGTAA TTTTACAGAA AAATAAAATA GAAAAGCTTC CTGTGGTTAA
  115321  TGAAGATCAT ATTCTAGTTG GTTTAATTAC ATTTAGAGAT ATTACTAAAT TGACACAAAA
  115381  GCCCAATGCA AATAAAGATC AATTTGGTCG TTTACGTGTT GCTGCAGCAT TAGGAGTTAC
  115441  TGCGGATGTG GTTGAAAGAG CAACAGCTTT GGTAAATGTT GGAGTAGATG CTGTTATTAT
  115501  TGATACAGCC CATGGACATA CTAAAGGCGT TGTTGATGTA TTGAAAAAGG TGAAAGCAGC
  115561  TTTTCCTGAT TTAGAAGTAA TTGTTGGTAA TATTGCTACT GGTGAGGCCG CAAAATATTT
  115621  AGTTGAAGCA GGTGCTGATG CGATTAAAGT TGGAATAGGA CCAGGGTCAA TTTGTACAAC
  115681  ACGTGTTGTA GCTGGAGTTG GTTTTCCACA ATTTTCGGCA GTACTTGAGG TGGCAGCAGC
  115741  CATTAAAGGT ACGGGGGTTC CAGTAATTGC CGATGGAGGG ATTCGATACA CAGGGGATAT
  115801  TCCAAAGGCC ATTGCAGCTG GAGCAGATTG TGTAATGCTT GGTTCATTAT TGGCAGGGAC
  115861  TAAGGAGTCT CCAGGAGAAA CAATTATTTT TGAGGGACGT AAATTTAAGT CATATAGAGG
  115921  AATGGGATCT GTTGAAGCCA TGAAAAAAGG CTCAAAAGAT CGTTATTTCC AAGATGTGGA
  115981  AGATGATATT AAAAAATTAG TTCCTGAAGG AATTGTAGGT AGAGTTGCAT ACAAAGGAGA
  116041  ATTAAATGAA AGTATCCATC AATTTGTAGG AGGCTTACGT GCTGGAATGG GGTATTGTGG
  116101  TGCTGCTACA ATTGAGGATT TAAAAGAAAA TGGACGTTTT GTGAAAATCA CAGCAAGTGG
  116161  AATTAATGAA AGTCATCCAC ATGATGTTAC TATAACAAAA GAAGCTCCAA ATTATTCTAG
  116221  ATAATTAGAT CTATTCATAA AAAAAGCGAC TTTTAGTCGC TTTTTTTTAT AAATATTGGG
  116281  TGCAAGTTAG CTTTATTTTG ATGCTGTAAC TGCAATTTGA ATACCCACAT TATCTTTAAT
  116341  TAGGTAATCT CCTAATTTTG CAGGATCAGC AAATTTACCC GAGTTATATT TTACGCCCCA
  116401  CTCAGTTCGA TCAATTTCAA ATTCATCACT AGTAATAGTT ACTGTGTTGC CATTTACAGA
  116461  AACTGTTGCA GGGAATTCAA TATTTTTCTT AATTCCTTTT ATGCTTAGGT TACCAGCTAT
  116521  AACAGATTTT CCGTTTTTAG GAGTAACACT TGTAATTTGA AAAGCAGCAC TTGGGTGTTT
  116581  AGCTACATCA AAAAAGTCTT CATTTTTCAA GTGACCAATT AATTTGTCAT AGTTTTCTCC
  116641  AGCAGGAAGA TCGGAGCATT TAATTGTATT TATATCAAAA ATAAAGTTTC CACCAACTAA
  116701  GTCATTTCCT TTAACTTCAA TTAATCCAGC AGAAGCATTA ATAGTTCCTT GGTGTCCTCC
  116761  AACTATTTTG TGTGCATTCC ACTTAATCAT AGTTTGCGCG GGAACGGCTT TAAACTTTTC
  116821  GGCAGTAACA ACTTGTTCAA CAGTTTTTGC ATTAGTAGTT TCGACTTCTT TATTTTTTTT
  116881  ACATGAAATA AAACTTGCAG TAAGTACAGT AACGGCAAGA ATATTAATAA GCTGTTTTTT
  116941  CATTTTAATA AGTTTATGTT AAAATTTTTC TATTCAAAAG TATAGGTTTT GTGGCTTTTA
  117001  AATCTTAATT AATTATTAAA TTCTTAAAAG GGCACTTGAT TTTAAGAAGT AATTTTAAAT
  117061  TTATTAACGT CTTTTTTGTT GATTATTAGG TTTTTTGGAT TTTGATATTT AGGGTTTTAA
  117121  CAATCATTTT TTGTTTGAAT AATTCTTACA AAAAACATTT AATGACATAT TGGCATATCA
  117181  ATTGAATTGG CAGTACTTTT GCACACTAGT TTTAAACCTA TTAAAACCTT CGGTAACGAA
  117241  GTTCTGGTGT ATAATTTAGG TTAAGCATTA AAAAATAGAA GTAAAAAGAA CTAAAGTAAC
  117301  ATGAGTACAA AAGATAAAGC TAAAGAAACA GTGGATGAAA TAATCCAAGA TTCAACTAAA
  117361  GATGCGAAAG TAGAGGAAAA AGAAACTCAA CCAGTAGAAG AAAAAGATGA GTTAACGCTA
  117421  GCCAAAGAAG CAGCTGCTGT TGAAAAAGAT AAGTTTTTAC GTTTGTTTGC CGAGTTCGAA
  117481  AATTATAAAA AAAGAACTTC AAAAGAGCGT GTTGAATTAT TTAAAACTGC AGGTCAAGAA
  117541  GTTTTACAAG CCTTATTACC AGTTTTAGAT GATTTTGATA GAGCAAGTAA AGAGATTGAA
  117601  AAGTCAGAAG ATGAAGCTTT AAAGCAAGGA GTGACACTTA TTCATAATAA ATTAAAGGAT
  117661  ATTTTAAAGT TAAAAGGCTT GGAGCAGGTT GAAGTAAATA CTGCCGATAC TTTTGATGCA
  117721  GATATCCACG AAGCAATTAC GCAAATTCCA GCACCAAGTG ATGATTTAAA AGGAAAAATC
  117781  ATTGATGTAG TTGAAAAAGG ATATAAACTT GGTGATAAAA TCATTCGTTA CCCTAAAGTG
  117841  GTTACGGGAA ACTAATTAAT TAGGAAATAA TGAAAGAAGA TTTCTACGAC ATACTTGGTA
  117901  TTAGTAAAGG AGCTAGTGCT TCCGAAATAA AGAAAGCTTA CCGTAAAAAA GCGGTACAAT
  117961  ATCACCCAGA TAAAAATCCG GGAGATGCGG AGGCTGAAGA GAATTTTAAA AAAGCAGCAG
  118021  AAGCTTATGA AATATTAAGT GATCCAGATA AAAAAGCTCG TTACGATCAG TACGGACACC
  118081  AAGCCTTTGA AAATGGTGGA GGTGGAGGTG GCTTCGGCGG TATGAATATG GATGACATTT
  118141  TTAGCCAGTT CGGAGATATT TTCGGAGGCG GAGGTGGTTT TGGCGGCTTC GGTGGCGGTG
  118201  GCGGAGGACA ACGTCGTTCC AAAGGGAGTA ATCTTCGTAT TCGTGTAAAG CTTACCTTGG
  118261  AAGAGATTGC TAATGGAGTT GAGAAAAAAG TAAAAGTAAA ACGAAAAGTT CAAGCAGATG
  118321  GAACTACATA TAAAACTTGT GGTACCTGTA ATGGAAGTGG TCAAGTAGTT CGTATTACCA
  118381  ATACTATTCT AGGACGTATG CAAACTGCCG CTCCTTGTAA TGCATGTGGG GGTAGTGGTC
  118441  AGCAAATTGA TAAAAAACCG AATGGAGCAG ATGCTCAAGG GCTAATTGTT AATGAAGAAA
  118501  CGGTAAGCAT TAAGATACCT GCAGGAGTGC AGGATGGTAT GCAATTAAAA GTTTCAGGCA
  118561  AAGGGAATGA AGCGCCAGGA AATGGATTTG CAGGGGATTT ATTGGTTGCC ATAGAGGAAT
  118621  TAGCACATGA AAGTTTACAA CGAGAAGGTG ATAATTTACA CTATGATTTA TATATAAGTT
  118681  TTTCGGATGC TGTTTTAGGT GGATCAAAGG AAATTGATAC CGTATCGGGT AAAGTACGTA
  118741  TTAAAATTGA TGAAGGTGTA CAAAGTGGTA AAATTTTACG CTTACGCGGA AAAGGGATTC
  118801  CAAACTTAAA TGGCTATGGT AAAGGAGATT TATTGGTACA TGTAAATGTT TGGACTCCAA
  118861  AAACTGTAAC TAAAGAGCAA AAAACGTTTT TTGAAAAAAT GAAGGATGAT GATCATTTTT
  118921  CACCTAGTCC AGAAAAGTCA GAAAAATCTT TTTTTGAAAA AGTGAAAGAT ATGTTCTCGT
  118981  AATTAACACG TTAGTTCTAA TTTTTTGTCT ATATTTGATA AAACACTTGT TAAAACGAGT
  119041  GATTTTCTTT TTCATAGCAA TTTTTTTCCC ATCCTATTTT AATTAATAGG GTGGGTTTTG
  119101  TTTTTTAGCA TACTTATAAC TCATATAAGT ATGCTAATTT TAAAACTATT TTATAGCAAT
  119161  TTTATTATGT AGTCTTTGTT AAATTCGGAA CCTTACAAAA AGTAATACAA AATTTAAAAT
  119221  GATTATATGA TTAATGAGAT TTTTGATCAG TTTTCATATT AGACAGATTG AATCTTTATT
  119281  ATAACCAGTA TTTTTTTGAG TTAGGTTAAA AATGAGTATT ATAGCATAAA AAATATTTTT
  119341  TAGTTAAATT CAATACATGA TCATTTTATT TCTACAGCAA AAAATAGCCG AAAAAGTTGT
  119401  AGACACATTA GACAAAAATG TGTGGCAAAA AATACGTGAG ATTCTTACTT TAAAATTAGA
  119461  GTTGGGTGCA TTTAAAATTA GTATTCTTTC CCTTATAATT GTTATAGTCA CATTTATTGT
  119521  AACCAAATAT GCATTATATT TTATAACTAA ATTAATTACT AAAAGACTAG ACAAGGAAAA
  119581  TGTACCTAAG TTTGAATCAC TATTTAGTTT TATAAAATAT TTTATATATG CTTTAGTGGG
  119641  TGTAATGGTT TTTCAGGCTT TGGGTATCAA TTTAACACCA ATTTTAGCGG CTTCAGCAGC
  119701  TTTATTGGTC GGAGTTGGAT TGGCATTACA AACTTTATTT CAGGATATTT TATCTGGAGT
  119761  TTTTATTCTT ATTGATCGCA CTGTAATAGT TGGTGATATT ATTGAATTAG ATGGAAAAGT
  119821  AGGACGTGTT GAAGAAATAA AGTTGAGAAC AACTCGTGCT GTAACTATAG ATAATAAAGT
  119881  TTTAGTAATA CCAAATCATA AGTATTTGAC TAAAAGTTTA TTTAATTGGA CTCAAAATGG
  119941  TAAAAAAACT AGAGATACAG TTGCAGTAGG AGTAGCCTAT GATAGTGATG TTAATTTGGT
  120001  GAAAAAGCTA TTACTTAAAG CGGTTCATGA GAATAAAAAA ATATTGAGTG AACCAGAGCC
  120061  CATCGTACTT TTTGAGGATT TTGGTGATAG TTCATTACAA TTTAAGGTAG TATATACCAT
  120121  TAGCGATAGT TTTATGGGAG CTATCCCCAG GAGTGAATTA CGATTTGAAA TTACTAGATT
  120181  GTTTAGAGAA CATAATATTC AAATTCCTTT CCCTCAACGT GAAATACGTG TATTGAGTGA
  120241  TCATAGGAAT AATTAAAAAA TAAGTATATG TCAAAAATTT TGATTATCGA AGATGAAGCA
  120301  GCCATACGTA GGGTGTTGGT TAAAATCCTT TCGGAAGAGA ATGAAGCCTA TAAAGTATCG
  120361  GAAGCAGGTA ATGGTTTAGA AGGAGTTGAG CTTATTAAAA AAGAAGATTT TGATTTAGTA
  120421  CTTTGTGATA TTAAAATGCC AAAAATGGAT GGTATTGAAG TCTTGGAGGC TATAAATAAA
  120481  GTAAAACCAG AAATACCAGT TGTTATGATT TCGGGTCATG GTGATTTGGA AACAGCCGTA
  120541  AATACAATGC GTTTGGGAGC TTTTGATTAT ATATCTAAAC CACCAGATTT AAATCGCCTT
  120601  TTAAATACAG TACGAAATGC TTTAGATAGA AAAGAACTTG TTGTAGAAAA TAAGCGATTA
  120661  AAGAAAAAGG TTTCCAAGAG TTACGAAATG ATTGGTAATT CGAAAGCAAT TTCTGAAATA
  120721  AAGGAAATTA TTGAAAAAGT AGCCCCCACA GAGGCGCGTG TTTTGGTAAC GGGACCAAAT
  120781  GGTACAGGTA AAGAATTAGT GGCTCATTGG TTACATGAAA AAAGTGAACG ATCTAAAGGG
  120841  CCTTTTATTG AAGTGAATTG TGCAGCCATA CCTTCAGAGT TAATCGAAAG TGAACTTTTT
  120901  GGCCACGTTA AAGGAGCATT TACCTCAGCA AATAAAGATA GGGCAGGTAA ATTTGAGGCT
  120961  GCTAATGGGG GAACAATTTT TTTAGATGAA ATTGGCGATA TGAGTCTTTC AGCGCAAGCA
  121021  AAAGTATTGA GAGCTTTACA GGAGAGCAAA GTGCAGCGTG TAGGTAGTGA TAAAGATATT
  121081  AAAGTAAATG TACGTGTTGT TGCTGCGACG AATAAAGATT TAAAAAAGGA AATTGAGGAC
  121141  AAAAAATTTA GAGAGGATTT ATACCATCGT TTAGCAGTAA TTTTAATAAA AGTGCCTGCG
  121201  TTAAATGATC GTAGAGATGA TATCCCTGAA TTGATCAATC ATTTTTCAAA AAAAATAGCT
  121261  GAAAGCCAAG GGACAATACC AAAAGATTTT TCTGATGAAG CTGTTAAACT ACTACAAAAA
  121321  TACGATTGGA CAGGTAATAT TCGAGAGTTA CGTAATGTGG TAGAACGTTT ACTAATTTTA
  121381  GGAGAAAAAG AAATTAGTGA AAATGACGTA AAATTATTCG CATCTAAGTA ATGAAATTAT
  121441  TTAATACGTT ATTTTTATTT TTTATAGTAA ACTCAATTTT AGCGCAACAT GAACCTGGGG
  121501  CTTGGGTTGT AGGTGTGCAA GGTGCAGCAA AGGTAGATAG GATTTCTGAT GTAGGAGGAA
  121561  GTTTTCAAGT ACATTATGCT CCCAATTGCT ATTCTACTTA CATTGCAGAG GTAGGTGTTT
  121621  TGAATACAAA AGATGGCATA GTACCCGAAT TGGGAATAAC CATAAATTCA ATTATGTTCA
  121681  ATTTTCAAAG TTGGATGATA ACAGGAGGTA TGGGCTTTAT TATGAACAGT GCAGAATTAT
  121741  CTAAAAAAGA GCAAGACGAT GCTATTTTTG CATTTTCGGA TGGAAAAAAT AGCTTTGGTG
  121801  CTTTACTAAA AATAAGAACA TTAGTTCCCA TAAATAAATG GTGGCAATTA AGTTCAGCAT
  121861  TTAATTTTAA AAGTGTAGGA GGTAAATTTT CGACAGTCAC TTTAGGTATA ATTTATGAAT
  121921  TTCCATTAAA AGGTTATTAA TATGAAAGCA GAAAAAGCAA ACAGTAGTTT TAAAATTTCA
  121981  GATGCTAAAA CAACTATCGA TATAGGATTA TCGGAAGATG AATTGAAGGA TGAATTAAAA
  122041  AGTGTTCGTA AAAAGTTAGG TAAACTACAA GATACCCTAT ATGCTCATGG AAAATATGCC
  122101  GTATTAGTTT GTTTACAAGG GATGGATACG GCTGGAAAAG ATAGTTTAAT TCGTGAGGTT
  122161  TTTAAAGATT TTAATACCAG TGGAATAATT GTACACAGTT TTAAAGTACC TAGTACAATT
  122221  GAACGTAATC ATGATTATTT GTGGAGGCAT TATATAGCAC TACCTGCGCG AGGTAAATTT
  122281  GGGATTTTTA ATAGGACACA TTATGAGAAT GTTTTGGTCA CTAGAGTACA TCCAGAATAT
  122341  ATTTTAGGGG AAAATATTCC CCACATTAGT TCTGTTAATG ACGTAGATGA TAAGTTTTGG
  122401  AAACAACGTT TTGAACAAAT TAATGATTTT GAAAAACACT TAACTCAAAA TGGAACTCTA
  122461  ATATTCAAAT TCTTTTTGCA TTTATCTAAA AGGGAACAAA AAAATAGATT ACTCAGAAGG
  122521  CTTGAAAAAA AAGATAAAAA TTGGAAATTC TCACCTGCCG ATTTAAAAGA GCGCAAATTA
  122581  TGGGATGCGT ATCAGGATTG TTATGAAGAT GCTATTCGTA ACACTTCAAC ACTTCAGGCT
  122641  CCTTGGTATG TAATACCAGC AGATCATAAG CCAGTGGCCC GATATCTAGT GGCAAAAACA
  122701  TTATATGACA GTTTAAGTGC TTACACTGAT ATTCAAGAGC CTGAATTAGA GGAGGATGTT
  122761  GTTTTTGAAT TAAGAAATTA CCTACATCAG TTGAAAAGCG AAAAATAAGG TTTTAACATT
  122821  TTAGTAGTTT AAGTTGTTAA AACTTGTTTT TTTGACATTT TTGTTGTGTT AAAATTGTTA
  122881  AATCTGCATT TTGAAATCGA TGAAAGGCAG AATTTGATAA CATGTATTTT TATTTAGTTA
  122941  TCAAATTGGA TAAAATTTAT TTAGTATTTA TAAATGTTTT TTTGGTTTTT TGGTCTTTTG
  123001  TATAAGTGAC GAAAACATTT TCGAAAAACC TATTATGCTG AAAAACAATA TTTTATGAAA
  123061  GAAAAATACT ACACAAAATT AATGTAGTAA TATTCTTACG TTTATAAAAG TGCTTACGAT
  123121  AAAAATGAGT CTATTTTTAA GTTGAATGAA AAGTTTATGT TAATAAACTT TTTTGAAAAA
  123181  TAACTATAAC TTAAAATTAA ACTTATGATT CTTAAGAAAT TAAGTTTGTA TGCTCTAGCA
  123241  TTTTTTGGCA CTTCGGGTTT TGCCCAATCT AGTTTCAATT ATGCTGAAGC ACTACAAAAA
  123301  TCGCTTTTCT TCTATGAAGT TCAGCAATCA GGAGAACTTC CTTCTTGGAA CCGGGTGACA
  123361  TGGCGTGGAG ATTCTGCGCT AAATGATGGT TCCGATGTTG GAGTAGATCT AACTGGTGGA
  123421  TGGTATGACG CTGGTGATCA TGTTAAATTT AATTTCCCAA TGGCATTTAG CGTTACTGCA
  123481  TTGTCTTGGG GAGCAATTGA ATATGAAGAG GCTTACAAAA ATGCTGGGCA GCTAGATATT
  123541  ATTAAAAGAA ATATCAAATT TGTTACTGAT TATTTATTGA AATGTCACAC AGGGCCAACA
  123601  GAATTGTATG GTCAAGTAGG TAATGGTGGT TTGGACCATG CTTATTGGGG ATCGTCAGAG
  123661  GTAATGGTAA TGGATCGACC AGCCTATAAA ATTTCGGCTT CAGCTCCAGG TTCAGATTTA
  123721  GCAGCTGAAA CTGCTGCAGC TATGGCAGCA GCAAGTATCT TGTTTAAGGA CTCTGATCCT
  123781  GCATATAGTA AAACCTTATT AGATCATGCG AAACAGTTAT ATAAATTTGC TGATGATTAT
  123841  AGAGGAGTCT ACTCAGAGGC TATAACAGAT GCAGCAGGTT TTTACAGATC TTTCAGTGGT
  123901  TTTCAAGATG AATTAGTTTG GGGAGCGGCT TGGTTATATC GAGCTACTAA TGACGCTACT
  123961  TATTTGGCTA AAGCAGAATC AGAATATGAT AACTTAGGTA ATGAAGGTCA AAGCAGTAAC
  124021  AAGGCTTACA AATGGGGATT GGCATGGGAT GATAAGTCTT ATGGATCTTA TGTTTTAATG
  124081  TCACAGCTAA CGGGCAAAGA TAAGTATAAA GCTGATGCGG AAAGGCATTT AGATTATTGG
  124141  ACAGATGGTT TTAACGGTGA TAGAGTACCT TATAGTCCTG GGGGGCAGGC TCACTTAACT
  124201  CAGTGGGGAT CGTTGAGGCA TTCATCAAAT ACGTCATTAC TTGCTTTTAT TTATAGTGAT
  124261  AAAGTAGAAA CATCTGCTAC CAACAAAAAG AAGTATCATG ATTTTGCAGT AAGACAAATA
  124321  AATTATGCAC TTGGTGATAA TCCAATAAAC AGAAGTTTTA TGGTTGGTTT TGGAAATAAT
  124381  CCAGCTAATA ACACACACCA TCGTGCTGCA CATGGCGCAT GGGCAAATTC ATTACAGAAT
  124441  AGACCAGACA AGCCAAGTCA TACACTTTTT GGAGCATTAG CAGGAGGGCC AAGTTCTCCC
  124501  AATGATCAGT TTGAGGATGA TAGAGGAGAT TTTATAGCTA ATGAGGTGGC TTGTGATTAT
  124561  AATGCGTGCT TTACTGGAGC ATTAGCTAGA ATGTATAGTG AATTTGGAGG ATCTACTTTA
  124621  GCAAATTTCC CAGTTAAGGA AACTCCAAGT AGAACTGAAA TTAGAAGTTA TTCTAAATTT
  124681  AATAGTAATA ATGCTTTCGG AAGTACAGTT AAAATTTTAT TGCAAAATAG ATCAGCATGG
  124741  CCAGCAAGAG TAATGGATAA GTTAAGTTAT CGCTATTATT TTGATATTGC TGAAGGAGTA
  124801  GCTGCGGGTA AGACAATTGA TGATTATGAT ATTCAATTAA ATGGAGTTGG AGGATCTGCA
  124861  ACTATGTCAA TCAAAAGTGC AGGTGGTACA TTGTATTATG CTGAAATAAG TAATATACCA
  124921  AGTATTTCAC CAATTGGAGA CCCAGCTTTT AGAAACGAAA CTCAAATTAA TTTTAGAGTA
  124981  TCAAACGGAG TGCCTTACGA TACTTCAAAT GATCCTTCAG CTTCAGGCCT TACTGGATCA
  125041  AGTGAAATTG AAAGTGTAAA TATACCCGTT TATGATAATG GTGTCTTAGT ATTTGGACAA
  125101  GAACCAGACG GGACTACTAC ACCAGTAGAT CCAGTAAATA CAGCTCCAGT AGCTAGTATT
  125161  AATGCCGATA AATTTTCAGG AGAAGCACCA TTAACAGTTA CATTTGATGC AAGTGGATCT
  125221  TCAGATGCAG AAAATGATGC ATTAACTTAT GTATGGACTT TTGGTAATGG AGAAACGTCA
  125281  ACGGATGAAA ACCCATCAAC AATATATACT ACAGCAGGAT CTTATTTAGT AAGTTTAGTA
  125341  GTAAATGATG GATTGTTAAA TTCTACTGAA GAAACGATAA CAATTAATGT AAATGACCCA
  125401  GCGGTTAATC CTGTAGTGGT AACTGGAGGA ACATTAAGCG GAGGTCCGTT CACATTTACA
  125461  GTAGGTGATG GGGTTGCAGA TAACGTATCT GGAGTAACAG TATCAGGAAA TACTGGAGCA
  125521  ACAAGCCAAT GGGTTGTAAC TGATGAGACA GGAAAAATTC TTGGATTACC ACCAGCACCA
  125581  GAAGCGGTTA ATTTTGATGA AGCACCTCCA GGAACATGTT TTATATATAA TGTAAGTTAT
  125641  AATGGAACAT TAAATGGGTT GACTGTTGAT GCAAATATTT CAGGTTTATC GGGTGATTTC
  125701  CAATTATCTT CAAATAGAGT AGAAGTGGTG CGTAATGCAC CTATAGTTGT AACACCAATT
  125761  ACTGTTGCTG GAGGAACATT AAATGGAGGT CCATTCACAT TTACAGTGGG TGATGGAATT
  125821  GCGGATAATG TATCGGGAGT ATCGGTATCT GGAAATAGTG GAGCAACAAG TCAATGGGTA
  125881  GTTACTGATG AGGTAGGAAA AATTCTTGGA TTACCACCAA CACCAGAAGC GGTTAATTTT
  125941  GATGAAGCAC CTGCAGGATC ATGTTTTATT TATAATGTGA GTTTTAACGG AGCATTAAAT
  126001  GGTTTAGCTG TTGATTCAAA TATATCAGGC TTATCTGGTG ATTTCCAATT ATCTTCAAAT
  126061  AGTATTGAAG TAGTGCGTAA TGCAGTAGTA GTGGTAACAC CACCTACTGG TGATTGTACT
  126121  TTTGGAGCGC CTATTGCAAC TCCATTAGAA ACTACTTATG GGTATTATAC TAATATGTAT
  126181  GCTTTTGGTA GTAGTGCACC AAGTATGGGT AACTTATCTG GGTTCTCATT TAATTGGGAT
  126241  TTAGCGAATA ATGGATTGTG GAGTATTGCA ATTCAGACTA CCGATGGAAA CCCTAGTTAT
  126301  TATGTGGATT TAAGAGATAA AACAACTCAT AATTTAGGTG CAAGTCAGCC AAGTATTACA
  126361  TTCGCTGGCA CAGGAATTCC TGGTCTTGAT GGAACATATT ACACTGCAAG AGATGGTGAA
  126421  AATTTAGCTC TTGTATCTAC TACAGCTGAT TATACACTTT ATTTCTCAAA TTCATCTACC
  126481  GCTCCAGATT GTGGGGACGT TATTGATACT CCAATAGTAG TTAATGGAGG TACATTAACT
  126541  GGAGGACCAT TTGCTTTTAC AGTAAATGAT GGAATTGCAG ATAATGTTTC GGGAGTAAGT
  126601  GTAACAGGAA ATACGGGATC TAATTTTGGT TGGATAGTAA CTGATGAAGA TTTAAATATT
  126661  TTAGGTTTAC CAGGAACACC AGAGGCAGTA AACTTTGACG AAGCTGGAGC TGGAGTTTGT
  126721  TTAATATGGC ATATTGCTTA TGAAGATGGT TTGACTGGAC TTACTGCAGG AGAGAATGCA
  126781  GGAAATTTAG TTGGTAACTT TGATTTATCA AACAGTATTC GTGTGGACAG GACAGCTGCT
  126841  ATACCATCAA CTGTTGATGG AGGTACTATA GTTGGAGGAC CATTTACTTT TACAGTAGGT
  126901  GACGGAATTG CGGATAATGT TTCGGGAGTA AGTGTATCAG GAAATACTGG ATCTAATTTT
  126961  GGTTGGGTAG TAACTGACGA AGATTTAAAT ATTTTAGGTT TACCAGGAAC GCCAGAGGCA
  127021  GTTAATTTTG ACGAAGCACC TGCAGGAGTT TGTTTAATAT GGCATATTGC TTATGAAGAT
  127081  GGATTAACAG GACTTACTGT TGGTGAAAAT GCAGGTAATT TAGCTGGTGA TTTTGATTTA
  127141  TCAAATAGTA TTAGAGTTGA TAGAACAGGA ACTAATGTTC CAACGCCAAC GGTTGATGGT
  127201  GCTACAGTTG CTACTTCAAC TGGTGCTGTT GCAGTAGAAA CAATTACTGG AGATGGTATT
  127261  GCTGATTTGA TTAATTTCAC AACAACAAGT ACTGCTACGC TTAATTATTC ATATTTAATT
  127321  ACGGATGCTG CAGGTAATAT TTTAGTTGTT GAAGCTGATT CTCATGATTT TGAAGGCGTA
  127381  TCAGTTGGAG TTTGTTTAGT ATATGGTATT TCTTATGAAG GTACTTTATC TGTTACTGGA
  127441  AAATCAATTA CAGATACGGA TTTAGCATCA GGTGCATTTG ATGTATCGGA TAATTCAATT
  127501  TCTGTAGATA GAAAAGATAT ACCAGTAGTG GTTGATCCAA CAGATCCTAC AACAGGAGGA
  127561  CCTGATGTAA ATAATAAATA TATCGAGCGT TTTACTGAAA TGAGAAACGA AATTTATGAT
  127621  CCAGCTAATG GGTATTTCAG TAAAGATGGT TCTCCGCATC ACTCTGTGGA AACACTTATT
  127681  GTTGAAGCAC CAGATCATGG TCACGAATCA ACTTCTGAAT TATATTCATA TTGGTTAATG
  127741  ATGGAAGCTA TGCAAGGTCG TATTACTAAA GACTGGCAGC CATTAGCTAA AGTTTGGAGT
  127801  GAAATGGAAA GAATGATTAT TCCAACTAAA GCAGATCAGC CAACAAATGC AGCTTATGAT
  127861  GCTTCTAGTC CTGCGGCTTA TGCGGCAGAA TTCCCTTTAC CATCAGGTTA CCCAGCACCT
  127921  TTAGATTTTG GTGCAGCAGT TGGTCAAGAC CCTGTTTCTG CCGAATTAAC AGCAGCTTAT
  127981  GGACCAGAGG TTTATCAAAT GCACTGGTTA TTAGATAATG ATAACTTTTA TGGATATGGA
  128041  AATAGAGGTG ATGGAACAAG TACTCCTTCA TACATAAATA CATTCCAAAG AGGGGAGCAA
  128101  GAGTCAGTTT ATGAAACTAT TCCTCATCCA TCATGGGAGT CATTTGAATT TGGTAATTCA
  128161  GAAAATGGAT TCTTACCATT ATTTATTTTA GATACTAATT ATGCTAAGCA ATGGAGATAT
  128221  ACAAGTGCTC CTGATGCTGA TGCACGTGCA GTACAGGCAA TGTATTGGGC AGTTCAATAT
  128281  GCAAAAGAGC AAAGTGGAGC AATTGATCCA ACACTTTTAG ATAACACTAA AAAGATGGGT
  128341  GATTACTTAC GTTTGGCTAT GTTTGATAAG TATTTCAAGA AAATTGGTTC TCAAGACGAA
  128401  CAAGGTAGTG CAGGTACTGG ATATGATAGT GCTCACTATT TAATGTCATG GTACATGTCA
  128461  TGGGGAGGAT CTGCCGATCC GGCTTCAGCA TGGGCTTTCC GTATTAGTTC AAGTCACTGT
  128521  CACTTTGGAT ATCAAAATCC AGTTGCGGCA TATGCGTTAA CTACATTGGA TGAGTTAGAT
  128581  CTTCAAACTC CTAATGGAGA AAGAGATTGG ACAACAAGTT TAGGGCGTCA AATGGAATTC
  128641  TACAGATATT TACAATCTGC TGATGGAGCT ATTGCAGGTG GAGCAACTAA TAGTTGGAAT
  128701  GGTGACTATA GTACTTATCC AGCTGGTAAA TCTACTTTCT ATGATATGGC TTATGATGAT
  128761  AATCCAGTAT ATCATGATCC AGGAAGTGGA ACTTGGTTTG GATGGCAAGC TTGGTCAGTA
  128821  GAACGTGTAG CTGAATATTA CTACATTACT AATGACCCAT TAGCTAAAGA GATCATGGAT
  128881  AAGTGGGTTG CATGGGTTAA ACCTAATGTA AAATTAATTG GAAGCGATGA TTTTGATATT
  128941  CCAGCAACAT TAGAATGGTC AGGAGAGCCA GATACATGGA ATGCAGCAAA TCCTGGTGAT
  129001  AATGCTAATT TACGTGTAAC TGTTACTAAC TTTAGTAAGG ATTTAGGTAT AGCATCTTCA
  129061  TTAGCTAAAA CATTGACTTA CTATGCGGCA GCAACAAGAA AGCATGCTAC TTTAGATGAA
  129121  GAAGCTAAAA ATTTAGCTAA AGAAATCTTA GATAGAATGT GGGTAACTTA CCGTGATGAT
  129181  AAAGGAGTTT CTGCTCCAGA ATCACGTGGA GATTACAAGC GTATGTTCGA AGAAGTTGTT
  129241  CATGTACCAA CTGGTTATAC AGGAACAATG GCTAATGGTG ACGAAATTAA AACAGGAGTT
  129301  ACTTTCTTAG ATATTCGTTC TGGTTTAAAA GATGATCCTG AATATCCAGC AGTAAAAGCA
  129361  GCTTATGATG CAGGTGAAGA CTATACAACT AGATACCACA GAACTTGGGC GCAAATGGAA
  129421  ACTGCTTTAG CTAACGCTGA ATATGGATTC TTCTTTGGTG AAGATGATGA GGCAGCTGGA
  129481  GCAAAAGCTT TAGATGTTGA GTTAACGGTG TATCCTAATC CAGCATCTGA ATTAGTTACA
  129541  GTTACTTATC CAACTGAAGA AGATGTTGCT TTAAAAGTAA CATTAGTAGA TTTTGCAGGA
  129601  AGAGTGATTA CTACTCAAGA GTTATTGAAT GAAAAATCAA CAACAATTGA TGTGAGTAAC
  129661  CTAGCTTCAG GAATGTATAT AGTTCGTTTA GAAACTAAAG GAAATGTAAT ACGTACCGAA
  129721  AAGCTTATTA TAAAATAAAT TAATAGTAGT TTATTTGTTG AAAGAGGTTG ACTTTTATTA
  129781  GTCAGCCTCT TTTTTTTATG TCAAATTTGT ATTTGATTCT TGGGGAAACA TTATGCCAAA
  129841  TATTACTGGA ATAATAATAC CTTAGCTTCA AAAAAAGTGC TTTCTAAATA TATAAAGGAG
  129901  TTCCCTGTTA ATTTACGTTT AGCTTACCCA ATTATGATAG GTCAGTTAGG AAATGTGATG
  129961  GTTGGTTTCA TAGATAACGT AATGGTAGGA AAATTAGGAG CTTCTTCATT AGCAGCCGTA
  130021  TCTTTAGGGA ATGGACTATT TTTTTTGGCA TTATCCTTAG CAATAGGTTT TTCACTTAGT
  130081  ATCACTCCAC TGGTAGCAGA AGCAGATGGT CAAAAAGATT ATTTAAAAAT AAGCTTACTT
  130141  TTAAAAAATG GAATAGCATT ATCAACCTTA TTAGGTGGTG CTTTATTTGT TGTTATTAAA
  130201  TTATTACAAC CTTTTTTAAC ATTATTAGAT CAGCCAGAGG AGGTAGTGGT ATTGGCCAAT
  130261  CCTTATATAA ATATACTGGC ATTTTCAATT ATACCTTTGG CTATGTTTCA AGCTATGAAA
  130321  CAATTTTCCG ATGGTTTATC GGTAACTCGA TATGCAATGA TTGCCACTAT AATAGGTAAT
  130381  GTGCTTAATG TTTTTTTTAA TTATGTGCTT ATTTATGGAA AATGGGGATT CCCAAAACTT
  130441  TTATTAGAAG GAGCAGCGAT AGGGACTTTA ATTGCCAGGT TTTCAATGGT GTTTTTTATG
  130501  CTGCTAATAT TTTATAAACA GCAAAATTTT AAAGTATATG TTAGCAATAT CTTTTCAAAT
  130561  ATTTTGCAAT TAAATATTGT AAAGAACTTA TTAAAATTAG GATTCCCAGC TGCATTACAA
  130621  ATGCTTTTCG AGTTTGGTAT TTTTATTTCT TCAATATTTT TGTCTGGTTT ATTAAGTACC
  130681  GAGGATCAAG CAGCGAATCA AATAGCGCTT AATGTAGCGT CTATTACATT TATGATAGCT
  130741  GTTGGTTTAG GTGTAACCGC AACAATACGA ACAGGAAATC AATTAGGGAA AAAAGATTTT
  130801  AAAGCTTTAA TACGAATAGT GCGTTCAATT TTATTATTGG TTTTTTTAAT AGAATTTGTT
  130861  TTTGCTATTG TTCTAGTATT TTTGAAAGAT TATTTGCCTG TTTTTTACAT TAGTGATGTA
  130921  AATGTAATTG CACTAGCTGC CAAATTATTA CTCGTAGTAG CTTGTTTCCA AATTAGTGAT
  130981  GGATTTCAGG TAGTTTTATT AGGAACACTC CGGGGATTAC AGGATGTAAA TATTCCTACT
  131041  TTATGTCTGT TTATTGCTTA TTGGTGCGTA GGTTTTCCAA TTTCATACTA TTTAGGAAAT
  131101  CCTTCCTATT TAGGTTCGGT GGGCATTTGG ATAGGCTTAT TTGCAGGTTT AACCGTTTCG
  131161  AGTGGCTTAT TATATATTCG CTATTTGTAT TTAAGTAAGA AGTTTAATTA ATTGAGTAAA
  131221  AGCATAAAAA AAGCCTTCTT TAAAAAAGAA AGCTTTTTGA TTTATTTTTA GGTGTATATT
  131281  TATTTATACA TCACTTTTTT TACAGCTTTA ATAACATCTT CATTATTTGG TAACCATTCG
  131341  GCTAGCAAAG TAGGAGAGTA AGGAGCTGGA GTATCAGCGG TATTTATTTT AATTACTGGC
  131401  GCATCTAAGT AATCAAAACA ATTTTGTTGT ACTTGGTATG TAATTTCCGA AGCAATGTTA
  131461  GCTAATGGCC AAGCTTCTTC AAGTATGATA AGTCTGTTCG TCTTTTTTAC AGATTTATAA
  131521  ATAGCTTCTA AATCCAAAGG ACGTACCGTA CGTAAATCAA TAATTTCACA TGAAATTCCT
  131581  TCTTTAGCTA ACGTGTCTGC AGCAATGTAT GCTTCTTTAA TAATTTTTCC AAAAGAAACA
  131641  ATAGTTACAT CGTTTCCTTC TCTTTTTAAG TCAGCTACAC CAATTGGTAA TACATATTCC
  131701  CCTTCCGGTA CTTCACCTTT GTCACCATAC ATTTGCTCAC TTTCCATAAA AATAACAGGA
  131761  TCGTTATCAC GGATAGCAGC TTTTAATAAT CCTTTAGCAT CATATGGGTT AGAAGGTACA
  131821  ATAACTTTTA ATCCAGGAGT GTTGGCAAAC CAATTTTCAA AAGCTTGTGA GTGTGTAGCT
  131881  CCTAATTGTC CAGCAGAAGC TGTTGGTCCT CTAAAAACGA TAGGGCAAGG GAATTGTCCT
  131941  CCCGACATTT GACGAATTTT AGCAGCATTA TTGATAATTT GATCAATACC TACCAATGAA
  132001  AAATTAAATG TCATATATTC TACAATAGGG CGGTTACCGT TCATGGCACT ACCTACAGCG
  132061  ATACCAGCAA AACCAAGTTC AGCAATTGGA GTATCGATCA CACGTTTTGC GCCAAACTCA
  132121  TCTAACATTC CTTTACTTGC TTTATATGCA CCGTTATATT CTGCTACTTC TTCACCCATT
  132181  AAGTAAATAG ATTCATCTCT ACGCATCTCT TCAGACATCG CTTCGCAAAT AGCTTCTCTA
  132241  AATTGTATTG TTTTCATGTA AGTTTATAAA TTTTAGCATC ACATAAAATG AATGCTAGTT
  132301  TTAGTTACTC TAAACGCAAA AATAGTAAAA CCACAATGTT GGGGCAAGCT ACAAGCTTGG
  132361  AATCTGTAAA TATTTTTAAG ATTAAATGGT GACTGTTAAA ATTCGCAAAA ATACTATGCA
  132421  TGCATAGTAT TTTTGCGAAT TAATTTGTAA CTTCGTTTAT ATATAAGAAA CCGCTTATAA
  132481  AACTTTTGAT TTGGTAATAA ATTAAGAGTT TATTTTTTAA GTAAGCAATT GATAGATTGA
  132541  TTATTCAAAA ATAAGATATG CGTAGTTTAT ATGTGAAAAA GTTAAAAAAT ACACTAATTT
  132601  AAAATACTTA CTGTGAAGAT ATTAGTTTGT ATAAGTCATG TGCCAGACAC GACTTCAAAA
  132661  ATCAATTTTA CTGATGACGA TACTAAGTTT GATACCAATG GAGTATCATT TGTGATTAAT
  132721  CCGAATGATG AATTTGGATT AACAAGAGCC ATGTGGTTTA AGGAGAAACA AGGAGCTAGT
  132781  GTGGATGTTG TAAATGTAGG AGGTCCAGAT ACAGAGCCAA CAATTAGAAA ATGCTTAGCA
  132841  ATAGGAGCAG ATAATGCGAT TCGAGTAAAT GCGAACCCAA CAGATAGTTT GTTTGTAGCC
  132901  CAAGAGCTAG CATCGGTAGC TAAAAATGGG GGGTATGATT TAGTTATAGC GGGTCGCGAG
  132961  TCTATTGATT ATAATGGAGG TGTAGTGCCA GGAATGTTAG CCGCTTTATT AGATGCCAAT
  133021  TTTGTAAATA CTTGTATTAG TTTGGAAGTC GAAGGAACAT CGGCTACAGC TATTCGTGAA
  133081  ATTGATGGAG GTAAAGAAAC CATAAAAGCA ACCTTGCCTC TAGTCATAGG AGGACAAAAA
  133141  GGTTTGGTTG AAGAAAGTGA TTTAAGAATT CCTAATATGA GAGGAATTAT GATGGCTCGT
  133201  AAAAAACCAC TTAGCGTTGT AGAACCAACG GGTAGCGCTA GTCAATCTGA ACCAAGTTCA
  133261  TTTTCTAAGC CAGCTCCTAA GGGAAGTGTG ACTTTAGTAT CAGCAGATAA TTTAGATGAG
  133321  TTGATTAACT TGTTACACAA AGAAGCTAAA GTAATTTAAT TACCAAGGCT TTGATTATCT
  133381  TTAAGTGATT GATTTTAACT GTAAATTATA GTTAATTTTA ATTTTTTGTT GAATAAAATA
  133441  TGCTGAATTA TTTAGCATGA TAAAATATAA AATATGTCAG TTTTAATATA TGCCGAAAGT
  133501  GATAACGGAA GCTTACGTAA AGGAGCTTTT GAAGTAGCAT CATACGCAAA AGGAGTGGCC
  133561  GATGCATTGG GAACTACTGT AACTGCGTTG ACAGTGAATG TTAGTGATGT ATCAGAACTA
  133621  GGGAATTATG GAGTATCAAA AGTGCTTCAA GTATCAGATA ATGCATTAAC TAAATTTCAA
  133681  GCAAAAGCTT ACTCAAGTAT TATTGAGCAA GCTGCTAAAG CAGAACAAAG TAAAGTTGTT
  133741  GTATTAAGTT CATCTACAAA TAGTAAATAT GCAGCACCTT TATTAGGAGT AGCATTAAAT
  133801  GCAGCTGTGG TTTCAAATGT AGTGAGTTTG CCAAAATCGA CAAGTCCATT TGTAGTAGAG
  133861  CGTACAGCTT TTACAAACAA GGCTTTTCAG GAAACACAAA TAAATTCGGA TGTAAAAGTG
  133921  ATTTGTGTAT CAAATAATTC ATATGGATTA AAGGAAACTA GTGTTTCTAT TGAAGCAGAA
  133981  GCTTTTTCTC CGAGTGTGAA TGGAGGTAGT TTAGAAGTAG TAAGTATTGA TAAAGCTACT
  134041  GATAAAGTAA GTATTGCTGA TGCAGAAGTC GTAGTATCTG GTGGACGTGG GTTAAAAGGA
  134101  CCAGAAAATT GGCATTTAAT TGAAGATTTA GCTACTGTTT TAGGAGCTGC AACAGCATGT
  134161  TCAAAACCCG TTAGTGATAT GGGATGGAGA CCACATTCGG AACACGTAGG TCAAACAGGA
  134221  AAACCCGTAG CTACAAATTT ATATATTGCC GTAGGTATTT CTGGAGCAAT TCAGCATTTA
  134281  GCAGGGATTA ACGCTAGTAA AGTAAAAGTG GTTGTTAATA CGGATCCAGA AGCTCCATTT
  134341  TTTAAAGCAG CAGATTATGG TGTTGTAGGT GATGCTTTTG AGGTAGTGCC TCAGTTAATT
  134401  GAAAAGTTAA AAGCATTCAA GTCAACAAAT TAATATTCTT TACAAAAAAG AGAAACTATA
  134461  TGAATTGAAT TTTTAGCTGT AAGAATTTCG CTAAAAATGA TAAATTCGTT TTTTTTATAT
  134521  AGAAACCGTA TGAAACTTCT TTTTTATACG GTTTTTTCTT TCTTAAATAG AAAAATTATA
  134581  CCGAATTTAG CTTAACATTG TTATCAATAT ATGAGTTTAG TACGTTTAAA CATTAGAGGG
  134641  ATTTCTTATA GTCAGACACA AAATGGGGCT TATGCACTTA TTTTGAGCGA AATGGAAGGA
  134701  GAACGGAAAT TACCTATTGT AATTGGTGCT TTTGAAGCAC AATCTATAGC TATAGCATTA
  134761  GAAAAGGAAA TAAGACCGCC AAGACCCTTA ACACACGATT TATTTAAAAA TTTTGCAGAT
  134821  AGGTTTGATG TAGTAGTAAA GCAAGTTATT ATCCATAAGC TTGTGGATGG TGTATTTTAT
  134881  TCCAGTATTA TTTGTGAACG TGATGGCATT GAGGAGATTA TTGATGCAAG GACGAGTGAC
  134941  GCTATAGCAT TGGCTTTACG TTTTAGAGCT CCTATTTTTA CGTATAAAAA TATATTAGAT
  135001  CAAGCAGGAA TTTACTTGAA ACAACAATCT GATGGAGAAT TTTTATCCGA AAATGTAGAT
  135061  GGTCCAGAAG AGGATTCAAG TGATGAGAAA TCGGTAGAAC TAGTATCGTC ATCAGCTGAT
  135121  TTTAAAAATT TAACTGTTGA TGAACTTTAT AAGTTATTAG ATAAAGCGGT AACGGATGAA
  135181  GATTATGAAA AAGCGGCCCG ACTTCGCGAT GAAATATCAA ACAGAAACTA GCAGTCATTG
  135241  ACTGCTTTTT TGTATAATGT TTACAAATTA GTAATCTTAT TTACTTTTTT TAAGTAACAA
  135301  TATTCACCTA TTTTATATTT TTGTTTTTTC ATAAATATAT TATTCCAGTA GTTTACATTG
  135361  GAATAAGCCT ACACTCAATA AAATGAAGCA ATATTTAGAC TTAGTGCAGC ATGTAATGGA
  135421  TAATGGAGCT GTAAAAGGAG ACCGTACAGG TACAGGAACA CGAAGTGTTT TTGGATATCA
  135481  AATGCGTTTT GATTTATCTA AAGGCTTTCC TATGGTAACT ACAAAAAAAG TACATTTTAA
  135541  GTCTGTAGTA TATGAATTAC TTTGGTTTTT AAAGGGGGAT ACTAATATTA AGTATTTATC
  135601  AGACCATGGA GTACGTATTT GGAATGATTG GGCTAATGAT AATGGGGATT TAGGCCCTGT
  135661  ATATGGTCAC CAGTGGCGTA ATTGGAATAA TGAGGAAATA GATCAGATTA AGGAAATTGT
  135721  TGAAACTTTA AAAAAGAATC CAAATAGTCG CAGAATGTTA GTTTCAGCTT GGAATCCATC
  135781  GGTAATGCCA GATACGTCTG TTTCTTTTGA AGAAAATGTG GCTAATGGAA AAGCGGCTTT
  135841  ACCGCCATGT CATGCATTTT TTCAGTTTTA TGTGGCTAAT GGAAAATTGT CATGTCAATT
  135901  ATACCAACGT AGTGCCGATA TATTTTTGGG AGTACCTTTT AATATTGCAT CATACGCATT
  135961  GTTAACTGAA ATGATGGCGC AAGTATGCGG TTATGAGGCA GGGGAGTTCA TTCATACTTT
  136021  TGGTGATGCT CATATATATA ATGATCATGT GGAGCAGTTA CAATTACAAC TTTCTAGATC
  136081  GCCAAAGCCC TTACCAAAAA TTAAAATGAA CCCTAATAAA ACAGATCTAT TTGATTTTAA
  136141  ATTTGAGGAT TTTGAATTAG TAGATTATGA ACATCATCCG CACATAAAAG GTAAAGTTTC
  136201  GGTCTAATCT TTTTGCAGTT ATATAGGAAG ACTATCCTAA AATAAGATCT CATAATTTTT
  136261  AAAAGAGCTC AATATCAATA GTTTGATGTT TGAGCTCTTT CAGGTTTAAT AATGATTACT
  136321  TATGCTATGA TGTTACATAA GTAATTTGAA TTATTTTACC AGTTAAAAAC AAATATTATT
  136381  TTGTGCATTG CCGCCATACA TTTTTCTTAA CGCTCTTTTA TCAGCTTCAG TAAAATTATT
  136441  AAAAGGCCAA ACAGCCGGGT TAAAAGGAAG GTTGCCTGCA GAATTCATAA TTGAATTTCG
  136501  ATCCCTATTA GGTGTTCCCG GAATATGTTG CCCTTTTTCT TGATTGTCAA TTTCATTAGT
  136561  ATGTAAAAAT CCTAAGTTGT GACCAATCTC GTGTCTTATC ACAAAACGCA TTCTTTCACC
  136621  TCTTCTGGGG ATTCCTTTAT AAAAATCAGG ATCAAAATAA ACTGTTCGTC CTGGTTTTCC
  136681  GTTTCTAGGT CTGTCAGCAG CTCCAGCTAC CCCTTTTACA CGCATTATGG TCATATCTGC
  136741  ATTGCCTCCA TTTACTAAAC GTAACCTTAA AAAGCTTCCC CTGATTCTAT TCCAGTCGTT
  136801  TAGTGCATTT CGCACCTGGG TATTGATACT AGGGATTAAG TTTCTAACGG TTACATCTCG
  136861  GGCTTCACTA CATCTCATAA TACTATTAAA TCGACGTTGT TTACCTTTTG GATCTGTATG
  136921  AGCAGCTTCA AGTATACTTT CTTTATCTAC GATCATATCA CCTCCCACAA GGTAGTGATT
  136981  CCCTAGGTTT TCAATTTTGT CTAGTACCGT ATCATATCCC ATATTTTGTA AGCCTTTAAC
  137041  AATTTCTGGA GATACTTCAT TACTAACGGG AGTGAAATTA ACAACAGGTA AATCTAAATT
  137101  GGCTTCTTGG TTTTCTATAC TTGTCTCTTC GGTTGGTTGA ATGTCTGCGG TGTTTTCATC
  137161  CTGACATTGG ACCATTAAAA TAGCAGTTGT TGCTATTGCA ACTATTTTAA GTTTTTTCAT
  137221  TCTTTGTGAA TTTTTAAGTT AATTATTTAA ATTTTGTTTG CAAACGACTG ACTATTATAG
  137281  TTAGTAATAT AACGTTTGAG TACGTGTAAG ACCCTATTGA TGTAATAGTT AAAAAAAATA
  137341  TAATTTCAAG ATTAAAAAAT GGAAGGAGTT TATTTGAGAG ATAAAAATTA TTCAATTAGA
  137401  ACATATACCA TTTAAAAAGT TAAAAAGAGG AGTATAGCCT TGGAATAAAA GTTGATTTTT
  137461  TAAATTAAAA GTGGATTTAT CGATAGAATT TTAATGTATT CATTGTACAT AACGACTAAA
  137521  AATTACTACG AACATACGAA CAGTTGACTA TATAACTGTA ATGGATTTTT AAAAAAATCT
  137581  CAGATATACG TACTAGTTAG GGTATGTTTT AGATTAATTG ATACTTGAAT TTTGAGTATG
  137641  AATTTACTCA CTTATTATTT TCGATTATGA AGAAATAAAA AAGTAATGGT TTTCGTTTTT
  137701  TAATGAATAA CATTAACTAA TTAACAAAAC ATTTATGAAG AAGTTATCGA GATTCGCATT
  137761  GGTCATGTTT TTGATCAATA TGTTTATAAT CGTTAGTTGT GATCCTACGG AGGATCCAGA
  137821  AAACACACCA GAAAAACCAC CTATTGAAGA CCCAGATGAT GGAGGTATTA TGAGGCCAGA
  137881  CGAACCTATG GTTCCCGTTG TACCAACTAA TCCAGAACCC GAAAAGCCGA CTAATCCAGA
  137941  GCCGGAGAAA CCAACTAATC CAGAGCCAGA AAAGCCGACT AATCCAGAGC CAGAGAAACC
  138001  AACAAATCCA GAGCCAGAAA AGCCGACTAA TCCAGAGCCA GAGAAACCAA CAAATCCAGA
  138061  GCCAGAAAAG CCGACTAATC CAGAGCCAGA GAAACCAACA AATCCAGAGC CAGAAAAGCC
  138121  GACTAATCCA GAGCCAGAGA AACCAACAAA TCCTGAGCCT GAAAAGCCGA CTAATCCAGA
  138181  GCCAGTGATA CCAACTGATC CTGAGCCTGA AAAGCCGACT AATCCAGAAC CAGTAATACC
  138241  AACTGATCCA GAACCAGAAC CGGAAAAGCC AACTAATCCA GTAAATGAAG GACAAAATAC
  138301  TTCATATACA GATGAAGTAG ATCGTGAGCT TTTTAAGCAA TTAAAAGGTC ATGTGGATTA
  138361  CTATAATAAA AAAGAATTTT TTGATGATTT TCTTTTTGAA AAATATCCTA TGTATTTAGT
  138421  GCAAACAGAC TCGTGGTCTT TTAGTAGTGC GGGTAATGCA AAAAAAGCTT TTGTAATTAA
  138481  CCCTAAAAAA GTGACTAGTG CAATGAAAAA ATTAGGGTCT AATGAATCAA TGGGATTAAA
  138541  TGTATATCGT TTTGATGATT CCATGAACAA TGCTATGAAT AGATTAGCTA ATGGAAATGA
  138601  TTTTTTTACA TTTAACTATT CGCTAAATAA TCAAGAGGGA TATTACTTGC AAGTGTACGC
  138661  TAGAAACATA ACATTAGGTA GAAATAATGA AACAGCGGTA ACCACAATTA CTCATGAAGC
  138721  TTTCCATGCA TTACATCAAA AAAAGGGGCC ACTTAATCCA AATTGGAAGT TCAATTTTGA
  138781  TGGGATTCAA GATAAATCAT CTTTTCCGTA TACTAGAGAT TTAGTGGAGT TACAAATATT
  138841  AGTTACAGAA GTGTTGATTG ATTTCCCTAA TGTTACCGAC AAAAATGTGT TGAAAGAAAA
  138901  ATTAAAGCAA TATGTAGCTA TTCGATCTAA AGAAATGGAA CTAGATCCTA CTAGTCGAAA
  138961  ACTAATAAAA AATATGTCAC TCAATCAAGA GCGTTCTGAA GGGGCACCAC ATATGATTGA
  139021  ATTTATGGGA AAAAGAGACT ATTTTAAGAA TAATGATAAA TTCTTTGGAA CTTTGTATGG
  139081  GATTCCTATG AAAGCTAAGG ATAGAGCAGA CCTAAAAGAT ATGTTGAATT CTGGGAATTT
  139141  TTATCCTGTT GGGGCATCTG TACTTTATGC TATAGCTAAA CTGGATAAAG AAAGAATGAA
  139201  AGACTACAAT AGCAAAACAC CTTTCCAAAT GGCAAGTGAA ATGTTAAATA TGAGTGATAG
  139261  TGAAAAGGAA GAAGCTATTG AAGCAGCTAA ATTATCAGTT GATTGGGGTG CCATTCAAAA
  139321  AAAGGCAGCT GATTTTACTC CTTAAAATAA CTAGTAACAT CACTTAATAG ATTTTTATAG
  139381  ACTAAAAATC ATTTAAAACC TCTGGATAAA TAGTAGTGTA TTTTGTTCAG AGGTTTTTTA
  139441  TATAAAATAG AGGTTAATAT GTATGTTGTT ACTGTTTAGT ATTTGCAAAT CAATTATTCA
  139501  CAAAAAAAAA TAAATCTTTT GTTCATTTGT TCTGAAAATC CTTAAAATAA CATATCCATA
  139561  TAAAATCAAT AGCTTTAATT TAATAAGGAT GAATACAAGG TTATAAAATA ATTACTCTTA
  139621  AACCATATAA TCTCTTCTTG GTTAGCTTTA GGGAAAAATA AGAACTAACT GTAGAATTAG
  139681  AAATAACTCC AAGTTTATGG ACATGAATAC TTAAGTCTAG CTTTGTTCAA GTAAAACTAT
  139741  ATCATTGTGT ATTGTTTTTA TCCACAAAAC TATTAATTAG GACGTAGTTG TTTTTCGATA
  139801  AATTGAATAT TATATGTAAA TAATAAGGCA GAAAGCTTAT AAAAATTAGA GTTCTAACAC
  139861  TCCATTTTCG CCACCAGCAA AATCATTCCA TATATAATTA TCTGCGCTAT CATCATTGAC
  139921  CCATGAGTTA TTATCAACTA GGTATTTAAA TTGAAATGAG TTTTCAATGG GTAAATTAAT
  139981  TGAGCCTTTA AAAGTACCGT TTTTTAATTT TTTTAAGGGT AATTGAGTGG TTTCCCAATT
  140041  ATTGAAATCA CCAGCAACAG TAACCGATTT TGCCTCTTTT GCATTCCATA CAAAAGTAAC
  140101  TTTACACTCA GGTTTAGATT TTAAAAATTG TTTTGAAATT GACATAATTT AGTTTTAGTA
  140161  ATAAAAAATT CTATTACTAA ATTTACAAAA TAATTTAAAA ATAAATTATT GTTACTTATT
  140221  TAGTTTACAG TAAATTAACA TAAGTATTTG ATCGAACTAG ACTTTTTTAA TACAATAGCG
  140281  ACTAAATTTT TGATGGTATT CATAAAATTT AGCCGCTATT AATATAATGT TCACTTATTA
  140341  TTTTTGTTTT TTTTAATTTT TAATAAATAA CAAGTCTTTT AGTTTCTACA AGCTTTTTGT
  140401  GATCATTTTT AAAAATTAAA TAATAAATAC CACTAGCAAC TGTACTCACA TCAATAGTTG
  140461  TTGTTGTAGC TAAAGGGTAG GAGTTAATTT CTTTACCTAA AGCATCACAT AAAATCACAT
  140521  TTTTAACAGG TGAATTTTTA AGATTTTCAA TGCTAAGAGT AGCTGTTACT GGTATGGGGT
  140581  AAATTTTGAA TTCTTCATCA TGATCAGTGA TATCATCAAT ACTAAGTGTA TTTGTTTTTT
  140641  TATGAATTGT TGGATTTAAA GATCCAATTC CCCTAGTAGC TTGCCAAAAA TTGTAGAGTC
  140701  TTTTATCATC GTGATCTGCT TTTTGAGTGG TTACTTTAAT TATGGCATCA TATTCTTCCC
  140761  ATTCTTTTTC TGTAAGGGCA GTTTTAGTTA TAATTACCGT CAACATATTA AATTCTTTTT
  140821  GTGAGTTTTT ATATGAGGGA TTTCTAGGGC CAAGATCATT TAATATTTTT TCTGGCGTAT
  140881  ATCTTATTAC CTCACCTGCT TTAAATGTGT AGGAAGTAAA ATCCCCAGTA TCCTTATCTT
  140941  CCTCAAAAGA AAAATCCGTT ACATTTGAAA ATGAATCAAA TGGTGCGACT TCCTCTAAGG
  141001  GAATCATCCC CATTAGATAT AATTCAAATT CGTTATAGGG TACTTGATTA CCTCCGTTGG
  141061  CATTAAAACT AAACCCCGGA GTGGTAAAGC TTCCATCTTT GTTTTTAATT AAATCACTTT
  141121  GTTTAAAGCC CCCAAGTTGT CCAGGAGTAC TCCCTCCGGT TAATCCCCAA TGCCCTGGTA
  141181  TTTTACTAAA AGTAAACGAA CCGTCTTCAT TTTCTTCTGA AGGGGCTTCC CCGGCAATGA
  141241  CATCAAAATT GCCCCAATTA TGCATAATTT CATGTAAAAA AGGACCAAAT AGCATGCCTT
  141301  CTTTTTCAGG GAAATGCATT ATTGATTTAA GCACTCCATC AGAACCATAA AATTTTGAAT
  141361  CATCACTTTT ATCATTCGTA AAACTAATGC CTTCAATTTT ACTGTTAATT ACATTATTAA
  141421  TTCCAAAATA GTCTATTTTG CCAGTTGTAG GAACTTCTTT TTCATTTAGG ACAAAAACAA
  141481  TAAAATCATA GTTGTCTTCA AAATTATTGT AAAGCTCTTT TGTTAAGTTG GAAACAACTT
  141541  CTTTACTAGT AGTAAAGTCA TCATTTTGTA TCCAACTATC ATATTCTTTT TCAGATAGCT
  141601  GTAATGAAGC AAAAGTGTTG TTGGAATTTA CTTTAATAAT GTGTTCTTGT GATAGCGCAA
  141661  CACTAACCGA AAGGCTGAAA CCAATATATA AACAATTCTT GGCTTTGGAT AATAAGTTAA
  141721  TTTTCATAGC ATAATTTTTT TATTGATTAT ACTTGTTAAC CATATAGATA TTGTGAAAAT
  141781  TGCTTGCTTG TAAATGAATT TTTACAAATG TTTTGATAGA AAAAACTGAA CTTAATAAGT
  141841  TTTTGTTTTA ATTGTTATGT GTTTGTAGGT TAATTAGTTA AATTGAAGGT TTGTACTAGG
  141901  TATTATATTT TTGTAGGATA TCTCGCTATT GCTAAATGGA AGAGCATCCG AGTTAATTTT
  141961  GGGTGAAATT TATGTGTAAA TTATCACCGA TATTTTGATG ATATTGTTTC CGTTTTCGTG
  142021  AGAGTGTTGT ATTTCGTAGG ACTCGTCTTT TTTAAATTTC ATTAGTAACA GAATAAAAAA
  142081  GAATCATTTA AAGTGTTTTG TGAGGTGTAT TAAAAAAAGG AAAGTAATTA TGTTAAAAAT
  142141  TCCTAGCTTT GATGTATTAA GATGTAATAG ATTAAAAATA TGTTTTCAAG GTCAAAATCC
  142201  AAGGAGTCAA CTATTGATTT AGAGCAAAAA GAGCTTTTTG AGCATGCTCA GGCACGCATA
  142261  AAAGAAAAAA AAGGTTTGTA CAGGCATTTT ATTGTTTTTT TAGTGAGCTG TATTTTTATG
  142321  ATTGTATTAA ACCTGGGACT TAATTTTGGA AAAGAATATA AGTTTTTAGA ATTAGATTGG
  142381  TTTGTATTTG GTGTATTAGG GTGGTCTTTT TTCTTTTTAA TACACTTTTT TAGAGTAGTG
  142441  CTCTTTAGTA AGTTTATGGG AAAGGAATGG AAAGCGAAAC AATTGGAGCG TTTAGTGGCT
  142501  AAACAAAAAG CTAAAATTGC TAAAATGGAA CAAAAATTGA ATTTAGAAAT TCCAAAGGAT
  142561  ATAGTATCGG AAAAAAGTAT TTTATTAGAT AATACAGATT TAAATGATAC TGAAAAATTA
  142621  CAATAAATTA TGATAATACT TATTGCTGCG GCAGCTGAAA ATAATGCATT AGGAAAGGAT
  142681  AATGATTTGT TGTGGCATTT GCCAGATGAT TTTAAGCGTT TCAAAAAATT GACTTCGGGA
  142741  CACCCTATTA TAATGGGAAG AAAAACTTTT GAATCCCTAC CTGGCATGCT GCCCAAAAGA
  142801  ACACATATTA TAATAACACG TCAAGATGAT TATTTTAAAG AAGGTTGTTT GATCGCAAAT
  142861  TCATTAGAAC AGGCCGTTGA GCTAGCGGGT ACTAGTGCTA AAATTTTTAT TATTGGTGGT
  142921  GGCGAAATTT ATACACAATC CTTGAAAATA GCGGATAGTA TTGAATTAAC TCGAGTACAT
  142981  GCAAATTTTG AAGCGGACAC TTTTTTTCCA GAAATTGATA CAGAACAATG GGAGTTAGTA
  143041  GATAACGAAC AGCACGAGGC AGATGAAAAA CATACCTATT CGTTTTCCTA TTTAACCTAT
  143101  GTAAAAAAGT AATAATTTTC TAAGTAAAGA CAAATTAAAC CGACTATACT CATTCATTCA
  143161  AGTTATGATT TATGAAACCG TTTAGCTTAT TTCTTTTTTT ATGTTGTATT ACAGCCATGG
  143221  TATCTTGCGC AAAGCAAAAA GAAACTAAGA CTGTTGTTGC TTTGGAATCT TTAGAAAAAA
  143281  ATGGAATAAA AACGCTTGAA GATGCTATTA AAGGTGAAGA ATTCACAGAT TCAATAGAAA
  143341  TAGAGGGAGA TGAGGACTTC ATAGAAGAAA TTAAGGAAAA ACCTTTAGTT GTAAATGATG
  143401  AAGAGAAAGT AGTTGTTGAA ACTTTAAAAA ATACCGAAAA ACCAATTAAA AAAAAGGATG
  143461  CTACAAAAGG AGTAGTCATT GAAGAAGAGA TAGCAACTGT TCCTGTCAAA GAAATAGGCT
  143521  CCAAAAATGA AAAAGAAGGA ACTTCTAAAA AAGTACAAAA AATTGAAAAA GAAAGTACTC
  143581  AAGTTCAACA TAAAGTAGCA AAAATAGCAA CAAAGGAAGT GGAATCGATT GGAGCAATGG
  143641  AATTTGATCA TACTTTATTT GATGCTTTTT TAAATAAATA TGTTTCGTCA ACAGGTAATG
  143701  TAAATTACAA AATGATGAAA TCGCATCAAA TTGAGTTGGA AAGCTATATT AACTCACTCC
  143761  AAAATAAAAC ATTAAAAACT ACTTGGACTA CTAACCAAAA ATTAGCTTAT TGGATTAATG
  143821  CCTACAATGC CTTTACATTA AAGCTAATTT TAGATCATTA TCCTGTAAAT AGTATTACAG
  143881  CTATTGCAGG TGGAAAACCA TGGGATAAAA AGTGGATAGC GCTCAATGGG AAAATGTATT
  143941  CATTAAACCA GATTGAAAAT GATATTATAA GACCTCAATT TAAGGAGCCA CGTATTCATT
  144001  TTGCAGTGAA TTGTGCCGCA AAGTCATGTC CTAAATTGGG TAACTTTGCT TATACAGCGT
  144061  CTAATTTGAA TGCCAAGTTA ACGAGTCAAA CAAAAGCGTT CATTAATAGT AATCTTAATC
  144121  AAATAAGCGC TACACATTTA AAAATATCTA AAATATTTGA ATGGTATAAA AGCGATTTTG
  144181  GAGATTTAGT TCCATTTATA AAAAAATATT CTACGGTTGT AATTAATGAT AATGCGACTG
  144241  TTGAGTATAA TGAGTACGAC TGGAGTTTAA ANNNNNNNNN NNNNNNNNNN NNNNNNNNNN
  144301  NNNNNNNNNN NNNNNNNNAC TTTTAGCTAC ATTTGTGTTT CAAAATTTAT AAAAATGAAA
  144361  GCATACGTTT TTCCAGGTCA AGGTGCTCAA TTTGTGGGTA TGGGAAAGGA TCTTTATGAT
  144421  AACGCTCCAA TAGCAAAACA ACTATTTGAT AAGGCTAATG AAATTTTAGG TTTTTCGATA
  144481  ACTGATATTA TGTTTGAGGG AACTCCCGAA CAATTAAAAG AAACTAAAGT TACTCAGCCG
  144541  GCTATATTTT TACATTCGGT AATTTTAAGT AAAGTATTAG GGGATGATTT TAAGCCAGAT
  144601  ATGGTAGCTG GACACTCTTT AGGAGAATTT TCGGCATTAG TAGCCAATGG AGTATTATCT
  144661  TTTGAGGATG GTTTAAAATT AGTATCGCAA CGTGCTTTAG CTATGCAAAA GGCATGTGAA
  144721  GCTTCGGCTT CAACTATGGC TGCTGTTTTA GGTTTGGACG ATGAAGTAGT GGAGACTGTA
  144781  TGTAATGAAA TTGGAGCAGA GGTAGTGCCT GCAAATTATA ACTGTCCGGG GCAATTAGTT
  144841  ATTTCGGGTG GCGTGGATGC AATAGCAAAA GCTTGTGAGA TATTGAAAGA AAAAGGAGCT
  144901  CGCAGAGCTT TGGTTTTACC TGTTGGTGGA GGTTTTCATT CTCCATATAT GGAACCAGCT
  144961  AGAGCAGAAT TAGCTGCTGC TATTGAGGCA ACAACTTTTA ATGAGCCAGC TTGTCCAATA
  145021  TACCAAAATG TAACTACTAC TGCAGTAAAT TCTGCGGAAG CAATCAAAGA AAATTTAATT
  145081  GCACAATTAA CAGCGCCAGT GAAATGGACG CAAAGTATTC AGCAAATGAT TGCTGATGGA
  145141  GCTACATCAT TCACAGAAGT TGGACCGGGT AAAGTATTAC AAGGTTTAGT GAAAAAGATT
  145201  GATAGAAGTG CCGAAACTTT TGGAGCAACG TTATAACGTA ACTATCTATA AATTTCATAC
  145261  TATAAAAAAA GGAGGCATTG CCTCCTTTTT TTATAGTATG AAATTCCCTT ATTAAATCAA
  145321  AGATCTAAAT ACAGCTTATT GTAAGTTTTA GAAAAGTAAG CGGTTACTTT TTGATTTTCT
  145381  TTGTATTTGT TACAGTCCTT TTCGTTTTTA AAGAATATAT AATAGACTTG TCCTTTATAG
  145441  GCTACGGCGA CCAAACTTTT ATCGCCTTTA AGGCGCTGTT TGCAGTTTAC TTTTTCTATG
  145501  CTAGCTTCAA CTTGAATAGC ATCTTTTCGG GCTTTATTAT CGGCAGTATT AATTTTTAGG
  145561  AACCATACAA TTCCAGTAAT AACTAATAGG GAGATAATTA AACTCATAAT TTTCATTTTA
  145621  TATTATTTTG TTACAAAATC AATTACTGTT TTGGTAATAA AAGCTATCTG TTCATCATCT
  145681  AACTCGGTAT GCATTGGTAA TGAAATTACT TCTTTAACCA ATTGATTGGT TACAGGAAAA
  145741  TCGGATTCAA GGTAGCGCTT GTCCGTATAT GCTTTTTGGG CATGTAATGG AATTGGATAA
  145801  TAAACACCAC AAGGGATGTT GTTTTTATTT AAATGAGCTA CTAAAGCGTC CCGATCCGCA
  145861  TCTTTTACTT TTAATGTGTA TTGGTGAAAA ACATGACAAT CACATGTATC ACAAATGCCT
  145921  TCACATTTGG TATGTGTCAC TGGTGTTATT ATTTGAGGAA TATTTTTAAA AGCATCGTTA
  145981  TACTTTCTGG CGGAAGCCCT ACGTGCATTA TTATAAGTGT CTAAGTTTGG TAGTTTTGCT
  146041  AGTAAAACAG CAGCTTGAAT AGAATCTAAA CGCGAATTTA CCCCAACTAC ATCATGGTGA
  146101  TAACGTTGAT ACATCCCATG ATTTACAATA CCTCTTATGC TATGTGCAAG CTCATCATTG
  146161  TTAGTAAAAA TAGCACCACC ATCACCATAA CAACCTAAGT TTTTTGAAGG GAAAAAGGAT
  146221  GTTGAGGCCA CGTGACCTAA ATTTCCGGTT TTCTTTTTTG TGCCATTAGC AAAGGTATAG
  146281  GAAGCACCAA TACCTTGGGC ATTATCTTCG ATAATAAAAA GATCATGCTT TTTTGCAATG
  146341  GTGGTAATAG CTTCCATATT GGCAGCTTGT CCAAATAAAT GTACAGGAAC AATAGCTTTG
  146401  GTTTTAGGGG TAATCGCCTT TTCAATTGCT TTTGGATCAA TATTAAAGGT ATTTGGATCC
  146461  ACATCAACAA GTACGGGTGT TAATTGTAAT AATGCAATAA CTTCGACAGT GGCAGCAAAT
  146521  GTAAAATCTG CAGTGATTAC TTCGTCACCT GGTTGTAAGC CCAAGCCCAT CATAGCTATT
  146581  TGTAAAGCAT CGGTTCCATT TGCACAAGGA ATAACATGTT TTACATTTAG GTATTTTTCT
  146641  AATTCCTCCT GAAATTTGTG TACTTGAGGA CCATTGATAT AAGCGGTGTT GTCAAGAACT
  146701  TCTTGTATGG AATTGTTTAC CGTATTTTTT ATTCCTTCAT ATTGACCTTT TAGGTCAACC
  146761  ATTTGTATTT TTTTCATAAA CGAAGTAAGC TAACTATTGA AGCCAAATGA GTTTGATGTA
  146821  CTTGTATTGG GCGTAATGTC AAAAATACGA AATATAGTAG TTTTGTTCAA TTGTAATTTT
  146881  TGAAAATAGC ATATTTAGTT ATAAACCTAA AGCCTGCTAT TGTATTATTA AGTTTATCAA
  146941  ATGTTTAAAG CGTTAAATAC AATGACCTGG TTAAAGTAAA TAAAGCAGTG ATTAATTTGT
  147001  TAGTTTTTGA TCCTTTTGAT TTGTATAAAT TGTAACTTAC TTTTATTGTT ATACGATTTA
  147061  CTGATAAGAA TTTCGTATAA ATATGTTGAA TTATTTTTTG CTAGTCTAAG GCAAAAAAAT
  147121  CAAGCATAGC CTTTGCTACG GTTGTTTTTT TTAACGCAAG AATTGTGAAA AAGAAACAGC
  147181  ATATATGCGA AATTCTTATC AGTAAATCGT ATTAGTGTGT ATAGTACTAA TTAAAGTTTT
  147241  ACCACCATGA AAAACGAAAA ACGAAGAGAA TTTATAAAGC AGCTAGGATT AGTAGCAGGT
  147301  TCAACAGCCC TATTACCATC ATTATTATCT TTTGATTCCA TAATAAATAC ATATAAAAAA
  147361  GAGGGGTCTC AAAAAAAAAT AAATGTAGCC CTTTGTGGAT TGGGGAGGTA TGCTAAAATT
  147421  TTAGCAAAAG GTTTAGAGCA AACCAAGCAA TGTAAATTAA CAGGCTTAGT AACAGGAACA
  147481  CCCGAAAAGG AAATTACCTG GGGGCAAAAG TATAATATCC CTAAAAAGAA CATTTATAAT
  147541  TACGATAATT TTGATTCAAT AATTGATAAT AAAGATATTG ATTTGGTTTA TGTGGTACTC
  147601  CCTAATTCCA TGCATAAAGA ATTTACAATT CGAGCAGCAA ATGCGGGTAA GCATGTTATT
  147661  GTAGAAAAAC CTATGGGGTT AAATGCCTTA GAGTGTGTTG AAATGATTGA TGCTTGTAAA
  147721  AAAAATGGAG TACAACTGGC GGTTGGTTAC CGTCTTCATT ATGAGCCACA CCATAAAGAA
  147781  ATAAAAAGGA TGGGGCAGGA AAAAGTTTTT GGGAATATTC GATATATAGA TGCGTCTTTA
  147841  GGTTACCGAA TAAAAGGTTG GAAAAAGGAT GCATGGCATC TAAAAAAGGC TATGTCTGGT
  147901  GGAGGACCAC TTACAAATAT TGGTATTTAT TGCGTACAAA GTAATCGGTA TATTTTAGGC
  147961  GAAGAGCCTA TTGCCGTTAC AGCTCAATTT GGACCTGTTC AACGGCCTGA TTATTTTAAA
  148021  GAAGTTGAAG AATCTATTAC CTGGCAACTT GAGTTTCCAA GTGGAGCAGT GACTACATCG
  148081  GCAAGCTCCT ACAGTTATAA TGTCGACAGA TTATATGCCT CTGGTGACGA TGGTTTTTTT
  148141  GAATTAGAAC CAGCATTGAG CTATGGGCCA TTTAAAGGTA AATCGAGTCT AGGCACTTTC
  148201  AATTTTCCAG TAATTAACCA ACAACAAGTA CAGTTAGATG AAATTTCAAA ATGTATTTTA
  148261  AATAAGGAAC CTTTACCCAT GCATATTAGA GGCGAAGAAG GTCACAAAGA TATGTTAGTC
  148321  ATTGATGCGA TATACAAATC AGCTGCTACT GGTAAAAAGG TGGTAATTTA AACAAGGCAG
  148381  TGAATGATAA ATGATTTATT AATTCAAAAT ATAAAAAAAA ACGTATCACT TCCGGATACT
  148441  GATTTAAAAC GTATCTGTAA TTATTTTAAA CCCAAAACCA TTCCCAAAAA AGAGTTTTTA
  148501  TTAACTCAAG GAAGCATTTG TAAATTTGAA GGTTTTGTAC TTGAAGGTTG TTTTAGGATT
  148561  TTTATTATTG ATAAAAAAGG GCATGAAAAT ACATTATACT TTGCTGCCAA GGATTGGTGG
  148621  GTTATGGATA TAGATAGTTT TATGAATCAG AAACCATCGG ATTTGAATAT ACAGGCTATA
  148681  GAAGATAGCA AAGTTCTTTT GATTACTAGA GAAGACAAAA CAGATCTCTA TAATTCAGTT
  148741  CCATCCGCCG AAAAACTATT TCGTATTATG TCTCAAAAGT CCATAGTAGC CTGGCAACAG
  148801  CGGCTTATAA GAAACCATTG TCAAACAGCA AAAGATCGAT ATAATTATTA TATAAGTACC
  148861  TATCCCGATA TTGCATCTAA GTTGACAGAT AAGCAAATTG CTGGTTATTT GGGTATTACT
  148921  CATGAGTTTT TGAGTAAAAT CAAAAAGAAA TCTTAAATCC AATAAAATTT TATCAAGTTG
  148981  AACTTGTTCA ACTATTTTAT TAGACTAGTT TATAATTTTT GCAGTATTAA ATTAAAACAA
  149041  AAATGATGAA CTTACTAAGG TCTGCTAGAA GTTGTGCTAT TGCTTTTATC CTAACATTAG
  149101  CGTGTAATGG TGGTTATGCA CAAATTACAA ATGATATTAC TCATGATGAA GCTTTTAAAG
  149161  TGCTTTTAGC AGCAAAGAAA AAAGCAGAAC ATTCAAATGT ATTAGTAAAT ATTGCTATAG
  149221  TAGATGCCGG TACAAACTTA AAGGCATTTA TTAGAATGGA TAACTCTTTT ATAGGAAGTA
  149281  TTGATGTAGC CATAAAAAAA GCAAAAACAG CACGCTATTT TAATATAGAT ACAGGGAAAT
  149341  TAGGCGAGTT AACACAACCT GGCGGTATTA TTTATAACAT AGAGCATTCT AATGGAGGGC
  149401  TAATTACTTT TCCTGGAGGA ATACCAATTA AAAATAAAAA TGGTGAAATT ATAGGTGCGA
  149461  TTGGAGTAAG CGGAGGTACC ATAGAACAGG ATAGAGCAAT TGCTAGTGCA GGAATTAAAG
  149521  CAGTAATAGA TTAACTAAAT TTAAAAAAGG TTGAAATGAA GAAAATCTTA AAAAAAATAA
  149581  TTTTTGGAAC AGTCTTGTTG GTATTACAAA TTTGTAGTGC TCAGGTTTCT AATGAATTAA
  149641  TGCTTTACAG AAAAGATTTC AAGGATATAT CTGGCAATAA TACTGTTTCT GTGACAAGTT
  149701  ATCAAAAGGG AGATGCTCAT TTTGTATTTG CAGGCGGAAT AGGAAATATA GATGTATATA
  149761  GTTTAAATAA AAATGGAGAA CTCACCCCAA TTAGTAACCA TGAATTATAC AAAGGAAAAG
  149821  GGCCAGCAAG GGGTATGGTC GCAGATTCTA TTAATGGTAA CGACTTTCTA TTTGTAGCAA
  149881  ATAAACATGG AAATGCGATT GAAACCTTTA AAATTTTGAA TAATGGGGCT CTCGAGCGCG
  149941  TTTCTTTGGT AGCGGATACC AATAAAACTC ATCTTGGTAC AGCTATTACA TTACAGGTAA
  150001  TACATATGAA AGAATCGTCG TATCTCTTTA TTGGCGGTTT AGAAGAAACA CCTGGTTTGA
  150061  GTAGTTTTCA AATACATGAT GATGGGAAGC TAACCCATGT ACAGTCGATG GAGGATAATG
  150121  AAATTATTCA TACTGATGGA GTAATAGGAA TGTATACTCA TAAGATTAAT GGAAGGACTT
  150181  TTTTGTATAC AGGAGGATTC CAGGATAATG GAGTAAGTAG TTTTAGGGTT TATGAAAATG
  150241  GGACATTTAA AAATATTAAT AATATAAGTG ATAATACAAA TGATAGGTAT TTAACAGGAA
  150301  CTTATCCAGT AACGGGTGTT ACTTTAGGCA ATAATAATTA TGTGATTGTT GGTCATAGGC
  150361  ATCATAAATA TTATAAGAGA GCAGGCTTTA TAAAAAAAAC AGATTTTGTT TACCATGGAG
  150421  ATGCAGTGAG TGTGTTTAAA ATAAATAAAA AAGGGGCTTT AATTCCTCAC TTTGTTTTAA
  150481  AGGATGATGA AACCACCAAG TTACAAGGGC AAACTAGAAT TGAAGTTGTT TCAGTAGCTA
  150541  ATAATGAAGC TATTTTGGCG GTAGGGACAA GAGATGATGC GAGTATACAG TTGTGTAGAT
  150601  TAAATAAAGA AGGGATTCTT AGTCCTATAA ATTATTTAGA GACTGGTTTT TCAATTTATT
  150661  ATGGTTTAAG GTCTCATAAA ATAGGGAAGG AAAATTTTTT GATAGCAGGT TCTTTTAGGT
  150721  TTGATTTGAA AAAGATAGTA ACCTATAAAA TAGCCCCTAA AATCAATAGG GAAGGGAAAG
  150781  TTTTAAGGCA TATGGTAAAC CTTAAATATA AAGATGGTAT TGAAGAAAGT AAAGTAAATG
  150841  AAGCGGTTAA AAACTTTATG AATTTAAAAA ATGAAATCCC AGAAATAGCT AGTATAGAAT
  150901  GGGGTATAAA TGATAGCACT GAAGGGCATA GTAAGGGATT AACTCATTGT TTCACTTTAA
  150961  CTTTTGCAGA TGAACATGCT AGAGAAATAT ATTTATTTCA TAAAGCACAT TTACAAATGG
  151021  TAAGTAAAAT TAGTCCCATT ATAGCGGATG TTTTGGTATT AGATTATTGG ACAAAATAAT
  151081  GATAGTCAAT TTTTAATAGG CTTTTGTAAG GATATTAGCC ACGCATATCT AAATCACGTA
  151141  ATTCGTTCAA TTCTTTTTGT TCAAATTTTT CACGTGCATA ATCAAAGCCT TGTTGCCACC
  151201  ACTCGGTCAT TAGTTTTTTG TTAAATACTA ATGAGTTTTC GGTAAGCTTC GTCGGGGTAT
  151261  AATAAAGGTT AAGCGTGGCA TTTTTATTTT TGGCAGCAAG TTTACCAGCC GTTACATTAT
  151321  GTTGTTCTAC TTGATCTAAT AAATAACCGA ATAGATTTAC CATTAATGAA AATGGGTTTT
  151381  TACCTAATAT TTTATTCCTA TCTAAATTCT CGGATTCTAA TATAACCGCG TCTATTTCGG
  151441  TAGCACCACG TTTTATAGCT TCGCGGATAG GAACTATGGC ACCAAAGCCC CCATCGGCAT
  151501  ACTCGTAACC ATTTTTTTTG GCAATACTCA TAAAAGGGAT GTAGTTACAG GATATCCAAA
  151561  TCCATTCACA AAAATCTTCA TAACTAAATT CGTGGATGGA TTTATATTCA GTACAACTTT
  151621  TGGATAAGTT AGAAACCGTA ACGACAACAT CGGTTACATT TTTTCGGGCA AATTCAAATT
  151681  CTTCTCGCGT AAAGTTTTTA CGGATGTTTT TACGTAAATT TTTACTTTCG CCAAAGGTGC
  151741  GTTTTCGTTT AACAAATTGT AAAACAGTGT TTAGGTAATT AATACTCACA TATTCTCGGT
  151801  CCCCTTTATG TTTTACCACA AAAGGATTCA AACTAAAAAT AGTATTTTGA TTTACATTAG
  151861  TATAAATATC ATGTACTTTA TCTATTTTAT TAATAGATAA ATGAGGGATT AATAAGCTAC
  151921  CTGTGGAGGT GCCTAAAAAT AAATCATATT TGCGTTGTTG TACCTGCATA AGGTATTGTG
  151981  CAACTCCGCC TGCAAAAGCA CCTTTACTCC CACCTCCCGA AATGACTAAT GCTCGCATTT
  152041  GTTTTTTTAT TTGTTTTATT AATGACTAAG ATATAAAAAT CATTTACTAA TGTAAATCAC
  152101  TTAATCCGTC GTTAATAATT GTTTTACCTT ATTGGGAAAC GTAGCAGAAA GGCGATTTAT
  152161  TCTTTGCGTA TATTTTTCAT TAGCATAAAG CGCTTTAAGT GTAGTGCTAC AATTCTTTTT
  152221  AAATCGCCAA TTGGGATGTG TGGCACCTAA GGCTAAATTT TGTAAACTTT GATCGGAATA
  152281  GCTTTGGAGC AATTTTAAAT ATTCAAAAGC TTTACTGCGT AATCTGTAAT GATGATTTGG
  152341  AGCCGTATAC GAATTGAGTT CATTAAAAAA TCGGGTACGA TCTGTAGTGC TAAACCCTGG
  152401  AGTGTTTAAG GCAAGGACAA GCCAAAGTGT TCTTATATTT TTATCATTAA AACCAATTAA
  152461  GTTTTTTGTA GCTTGTAAAT AATTCATTTT TTTAGCCTCA AAATTATTCC ACAAATTATA
  152521  AAGTGCGCCT TCCACAGTGG CGTATGAATC TGCTTTTAAT AGGAGTGCCA TTTTGGGCTC
  152581  AAATGCTTTG GGAATAGTAG TTAATGAATT AGCTAAGGCT TGTAAAACTT GAGGTTGATT
  152641  ACTTTCGAAT GCTTTTTCAA GTAATAAGAG TGCTTCTTTC GAAAAATCTC CTTGTAATTG
  152701  AGCAACTACT TCTTGTCCTA AATAGGGATT TACAGGAAAA TCTAGAGCAT CCGATAGTAA
  152761  TTGATATTTT CCAATAAGCG GTTGAGTGCG TTCACCAGCC AATTGCAAAT ATCTTTTCAT
  152821  AACTTCCGAT TGCGTTATAA TTTTTAAAGC TTCTCCAGCA GGGAAAGTCG TATTATGTAA
  152881  CCATTTTTTT GCAAATTCAG AAGTGTCTTT TCCTGTTACT TCAAAAACAA TACTTAAAAA
  152941  GTCATAGGTG GTTACATTTT TATATTGGTG TGTTGTTAAA AATTGCTGGA CTACTTTTTT
  153001  AAAATGAGCA TCTCCTATGT TGTTACGTAA AGCTACAATA GCCCAAGCCC CGTGTTGATA
  153061  GTAAGTAAGG GAACTCCCTT TTGGAGTAAC TAAGGCTTTT CCTTTTTGTA AATCACTTTG
  153121  ATGATTTAAT TGCTCTGCAC TTTCATACAG TTTGTAATAA AAGTGATCTT CGCCAAATAG
  153181  CTCTTTTTCG GCTAATAAGG CGAAATAAGT GGCAAAGCCT TCGTGTAACC AATGGTGATT
  153241  ACTATCTGTT TCGGTAATGA TATTTCCAAA CCATTGATGC GCTAACTCAT GAGCGCTCAC
  153301  ATTTACAAAA TTTTGATCGT CAAAAGTGTT TGTGTCTACA ATAAAATCAT CAGAAAATAA
  153361  GGTACATGCT GTGTTTTCCA TCCCGGCATA TAAAAAATCA CGTACAGGAA CTTGCCTGTA
  153421  TATTTTCCAA GGATAGGGAA TACCAATTTC AGTTTCTAAA AAATCAAAAA CTTTTTTGTG
  153481  GTAGTTAAAA GTTGACTCGT AATCTGTTAT TCTATCCGAA TAGATATAAT TTTCTAAAGG
  153541  AACTCCCGAA GCGCTTTTTT CTTCTTTTTT TAGGTATTTA CCAATGGCAA GTGCCACCAA
  153601  ATAGCTACTC ATAGGTTGTT GCATTTGGTA AACCCATGTA GTAGTAGTAT TTGTGGTTGT
  153661  TTTATGAATT AAACTTCCGT TAGAAATTAC TTGGTAGTCT GTATTAAAAT CAATTTTTAG
  153721  TGTAAAAATG ATTTTATCAT TCATATCATC AATACTAGGT AACCAGTTAC TCGTGTATTT
  153781  ACCTTGTCCT TGTGTCCATA TTTGTTTATG ATTTGGTGAA TTGGGGTCAA TATTTTTGGC
  153841  ATCCCAACCC CAAAAATAGA GCGCTTTTTT TGGTGTTGTA CTATAATTGA AACTAAAGGA
  153901  ATAAGCTGTA TTGGCTTTAA AATCCCCCTT TAACCAGATC TTATTGTCCT TGTATTCAAC
  153961  TTTAGCATCT TTAATGGGAG TAACTGTTTC CATTTTTTGA GCATCCAAAT AGACTTGATT
  154021  AGTGTTTTTT AATGGGGTAA ATAAAACATC GATTTTTCCA AATACCTTTT GGTTTATAGT
  154081  GTCGAGTTGT ATATGTGCTT CAATAGTTTT AAAATCAACA AGATCTTTTT GTTGGGCCCT
  154141  ACTATAAATA ATGCTTGCGC AGAAGCTAAA AATAAGAGAA GTGATTTTTA TGAATTGGCT
  154201  CATATACATA ATACAGTTTA CGGAGGGACA AATTACAAAA ACCAATTTAT AATACATGCT
  154261  AAAAAATGTA TCTTAGCATG CTATGAGTGC TGATATATTA CAATCACCCG TTGCCTATGT
  154321  AAAAGGCGTT GGCCCAACTA GAGCCACAGT ACTAGAAAAA GAATTAGGAA TTCGAGTATG
  154381  CCAGGATCTA CTACATTTTT TTCCTCATCG GTACATTGAT CGTACCCGAT ATTATACGAT
  154441  AAGTGAATTG CAGCAAAATG ATGCCGAAGT TCAAATTGTA GGTATGGTTA CACAGTTAAA
  154501  AAATGTAAAA CAAAAAAAAG GAGGCAGTCG TTTAGTGGCT ACTTTTCAAG ATAAAACGGG
  154561  AAAAATGGAA CTGGTTTGGT TCCGAGGAGC TAAGTGGATT CAAGAAAGTA TAAAGATAAA
  154621  TGTTCCTTAT GTAATTTTTG GAAAGACAAA ATATTACAAT GGATTTTCCA TGCCACATCC
  154681  CGAAATGGAA TTGTTGGATG CCCATAAATC GAGTATGAGT TCCATTATGC AACCGATTTA
  154741  TTCGTCGACC GAAATGTTAC AACGAAGGAA TATTACCAAC AAGGTAGTTT CTAAAATGGT
  154801  GCAAAATCTG TTTTTGACTA AAGGTGTTTT TTTTGATGAA ACGTTGCCAA AGAATATCTT
  154861  GGAGCATATG AAGCTTATAG GGAAGTCTGA GGCATTATTA AATATACACT TTCCGAAAAG
  154921  TCAGGAGTTG TTAACTAAAG CGAGTTACCG ATTAAAGTTT GAAGAGTTAT TTTATATTCA
  154981  GTTACAATTA ATTCGTAAAA ATATTCTGCA AAAGCAAAAA ATAAAAGGCT ATGCATTTGA
  155041  AAAAGTAGGG GAATTATTTA CTAACTTTTA TGAAAACTAT TTACCTTTTA GTTTAACGGG
  155101  AGCCCAAAAA CGTGTAGTTA AAGAAATCCG TAGGGATATG GGAAGCGAGG CTCAAATGAA
  155161  TCGATTGTTA CAAGGAGATG TAGGCTCGGG GAAAACCATA GTGGCTTTAA TGAGTATGTT
  155221  GTTGGCTATT GATAATGGTT ATCAGGCTAC ACTTATGGCA CCAACAGCTA TTTTGGCAAA
  155281  ACAACATTTT GATGGTATTT CCGCATTAGT GAAGGATTTG CCTATCCATG TGAGTTTACT
  155341  CATGGGAAGT ACAAAAACTA AGGCCAGAAG AGAAATTCAT GCAGATTTAG AAAACGGACA
  155401  AATACATATT ATAATAGGAA CACATGCCTT GTTAGAGGAT AAAGTGAAAT TTAACAATTT
  155461  AGGCTTGGCT ATCATTGATG AGCAACACCG TTTTGGCGTA GCCCAACGTG CTAAATTATG
  155521  GCGAAAAAAT GAATTACCAC CTCATGTGTT GGTAATGACA GCAACACCTA TACCTAGAAC
  155581  TTTAGCAATG AGTTTATATG GGGATTTAGA TGTTTCGGTA ATTGATGAGT TACCTCCAGG
  155641  ACGTAAGTCA ATAAAAACAA TGCATAAATA TGATGGACAA CGTTTAAATG TATTCCATTT
  155701  TGTAAAACAA GAAATTGCTA AAGGAAGGCA AATATATATT GTATATCCAC TAATTCAAGA
  155761  ATCCGAGGCA ATGGATTACA AGGATTTAAT GGATGGGTTT GAAAGTATTT CACGTGATTT
  155821  TCCTAAGCCA GAGTATCAAA TTTCCATTGT ACACGGGCAA ATGAAACCTG CAGATAAAGA
  155881  TCATGAGATG GAACGCTTTG TTAAAGGAGA AACTCAAATT ATGATAGCCA CTACCGTAAT
  155941  CGAAGTGGGT GTAAATGTAC CAAACGCCAG TGTAATGATT ATTGAGAGTG CAGAGCGTTT
  156001  TGGCTTGTCA CAATTGCATC AATTACGGGG TCGGGTAGGG CGTGGAGCCG AACAAAGTTA
  156061  TTGTATACTA ATGTCTGGTT TTAAACTGTC CGAAGATAGT AAAACACGTT TGCAAACCAT
  156121  GGTGCAGACT AATGACGGTT TTGAAATTGC TGAGGTGGAT TTAAAATTGC GTGGCCCGGG
  156181  GGATATTATG GGAACACAAC AAAGTGGTGT ATTAAACCTA AAAATTGCCG ATATTGTAAA
  156241  GGATAATCAA ATTTTGCAGG TAGCTAGGGC TTATGCACAG CAAATATTAA AGGAAGATCC
  156301  AAACTTAGTA TTACCAAAGA ATAGTATGAT TAAGCAAGCC TATGCTCAGT TAATACAACA
  156361  CAAGAATATC TGGAATTATA TTAGTTAGCC TTATTAATAA AGGGATATAA TTAGATTGTT
  156421  TGCTTTGTTT TTTTTGAAGT AAAAGGATAA AATACTAATT TTTAAATCAC ATGTTATGGC
  156481  GGCATTTATC AAATTATACG AAGAAAATCC GAATCCTAAG CAAATAGCAG AAGCAGTTAA
  156541  AGTGCTAAAA AATGGAGGAT TAATAATTTA TCCAACAGAT ACCGTTTATG GACTAGGCTG
  156601  TGATATTACC AGTGTAAAAG CTTTAAATCG TATTGCTAAA ATAAAAGGGA TTAAGCTTGA
  156661  AAAAGCCAAT TGGTCTTTTA TTTGTAAAGA TTTGAGTAAC CTGTCCGATT ATGTGCGCCA
  156721  GATAGATTCA TCTACATTCA AACTATTAAA AAGATGCTTG CCTGGACCTT TTACATTTAT
  156781  CTTACCCGGA AACAATCAAT TACCATCAGT GTTTAAAAAA AAGAAAACAG TAGGGATACG
  156841  TGTCCCCGAT AATAAAATAT GCCATGACTT AGTAGAGGCA CTTGGTAATC CTATAGTATC
  156901  CACATCAATA CATGATGAAG ATGAGATTTT GGAATACACA ACAGATCCTG AGTTAATATT
  156961  AGAAAAATGG GGAAATTTAG TAGATTTAGT TATCGATGGA GGTTATGGTG ATAATATACC
  157021  ATCAAGCATT GTCGATGTAA CTGATAATAT CCCCGTAATT GTAAGAGAGG GAAAGGGTGA
  157081  TACAAGCTTA ATTTAGAATC TATTATTGTT TACTTTTCTT TTTTGAATAT ATGTTAATTT
  157141  TTTTTGTCAC TCATTGAATT ATAAGTAGTT TTTTTACGTG TTAATTTAAT GTTAAATTGA
  157201  TTTATTTTAA CCTTGTGAAA ATGTAAAGGG GTAAAATAGC ATCAATATTG GTAAATTCTA
  157261  TATATGCTTT TTGGGTAGTT ATCATAGTAT TTTTGGAGTG TAGATTAATC GTATTAATCG
  157321  ATAAAAATTT TACTTATGAA AAAACTATTG AAATTAGGAT TGTTAAGTGT AGCACTTGCA
  157381  TCATCCGTTA TAGCAAATGC CTCAAATAAA GTTAAAGTTG AAGTTTTAGC TTCAAATGAG
  157441  TTGAGTATCA CTATGTCGGA GGTGGTTGAA GGAGAAGTAT TATCAATAAC AAATAAAAAA
  157501  GGAAAGTTAG TATTTTCTGA AATATTAAGC GCAACTAGCT CTTACACTAA AACTTTAGAT
  157561  TTTTCAAAGT TAACTCAAGG CGTATATTAT GTAAAAGCAG AAACCGAAAG TGCGGTGAAG
  157621  GTAACTCCAT TTATTATAGT TCCAGATCAA GTTAAAATTA TAAAAGGAGC AACTAAAACG
  157681  TATAATGCAC CAGTTTTTAA AGTTGAAAAT GGTATTGCTG AGGTGAGTAT TGATAATAAA
  157741  GATTTACATG ATGTGTCTAT TACTGTATAT GCTAAAAATA GTAGTATTCC ATTAGAAGAA
  157801  GTTAGATTGA ATACGCCAAA AATAACAAAG ACATATAACT TTGAGTCATT ACCAGTTTCT
  157861  GAATATAAAA TTGTTATATA TCAAGGAGAT TATAGTTATG TAAAAACAGT GAAACGCTAG
  157921  TTTACAAATT TCATAAAGTA AAAAAAAGCC TTGTACAACC CCAATGTACA AGGCTTTTTT
  157981  ATGCGTTAGT ATTACCTAAT TCGGATTTCG TTTTAGGGTT GTTTGTTGTA TTCTTCTTCT
  158041  GTGTGTTACG TGTCATGATA AAAAACTAAT TACGGAGGTA GGTATAAAAG ACGCTACCTA
  158101  ACTATTAAAA GGGAGTGAAT CTTTAGTTCA CCATAGCATA TATCATAAGT TTATAAACAT
  158161  AATTTTATGT TTAAAAAAGG GGGGGGCTTA ATTCTAAATC TAATTGTCAC ATTTATAATA
  158221  CATTCAGTAG TGACCTGTGA TAATAACTTA AGTTTGTTAG TTTTTTGAGA TGTTAAAATG
  158281  ATTGTTTAAT CCACTTAATT AGTGTTTTTG GTTAAAATAG CATCAATATA GGTAAATTCT
  158341  ATGTCTGTTA TGAGGTGGAT GTCGGTAGTA CATTTGCAGT GTAAAATTAA TCGAGTGAAT
  158401  CGATAAAAAT TTCACCTTAT GAAAAAAATA TTGAAATTAG GATTGTTAAG TGTAGCACTT
  158461  TTAACAACTG TGGTAGTAAA TGCATCAAAT AAAGTGAAGG TTGAAGTTTT GGCTTCAAAT
  158521  GAGTTAAGCA TCACCATGTC TGAAGTAATC GAAGGAGAGG TGCTTTCGGT TTCTGATAAA
  158581  AAAGGAGAAG TTGTATTTTC TGAAATATTG AGCGCATCAA GTTCTTATAC AAAAACCTTA
  158641  GACTTTTCAA AATTAACTCA GGGAGTATAT TATGTTAAGG CAGAAACTGC TAAGGCTATA
  158701  AAAGTAACTC CATTTATTAT AGTGCCAGAT CAGGTTAAAA TTGTAAAGGG AGCAACTAAA
  158761  ACATATAATA CACCAGTTTT TGAAACTGAA AATGATATAA TCAAGTTAGA TATAGATAAT
  158821  AAAGATCAGC ATGAGGTATC GATAACAGTA TATGCTAAAA ATAGCAGCAT ACCATTGGAA
  158881  GAAGTGAGGT TAAATGCTCC AAAAATCACA AAAAATTATA ATTTTAAATC ATTACCAGTT
  158941  TCGGAATATA AAATTATAGT TTATCAAGGA GATTATAGTT ATGTAAAAAC GATAAAACGT
  159001  TAGTTTTTAA ATTTCGTAAA GTTAAAAGCC TTGTACTCCC CCAAAGTACA AGGCTTTTTT
  159061  TTGTCTTATC AGTTAGTTTT ATGATATGGT AAAATTCATT TCTTTTCGGT AATCAGTTGG
  159121  TGTTTTACCA GTGTATTTTT TAAAGACTTT GTTAAAGTGT GAAAAGTTAT TGAAACCACA
  159181  TTCAAAACAA ATTCCTTGAA TGCTCTCTTG TTTTTCGGTA AGTAATTTTG TGGCGTGCAC
  159241  TAGTCGGTAT TCATTAACAA ATTGAGTAAA TGTTTTGCCA GTTACTTTTT TGAAATTTCG
  159301  GCAAAAGGCA GGAGGTGTCA TATTTACAAA ATCTGAAATT TCTTCAATAC TAATTTGCTT
  159361  TTTGAAATTT TTTTGAACAT AATTAAATGT ATTATTAATA CGACTATTGT CTTGCGCTTG
  159421  AGCTTTTAAA ACAAAGCCTT CAGCATTTAA TATTTCAAAT TCTTTGGATG CTTCAAGTTT
  159481  GTGGAGTATA AGTAAGGAGT CTAATATGCG TTCAAAAGGA GATTTTGAGT ACATGTTTTC
  159541  AATAATGGCA CCCACCTCTT TTTTTGTTTC TCCAAAAAAA ACAAGGCCTT GTTTGGCTCT
  159601  ATCTAGTAAA GCATTTATGG GGTTCATTTC AGATACATTA AAAAAATCCT TGCCTAAATA
  159661  TTCTGGCAAC ATTTGAATTA CTGTTTCATT TCTGGTTTTG GAAAATCCAT CGGTAAAACC
  159721  ACAATGCGGT AAGTTGGCGC CGATACAAAT TAAATCACCA TTTTGATAGT AAGATACGTG
  159781  ACTTCCAATT TGTCGTTTGC CAGAGCCTTC ATTCACATAT ACAATTTCTA TTTCTGGATG
  159841  GTAATGCCAT ATAGGTTGCT TGTTTTTGTT TTCAATATTA AATCTCTTGT ATATCAAAGA
  159901  GTTGCCAATA TCGGGAGCAA GATGCTCAAA ACTGGGTTTA TTATAATTAA TTTTTTGTTC
  159961  CGTCATTATA GTGAGCTTAA TAGAATGTTA AATTGACAAT AGTTGAATGT TATTTTTAAT
  160021  ATAGGGTTAA TATAGCATAA ATATAGGTAA ATTGTGATGA TATATCATAC TTGTATTCGA
  160081  TTGTATATTT GTAGCGTACA TATTTAATAA TCAATTAAAT AAACACACTC ATGAAAAAAC
  160141  TATTTAAAGG AGGATTGCTT AGTGTAGCAC TTTTAGCAGC CGTAGTAGTT AATGCAGCCG
  160201  AAAAAATGAA CGTAAAAGTT TTAGGTTCAA AGGCACTGAA CGTTTCTTTA TCTGGAGTAG
  160261  CAAAAGGGGA GTCTTTGTCT ATTGTTGATA AAAGTGGAAT TACGTTGTTT TCAGAAACAT
  160321  TGAGTCAGGC AGACGTATTT GAAAAAACTT TTGATTTAAC CTATTTGCCA GAAGGAGTGT
  160381  ATTTTTTAGA GTCAAATGAG GAAAAAAGAA TAAATGTATC ACCTATTCTT ATAGCAAATA
  160441  ATAAAGTTTC ATTAATTGCG GGTGGATCAA AAGTGTATAA CGAACCTAGG GTTGTTGTCA
  160501  ATGGTTCCAT TGCAAAGGTG GTTTTGGATA ATTCTTCAAA AACAGATGTA GTGATTACTG
  160561  TGAGAGATGC TGATGATTCA GAATTGTTAA GATCTGAGGT GTTAACCGCA GAAAATATAT
  160621  ATAAAAAGTT TGATTTTTCT GCCTTACCTA AAGGAGAGAC TTATACTATT ACAGTTAAGG
  160681  AAGATGATTA TTACTTTATA AAAGAAATTA ATTTATAGTT AGTTGTTGTT AATACATAGA
  160741  ATTAGTTGTT AAAATAGCCT TCTTTTTTGA GGGCTATTTT TTTTGTTGAA AATGAATACC
  160801  ATAAATTATA ATTATTATGA TTTAATTTTG TGATGAAAAT AGGATTAAAT CCTATTTTTG
  160861  TCAAAAATAG CAATACATGG CAGGAAACAG TTTTGGAAAA GTATTTAAGT TGACCACTTT
  160921  TGGTGAATCA CACGGGGTAG CTATTGGAGG TGTAATTGAT GGTTGTCCAG CAGGCGTTAC
  160981  TATAGATTTT GATGCTATTC AAGCAGAATT AGATCGAAGA AAACCAGGGC AATCAGCCAT
  161041  TGTAACACAA CGAAAGGAAC CGGATACTGT TGAGTTTTTA TCAGGTATTT TTGAAGGTGT
  161101  AACTACAGGG ACCTCAATAG GTTTTGTGAT TCGAAATGCG AATCAAAAAT CAAAAGATTA
  161161  TTCACATATA AAAGATTCTT TTCGTCCGTC GCATGCAGAT TATACCTATT ATAAAAAATA
  161221  TGGAGATGTT CGCGATTATC GAGGAGGAGG ACGTTCTTCA GCACGAGAAA CAGCTTCACG
  161281  TGTAGTAGCA GGTGCAGTTG CAAAGCAGGT GTTAAAGGGA GTGTCTTTTA ATGCCTATGT
  161341  TACTGGAGTA GGACATTTAA AATTAACTAC GCCTTATAAT GAATTGGATC TTTCGGCAAC
  161401  CGAGTCTAAT ATTGTGCGTT GTCCTGACCA AAATATGGCT AGTGAAATGG AAAGCTACAT
  161461  TAAGCAAATT AGAAAAGAAG GGGATACCGT AGGAGGTGTG GTGAGTTGTG TAATTAGTGG
  161521  TGTTCCTGTT GGTTTAGGAG AGCCTGTATT TGATCGCTTA CATGCCGAAT TAGGTAAAGC
  161581  AATGTTGTCT ATAAATGCGG TTAAAGGTTT TCAGTACGGT AGTGGTTTTG AAGGATCTGC
  161641  TTTAAAAGGA AGTCAGCATA ATGATCTATT TAATGCAGAT GGTACTACAA AAACAAATTT
  161701  ATCCGGAGGT ATACAAGGTG GAATATCTAA TGGAATGGAT ATTTACTTTG ATGTAGCGTT
  161761  TAAACCAGTG GCTACAATTA TGCAGGATCA ACATACGATA GATAAAGAAG GGAATATAGT
  161821  TGAAATGCAG GGAAAAGGAA GACATGATCC TTGTGTTGTG CCACGTGCTG TGCCTATAGT
  161881  TGAGGCTATG GCAGCTCTAG TGGTTGTAGA TTATATGTTG CAAAATAGAG CAAGTCAAGT
  161941  CTAACATATT ATGTTTCAAA AAAGACATAA AAAAAACTCG TAAAATTTAT TTACGAGTTT
  162001  TTTTTATGTC TTGTTTTGTT TTTAAGAACT TAAAGCTTCA CTTAGTGCCG CTTTTTTGTG
  162061  TCGACTAACA GGAATTTGTT CTTGGTCAAT TTCTATATTT CGGTTATTGT AGCGTTCTAC
  162121  TTTCTTCAAA TTTACAATAT AGGACTTGTG TACCCTTAGG AAACGTTCGC TTGGCAATTG
  162181  GGACTCAAAT GACTTCATAG TGGCTAAAAC AACCACAGGG TCACTGTTAT CCATAATTAA
  162241  TTTAACATAA TCACCTAAAG CTTCTACATA TTTCAAATTA TTTAAAAATA TTTTTCGCTT
  162301  CTTTAAATTG CTTTTTACAA AAATATAATC TTCATTTTCT GCCGACTTAC TTGTAGCAGC
  162361  CATTTTTGTT TGACTTAAAG CTTTTTCAAC TGCAGCATTA AAACGATCTC TTTTTAGTGG
  162421  TTTACGCAAA TAGTCTATAG CATCATAATC AAATGCCTTA AATGCATATT TTGTTTTTCC
  162481  AGTAACAAAT ATGGTCTTTG GTTTATTCTC TAAATCATCC AATAAATCAA AACCAGTTAG
  162541  AATTGGCATT TCAATATCTA AAAACAATAA GTCAACAGGA ATATCCAATA ATCCATTTTT
  162601  TGTTTCAATG GCGTTGTTCC ACTCTGCTAC TAGTTCTAAA GAGGAATGTT CCTCTATAAG
  162661  TTTAACTATA GCAAGGCGTT GCAACTTTGA ATCGTCAACA ATGGCACATT TCAGAATGGA
  162721  GTTATCTTGC ATATCTATCT AATTAGTTAT ACAATACTAA ATAATAAAAT CCAATATCGC
  162781  AAGAAAAAAC GTGTTTTGTC GGAAAAAAGT GAGTTTTGTC GATGTATAAT AATCGATGAA
  162841  AAGCACTTGT ATATTTGACT AAAAAGCTTA CTTTTGCAGT CTTAAAATTT AACAAATAAA
  162901  ATTTTTTTTA TGAATCATTA TGAAACTGTT TTCATCTTGA ATCCCGTTTT ATCTGAAGAA
  162961  CAGATAAAGG AGACAGTTAA GAAGTATGAG GATCTTCTTA CTGAAAATGG AGCAAAGATG
  163021  GTAGCTAAAG AAGACTGGGG TCTTAAAAAA TTAGCTTATC CTATTCAGCA CAAAAAAAGT
  163081  GGTTTTTACC ATTTATTTGA GTACACTGTG TCAGGTGAAG TTATAAACAA ACTTGAAATT
  163141  CTATTTAGAA GAGACGAGAG AATAATGCGT TACCTAACTG TAAGCTTAGA TAAGCATGCA
  163201  ATTTCTTGGG CAGAAAGAAG AAGAGTTAAA CTTAAACAAA AAGCTTAGTT ATGGCATCTA
  163261  TAGAACAACA AGCTAAAGGA AAAAAAGATG GAGAGATCAG GTATCTTACT CCATTAAACA
  163321  TTGATACTAA TAAAGAGAAG AAGTACTGTC GTTTCCAAAA ATCTGGAATC AAGTATGTTG
  163381  ATTATAAAGA TCCAGACTGG TTATTAGGTT TTTTAAATGA ACAAGGTAAA ATTTTACCAA
  163441  GACGTTTAAC AGGAACTTCT TTAAAGTACC AACGTAAGGT AAGTGTTGCA GTAAAAAGAG
  163501  CTAGACATTT AGCTTTATTG CCATATGTAG CTGACTTAAT GAAATAATCG ACCAAAACAA
  163561  TGGAACTTAT ATTAAAAAAA GACGTTGAGA ATCTAGGATT CGCAGACGAT ATAGTAGAAG
  163621  TTAAAAATGG TTACGGTCGT AACTTTTTAA TTCCTCAAGG ATATGGAGTA CTTGCTACTG
  163681  TTTCTGCTAA AAAAGTATTA GCAGAAAATT TAAAGCAACG TGCATATAAA GAGCAGAAGT
  163741  TAGTTGATGA TGCGCAAGCA TTAGCTAATA AACTTAATGG TCTTGAAATT AAAATTTCTT
  163801  CTAAATCAGG AGCTGGTGGT AAATTATTTG GATCTATCAC TAATGCCGAT GTTGCTGATG
  163861  CTTTAGCTAA AGAAGGAATT TCTATTGAAA AGAAATTTAT CAGCGTTCCA GGTGGTTCAA
  163921  TTAAGCGTTT AGGATCTTAT GAAGCTCCTG TGCGTTTTCA CCGTAACGTA ATTGCAAATG
  163981  CTGCTTTTGA AGTTGTTGCT GAAAAAGCAT AAGTATTTGA AAAAATAAGA AATAAGGCTA
  164041  TCTTGAAAAA GATGGCCTTT TTTTATGTCA ATCAAAATAG AGAAAACAAG TAAAATGAAA
  164101  TACGCTCGTT TATCAAAAGA ACAATTAGAA GCTTTACATC AAGAGTTTAT TAATTTTTTA
  164161  GCAACACAAT CTATAACAGG TGACGAGTGG GCTGAAATTA AAGCAAATAA ACCCGAAGTT
  164221  GCAGAAGAGG AAATTGATGT TTTTAGTGAT ATGATTTGGG AAGGTGTTTT GAATAAAGTG
  164281  GAATTTTTAG AACATTTTTC AAAAGATCAA ATTCATTTGT TTTTCCTTAC GGAAGAAAAA
  164341  ATGCATTTAA TAGCTATTAA AGTAAAAAAT AAGGCTATTG ATTTATTAAC CGATGAAGGT
  164401  TATAAGTGGT TGCAGCAAAA TTTAATGGAT GATAGTGTGG CATTTTTTAA TGCAACAAAG
  164461  GAGTATACCG AAGATAAAAA TGTAGATAAA TTCAAAATTA TCGAGCAAGG AGCTAATATA
  164521  ACCAAAGGAG ATTTGTATGC TTACTTTGCA AAGTTATTAG ATAACAAAAA GGATTAATGG
  164581  AGTTGTAGTC TGTATCTTAT GATAGCTTTA TTGCGGCTAT TTAAACCCGA ATTATGCATT
  164641  AAAAAATCTA TTACGTCTGC GATCTACTTC AAATACTATC GTAAACTGTA TTTTTTAATT
  164701  TAACCATAAC GGTGCTATGC TGAAATTAAG AAAACACTAG TATTTATTGT ATATCACAGC
  164761  CTCATGACAA AGTTTCAATG CATAATTCGG GTTAAACAAA CAAAAGCCCT TTTTTCAATG
  164821  AAATAAGGGC TTTTTGTTTT AAAGGTATCT TGTTTGTTGT TTAGCTTTTC ATAGTTACAA
  164881  TACGCTGTGG CAACGGAGCG TCGTAGTTTG CTTCTCCAAG GGCTTCTACA ATTTTTTGAC
  164941  GTGTATCCCA ATATACATCC CAATAGTCAT CAGATGTAGA GTAAGGTAGT GCTAATAATT
  165001  CAACGCCGTT CGGACCTAGA TTATTTACAG CTACTCTAGG AGCAGGATCC TTCATTACTT
  165061  TGTCATCGGC TTTTAGTACA TTCATTACTA CTTCTTTTGC TTTTTTTATG TCTGTACCAT
  165121  ACTGAATTGC AAAAGGCATA TCAACTCTTA AATGTCCAAT TGTGGTTAGG TTAGTAATAG
  165181  CTGCTGCCGT GATAGATCCA TTTGGTATAA TTTCAGTTTT GTTTTGAAAA GTTTCTAATA
  165241  TGGTAACAAA AACAGAAATT TCCTTTACAA AACCTAGTTT TCCGTTAGTT TCAATTAAGT
  165301  CGCCTACTTT AAAGGGTCTA AAAATAAGAA GCATAACACC TGCGGCCATA TGCCCTAATG
  165361  ATCCGTTAAA GGCACCACCA ATGGCTAAAC CTACAGCTGC AAGTAAAGCA GCAAAAGTAG
  165421  CAGTCGGTAT CCCTACAATT CCAGCAATGG AAATAAATAA TAGTACTTTG AGTAAAAAAC
  165481  CAACAAGTGT AAGTAGAAAA GGTTTTAAAG TGCTATCAAT TTTACTGGTA TCAAAAGCTT
  165541  TGCGAACGGC TTTTAGAATA ACTTTTATAA TCCATAGTCC AATAATAAGT GCTACTATAC
  165601  CACCTACTAT TTTAAGGCCA TATTGTGCAA CGCCTTCTTG AAGTGAATTA AATAATCCGC
  165661  TCAGGGAATT CATAACATCG CTGCTGGTTT TTGTGACATT TTGGGTAATG CTCTCTTGCA
  165721  TAGTAATAGT TTTAATTTAA AATTTAAGTT CTATTAAATT TCATAAAACT AATTGTAAAT
  165781  CAATATGTTT TGGTGTAAAT AATTAAAAAT ATTAGATGAA AGTGTAGTTA AATTCGTTAA
  165841  AAATCCAAGA ATAAACTTTT GATCTCGTCA TTTGGGATCA TGCAGCTTTC TTTTTTTCCG
  165901  AACCATTTAT ACCTGTTTTT GGCAATAAAA TCATAAATGG GATCTCTCAT TTTTTCTGGA
  165961  AAAAACAGAA ATATCCTTAG CAATGGGTAT AGGCCAGATA GTTCTTTTGA TATTTCTAAT
  166021  GCAGCTGTAG ATTTAAAGTA ATAAGCTTTT TTAGGGTCAA TAAGAATTAT GGAATCTATG
  166081  ATTTTTGGGT CAATATTTCG CTCAGCTAAT AATTCTTTAC CCAATTCACT TTGTAATGAG
  166141  GCATATCGAA AATTTCGTTT TTTATCATGT TTAATCATAA ATTGTATGGC GCCACTGCAC
  166201  AGGTTGCAAA CGCCATCAAA AAGAATGATT TTTATGTCTT TAGGGAGGTT ATTGTAGTCC
  166261  AAGTTCTTTT CTTAAAGGGG TGAATTTATT GGAATTTTGA TTCCAGTAAG GTAATAATTT
  166321  TGTCGTAATT CTTTTAGCAG TTGTGGGTAA GTGAGGTGAG ATTTCTTCAC TCCAGCTTTC
  166381  AATAATATAC GGGAATTGTT GTTGGAATGT AATTTTTAAG CTCCGTTTTA GTTCTGGATA
  166441  TGTTAAAGAG AATGTGTTTA AATTGTTGTT TTTTTGGATA GATGCTATGG CTTTATAGCT
  166501  TTGCGTTTTT TTGTGGTTTA ATCTTAAAAA TTCAAAGGAA GGAATGCAGT TTATTTCGCC
  166561  TTTAGGTAAT AGTTTGTCAC CATGTATTCG AATTAGATTC CATAACTCGT TTTCAAGGAT
  166621  GCTTTTTTGT AATGATAATT TTTGATCTCC TTCCGATGCA AAGTATGATT TTATATCTAT
  166681  TTCAAAATTC TTTTTGTTGT TAAGCTGCAT AAAAGTTTGG CCACACCATT CTTGAATACT
  166741  AGCAGTGGTT TTAAGTGCGT GTTTTTTTTC TCCCTTTAAA GGGGAAAAAG AACTTTGCAT
  166801  AATACTATAA GGGTATATGC CTGTAGTAAA CTTTTTAACA CTGTTAAGTT TGAGTACAGG
  166861  GATGTTTTTT GGAGCTGAAA TGTCAGCCTT TACTTGTTTT ATTGGTAAAA AATCTTCGGT
  166921  AACATAAATA AGTGTGGCAG TTCCATTACG TAATTCGCCA TACCTGTTTT GAGATAATTC
  166981  ATAGGTGGAA ATCTCGGCTT CTCCTTGGTA CCAATAACTT TTAAAATCGC TAGTTAGCTC
  167041  AATTGGATTT GGTCTGTTTT TGGAGCTTTC CTGACAATTT ACTAGGTGAA TACTTAGTAA
  167101  AAGACTTATG GCTATTGGCG TAAGTGATTT TTTCATAAGC AGTAAATCAG GGTTAGGAAT
  167161  TCGCAAAATT ATTTTTTTTT TAAATTACAA AAGCATGTTA GTAAATTACG ACTAGTTTAA
  167221  GGTTTTGTCA ATGCAATTAA CGTTTCGTAA ACAATATGCG TGGGTAAACC AACTACATTA
  167281  AAGTAGCTTC CTTTAATTTT ATCAATACCA ATAAGTCCAA TCCATTCTTG GATCCCATAG
  167341  GCGCCAGCTT TATCAATCGG ATTGTAGTTG GTTACATAAT AATCAATTTC TTCAATAGTT
  167401  AATTCTTTAA AGTGAACCTT GGTGGTGAAA TGTTTAGTTA TTTGTTTGTT TTTAGTGGTA
  167461  AAACTAACAG AGGAAATGAC ATCATGCCAG TCATTGCTTA AGCTGGCTAT CATTAGTTTA
  167521  GCGTGTTCTG CGGATTGTGG CTTGCCAAGT GCATGGTGAT TGTGCCAAAC AATAGTATCG
  167581  CTAGTAATTA AAATATCGTT ATGTTGTAAG CGTTGTTTAA AAGCTGCGGC TTTTAGTTCG
  167641  GATAAATAAT TGGTAATTTC TTCAGCTTTT AAATGATCTG GATAAACTTC GTCAACAGGT
  167701  TGTAGTTGGA TCTCAAAATC AATTTCGAGG TCTTTTAAAA ATTGTTGTCG TCTGGGAGAT
  167761  CCAGAGGCAA GAATGATTTG ATGATTTTTT AGTTTTTCTT GAAGCATTTT GAGTCGAATT
  167821  AAAAGGGTTA CCTGTGGTGA TAGGGTTCAT TTTTTAAAAT AGTAAAACCG CGGTATAGTT
  167881  GTTCGATAAT AAATAAACGT ACCATTTGAT GCGAAAAAGT CATTTTTGAA AGAGAAATTT
  167941  TTCCATTGGC TCTTTTGTAG ATAGTCTCGC TAAATCCATA AGGGCCACCT ATAACAAAAA
  168001  ATAAATTTTT GATGCCACTA TTCATGTGTT TTTGAAGGTA ATTGGAAAAA TCCACTGAAT
  168061  TGAATTGTTT ACCATTTTCG TCCAAAAGGA TAAGTGTATC AGATGTGTTT ATTTTTTTTA
  168121  AAATAAGTTC ACCTTCCTTT TCTTTTTGTT GAGTTTCGCT TAAGTTTTTA ACTTTTTTTA
  168181  AATCAGGTAT GATTTCAAAA TTGAACTTTA TATAAAAACT GAGGCGTTTT TTATAGTCTT
  168241  CAATTAATTG GGTTAATTGA AGACTGTCGG TTTTTCCAAT AGCTAATAAT GTAATTGTCA
  168301  TTGAAACAAA TTCGGATTAC TTTGTACATT AGCAAAAATA ACGATACCAA ATGATAAGTA
  168361  AGGAGCAATT TAACCATGAA ATAGAATTAA TCATTGCTAA TGCCATTCGT GAAGACGTTG
  168421  GTGATGGAGA TCATAGTTCA TTAGCATGTA TACCAAAAGA CACTCAAGGA AAGGCAAAAC
  168481  TATTGGTGAA AGACGAAGGG ATTTTAGCAG GAGTGGCGTT TGCTAAACAA GTTTGTGCTT
  168541  ATGTAGATCC TAATCTTGAA ATTGAAGTGT TAATACCAGA TGGTAGTGCT GTTAAGTACG
  168601  GAGATATTGC TTTTTATATT TCTGGAAGTT CATTAGCTAT TTTAAAAGCT GAGCGATTAG
  168661  TGTTAAATGC TATGCAGCGA ATGAGTGCTA TAGCGACTAA AACTAAGTTT TTTGTTGATT
  168721  TATTAGCGGG TACAGGAACA AAAATTTTAG ATACCAGAAA AACCACGCCG GGAATACGTG
  168781  CGCTAGAAAA ATGGGCAGTA ACCATTGGTG GGGGTGAAAA TCATCGTTTT GCATTATATG
  168841  ATATGATCAT GCTTAAGGAT AATCATATTG ATTTTGCAGG AGGTATTACA CAGGCTATTA
  168901  ATCAAACAAA AAGCTATTTA AAGGAAACCG GCCGTGATTT AAAAATAATA GTAGAAGCAC
  168961  GCGATTTAAA TGAAATTAAA GAAATTTTAA AATCCGATGG GGTATATCGT ATTTTAATTG
  169021  ATAACTTTAA TTACGAAGAT ACGCGTGAAG CAGTTCGATT AATTGGGGAT ACCTGTTTAA
  169081  CAGAATCTAG TGGAGGAATT GATGAGCATA CCATTCGAAA ATATGCTGAA TGTGGTGTCA
  169141  ATTATATCAG TAGTGGAGCG TTAACGCATT CGGTATATAA TTTAGATTTA AGTTTAAAAG
  169201  CAGTATGATT TGTCATTTAA ATTAACAAAA ATAGGATTAA AAATACCAGG GGTACTTTTG
  169261  TTAACTAAAG TGCTTAAAAA AATTGTAATA CCGGGTTTTG AAGGACTTTC AATTTACGAT
  169321  TTAGTAAAAA TGTACGTAAA TGGAATAGTT GAAGGGGCAT TTAGTACACG TGCGTCTGCT
  169381  ATTTCATTTA GTGTTTTTAC GGCTATTTTT CCTTTTTTAT TATTTTTATT AAACTTAATA
  169441  TCGGTAATAC CAATTGATGG TTTTCAGGAG GAATTTATTG TTTTTATAAA TAGTTTATTG
  169501  CCGCCGCGAA CTTCAGATTT TTTTGATAGT ATAATTTATG ATATAGCCAA TAAGCCTAGA
  169561  CCAGGTTTAT TGTCTTCTAC ATTTGTGCTT TCGATGGTGT TTATGACAAA TGGGATTAAT
  169621  GCTGTTTTTT CGGGATTTCA AAACTCATTT CATACCAAAA TAAGTCGTAA CTTTTTAAAA
  169681  CAATATGGTG TAGCGTTTTG GGTGGCAATA ATTGTGGCAT TGTTCTTGAT ATCTACGGTG
  169741  TATATCATTC TGTATTTTAC ATATTTAGTT ACAGCTTATG AGCAATTTTT AATAGGTGAT
  169801  ACTATATTTT GGTTAAAATT TGGAAGAGTA GGAATTTTCA TTTTAATGAT TTTTACAACT
  169861  ATGGCAACAT TATTTTATTT TGGAACAAAA GAAGGGAGAA TTACTCGTTT TTTTTCGCCT
  169921  GGAGCAGTAT TAACAACAGT TTTAATAATT GTGACTACAT ATTTGTTCGG ATTTTATATC
  169981  GATAATTTTT CTCGTTATAA CGAGTTGTAT GGTTCAATTG GTGCCTTATT AATATTGATG
  170041  TTTTATATTT GGATTAATGC AAATTTAGTT TTGTTAGGAT ATGAGCTTAA TGCCAGTTTA
  170101  AGAAATTTAA AAATGCAAAC AGTTAATAAA TAATAATTAA GAAATTATGA AGAAAGTATT
  170161  ACTAGCATTA GTCGCTTTAA TGATGTTGAA CTCAGCAGTA GCGCAAACTG TAATAGGTGA
  170221  TGCAACATTG CCTAATAACA AAACTTATGA ATCTCATGAG CTTATTTTGA ATGGAGCTGG
  170281  ATTACGTGAA AAATTATGGT TTGATTTGTA TGCCGCTGGT TTATTTTTGA AGGAGAAAAA
  170341  TACAGATGCG GATGCAGTCG TAGCAGCAGA CCAACCAATG GCAATACATT TAGTTATCTT
  170401  ATCTGGAATG TTGTCAAAAA AGAAAATGAT TGGTGCGTTT AGAGATGGAT TTGAAAATAC
  170461  AAATGATAAA GCTACTGTTC AAAAGCTTCA ATCTAAAATA GATAAATATG TCTCATTCAT
  170521  CTCTGAAGAA ATTAGTGTGA GTGATCGGTA TGATATCATT TATACCACAG AAAAAGGAAA
  170581  CGAATTATAC AAAAATGGAA AACTACTAGG AGCTATTGAA GGTCTTGAAT TTAAAAAAGC
  170641  ATTATTTAAT ATATGGCTTT CAAAAGAACC TGTAGATGAT GATTTAAAAG ATAGTATGTT
  170701  AGGAAATTAA AAAATAGTAT CTTTGCAAAC TTTAAAACCC AAATTTAAAA CCCTAAATAT
  170761  GAAACAATTA CTTATAACCC TTGCGTTGCT TTGCTCGGTT GTAGCTACTG GATATGCTCA
  170821  AATCCCTGTA GGAAGAACAG TTATGGAATA TGAAGTTGAG TATGATGATA CCACACTTAA
  170881  AATGAATGGA GCGGGAACAT GTTCAATGCT TTTTATTGAA TTATACTCTG GTGGTCTTTA
  170941  TTTACAGGAA AAAAGTAGCG ATCCAATTGC TATAGCATAT GATGATGAAA CAATGGCTAT
  171001  TCGAATTAAA ATCACATCAA AATTGATTAA GCGTGAAACA ATGTTGAGTG CCATCGAAGA
  171061  AGGTTTTGAG AAAGCTACCG AAGGTAAAAC AGGTCCTTTA AAAGATAGAA TAGCAAAAGT
  171121  TAGAGAGTAT TATGCGAAGC CGATAAGTAA AGGAGATTTG TTAGAGCTTG TGTATGTCAA
  171181  GGGTAAGGGA GTTTTCTGTT ACTTAAACTC TAAAGAGCTT GGTGTTATCG AGGGACAAGA
  171241  TTTTAAATTC GCTTTATTTA AAATATGGTT AGGTGAAAAT CCAGCTAGTG AAAGTTTAAA
  171301  GAAAGGGATG TTAGGAGATT TTTAGAAAAC AACTCATTTT ATAATATTAA AACCTTAATT
  171361  GTGATTATTT GAGCAATTAA GGTTTTTTTT ATATGTAAAA TTAACTATTT AGTTTATTGT
  171421  AGTTTAAATA CAATAGCTTA TATTTGCACT CAGAAATTAA TCCCTACTAA CCCGATAGGA
  171481  ATTAAATATT TTACGACAAA CTAGGTATGA TAACAGAAAA AGTAGCAGGA GCAAATACTA
  171541  CATATGCGCA AGATGCGAGT TCGGAAAAAC CAATTCGGAG TGTTGTGAAA GCAGTCAGTT
  171601  GGCGTGTGGT AGGTACACTG GATACTTTAG TGGTGTCCTA TTTAGTACTC GGTGAAGGAA
  171661  GGTTAGGGGA GGCTTCAGCA ATTGCAGGAG TGGATTTTGT AACTAAAATG ATTTTATACT
  171721  TTGCTCACGA AAGAGTTTGG AATAAGGTAA AATGGGGAAA GTAGTTTGAT ATTGCTTTTT
  171781  TAGGATAGTA GTAAAAATAA ATTTTGCTGA AAGTGAATAA CTGACGGCTG AAAGCTGAAA
  171841  ATATGAGTTT TACACAAGAA GAAATAGTAA AATATAACGA GGAACTTAAA GGGAAAACGC
  171901  CTTTGGAAAT CGTACAGTGG GCAGTAAGTA AGGCGAAAAA ACCTGTGGTA ACAACAAATT
  171961  TTAGACCTTA CGAAGCTTCG ATATTGGAAG TATGCGTTGC GGCAAAAGCT GATATCCCTG
  172021  TTATTTGGTG TGATTCTGGT TACAATACGC CAAATACGTA TCGCCATGCC GAAGCTGTAA
  172081  TTGCGCAATT GAATCTAAAT GTGGATTTGT ATGTGCCTCA ACAAACAGTA GCACACAGGG
  172141  ATGTGGTTAT GGGAGTACCT GGGGTTGATG ATCCTAAGCA TGCTGAATTT ACGAAGCGGG
  172201  TGAAATTAGA GCCTTTTGGT AGAGCAATGG AAGCACATAA ACCAGATGTT TGGTTTACAA
  172261  ATTTAAGAAA AGGACAAACC ACATTGCGTG ACTCGTTGGA TATATTAAGT TTGGGAGCTA
  172321  ATGGCGTATT AAAAGTAAGT CCTTTTTATA ATTACTCTGA TGCCGAATTG GATGTCTATT
  172381  TATCAGAAAA AGGATTGCCA AATGAACATA AGTATTTCGA TCCAACTAAA GTCTTAGGGA
  172441  ATAGGGAGTG TGGATTACAT ACGAGTAATT AAAATGTGAT ATTTGTTCTG TCGAATCGTT
  172501  TTAGTTTTTA TGGTATTACT AGCTAAAATG AATGATGAAA ATAAAATTGA TAATCCCCTT
  172561  AATGAGCCGT ATTTTTGCAA ATTCAAAAAG GGAGATAAAA TAAATAAGAA ATTATTGATA
  172621  GCTGAAAGCC ATAGGTGGAC AGCTGAAAGC TGAAAAAAAA TGAGTAAAGA ACTTTCAATA
  172681  AATCCATTAG AAACAGAAGC GATACATATA TTTCGCGAAG TAGTTTCTCA GTTCGAAAAG
  172741  CCAGTATTGT TATTTTCGGG AGGAAAAGAT TCTATTACAT TGGTGCGTTT GGCGCAAAAA
  172801  GCCTTCTGGC CAGCAAAAAT ACCTTTTCCA TTGTTGCACG TGGATACAGG TCATAATTTC
  172861  CCTGAAACTA TCGAATTTAG AGATCGTTTA GCTAAGGAGT TGGGTGTGGA GCTTATTGTG
  172921  CGTAATGTGC AAGATGCTAT TGATGCAGGT AAAGTGAAGG AAGAAACGGG GAAGTACGCA
  172981  AGTCGTAATT CATTACAAAC AGTAACACTT TTAGATGCTT TAGAAGAATT TAAATTCGAT
  173041  GCCGCTATTG GTGGAGCGCG TCGTGATGAA GAAAAGGCAC GTGCTAAAGA GCGTATTTTT
  173101  TCGGTACGTG ATGATTTTGG ACAGTGGGAT GAAAAAAACC AACGTCCAGA ATTGTTTGAT
  173161  ATGTTGAACG GAAAAATTGA TTTAGGTCAG AACGTTCGCG TATTTCCAAT TAGTAACTGG
  173221  ACAGAATTGG ATGTATGGAG TTATATAGAG CAAGAAGAAA TTGAAATTCC TTCTATTTAT
  173281  TTTGCGCACA AACGTAAAAC TTTTGTTCGT GATGGCATGA TATGGTCTGC CGAAGATGAT
  173341  GTAGTGTATA GAGAAGAAGA TGAAATTGTA GAAGAGCGAT TAGTGCGTTT TCGTACTGTA
  173401  GGTGATATGT CATGTACCGC AGCGGTACTT TCAGATGCTG TAAGTATCGA AAAAGTAGTA
  173461  GGTGAGATTA GAGAAAGTAC AATTTCAGAA CGTGGTGCGC GTATTGATGA TAAACGATCC
  173521  GAAGCTGCAA TGGAAACACG TAAGCAACAA GGGTACTTTT AATAGTTGTG AGTTAGCAGT
  173581  TGTGGGTTGA GTGTCTTTTC AATTGCTGTA AAATAAGTTA TAAACAGATA AAATAGGAGT
  173641  TTTAGTTTAG TGGTCAATAT AAATTAAGTC TGACAACTGA CAACTAAAAA CTACCAACCA
  173701  AAATAGGATG GAAGTATTAA AAATAGCAAC AGCAGGAAGT GTCGATGACG GTAAAAGTAC
  173761  CTTAATCGGT CGTATCCTTT ATGATACAAA ATCATTAACT ACAGATAAAT TAGAAGCTAT
  173821  TGAAACACGT AGTAAAGCTA ATGGCTTTGA CTATTTGGAT TTTTCATTGG CAACCGATGG
  173881  TCTAGTAGCA GAGCGTGAGC AAGGGATTAC TATTGATGTA GCACATATTT ACTTTTCAAC
  173941  AGCAAAAAAG AGTTACATTA TTGCAGATAC TCCAGGTCAT ATTGAGTATA CACGAAATAT
  174001  GGTTACAGGG GCATCAACAT CGCAAGCATC TATTATATTA GTTGATGCAC GTAATGGTGT
  174061  TATTGAGCAG ACATATCGTC ACTTTTTTAT CAATAATTTA TTGAGAATAA AAGATATTGT
  174121  AGTTGCTGTA AATAAAATGG ATTTAGTAGA TTTTTCGGAA GAAAAATTTA ATGCTATCAA
  174181  AGCTGAGTTC GAAAAAATGA TAGCTCAAAG TGATTACAAG GATCAAAACA TCACTTTTGT
  174241  ACCGATTAGC GCTTTAAAAG GAGATAATGT TGTTTCTACA TCAGAAAATA CACCTTGGTA
  174301  CAAAGGAGAG TCTATTCTGG ATCATTTGGA AAAGTTAGAA GCTCAAGATG TATTTGAAAA
  174361  AGGACAAGCG CGTTTTCCAG TACAAACGGT TATTCGTCCT AAGAAAGATG AATTTCATGA
  174421  TTTTAGAGGA TATGCAGGGA AACTTTATGG AGGTGATTTA GCTGTTGGTG ATCAAGTAAC
  174481  AGTATTACCA TCATTAACAA AATCGAAAAT TAAAGAGATT TATTTCTTTG ATAAAAAATT
  174541  TGACAAAGCA GGTAGAGGAA GTTCAATTAA TGTAACTTTA GAAGACAATA TTAATGTATC
  174601  TCGTGGGGAT ATGATTGTGA AAACCGGTGA AGAGCCAGGA GTTCACAAAA CATTAAAAGC
  174661  TAAAGTATGT TGGATGGATA GTAAAAACCT AGTTGGAGGT ACTAAATATT TATTACAACA
  174721  TGGAGTAAAT AGAGTGCAAG CTATGGTTAC TGGTATTGAT AATGTATTAG CTCCGGATTT
  174781  TTCAGGAGAG GATGCCTCGG CAGATGCATT AGCATTAAAT CAAATAGGTG AAGTAAACAT
  174841  TAAGTTAGCA AAGCCTGTTT TTTATGATAA GTACGCAGAA AATAAAACCA ATGGATCATT
  174901  CATATTAATT GATCCACAAA CAAACCACAC GGCAGGAGTA GGGTTTATAC AGTAGTCATC
  174961  AGCCTTTGGC TGAAGTACTA AGTAGTGAGT ACAAAGTATT AAGTTTTAAA GTGTTTGATA
  175021  AAGTTGTAAC ATCGAACGGA CAACTAACAA CAGACAACTA ACAACCAAAT TAAGATGCAA
  175081  AGTTTTAGAA CCGAAATAGA GAATCCAATT GTTGAAAAGG ACATTATCGA ATTAGCCGAT
  175141  AAAATCCAGA TGTTTCACAA TGGAAAAATT GATGAAGAAA AGTTTCGTAG TTTACGTTTA
  175201  GCACGTGGAG TATATGGGCA ACGTCAGGAA GGCGTTCAAA TGATTCGTAT TAAATTGCCT
  175261  TATGGTAAAG TACGATCAAA TCAATTACGT CGTATTTGTG CCGTGTCCGA TGAGTATTCT
  175321  CGTGGACGTT TACATATAAC TACGCGTCAA GATATTCAAA TTCACTATGT GGATTTAAAT
  175381  CGTACACCAG AACTTTGGGC TGAGCTAGAA AAAGACGAAG TTACTTTGCG TGAAGCTTGT
  175441  GGAAATGTGG TACGTAACGT TACGGCATCG GAAACAGCAG GTTTTGATGT GAATGAGCCG
  175501  TTTGATGTAC AGCCTTATGC CCATGCTATA TTTGAAGAAT TTTTACGTAA TCCTATCTGT
  175561  CAAGAAATGG GACGTAAGTT CAAAGTATCT TTCTCTTCAA CAGATGAAGA TACAGGATTG
  175621  TCTTATTTAC ATGATATCGG TTTTATAGCA AAAATAGAAA ATGGAGTACG TGGGTTTAAA
  175681  GTAATGGTTG CTGGAGGATT AGGTTCTCAG CCACATCTTG CGGAAACCTT ATATGAGTTT
  175741  TTAGCAGCGG AAGAAATTAT TCCTGCAATG AACGCTATTT TACGTGTGTT TGACCGTTTT
  175801  GGAGAACGTA AGAGTAGAGC TAAAGCCCGA ATGAAATTCT TAATGGCAAA AATTGGTTTG
  175861  GATGCCTTTA AAGAATTAGT AGAAGAGCAA CGTATTGCGG TTCCGTATAC CTCTGTAGCT
  175921  ATTGATGCAG ATGCGTATCC ACAGCCTGTA ATTGCTGAAG TTTCTGAAAT TCCTTCAGTG
  175981  GAAATTAAGG ATCAAAAAGC ATTTACACAA TGGAAAGCAA CTAACTTGAT TCCGCAAAAG
  176041  CAAGCAGGTT ATATAGCTAT TGGAGTAAAA GTATTGTTAG GAGATTTTTA TACAGACAAA
  176101  GCACGTTTAT TAGCTGACTT GGTAGATAAA TATGCTGCAG GTGAAATTCG TTTGACTTTA
  176161  CGTCAAAACA TTGTGATTCC TCATGTTAAG GAAGAATTAA TTGAGGTTGT TTATGCTGAA
  176221  TTAGAAAAAC TAGGTTTTGT TGATGCTGGA TATAATAAAG CAGTAGATAT TACAGCTTGT
  176281  CCAGGTACAG ATACCTGTAA CTTAGGTATA GCTAGTAGTA CGGGTATTGC CGAAGAATTA
  176341  GAAAAAGTAA TAGCGTCCGA ATTTCCACAG TATTTGAACA ATGAAGATGT GGTAATTAAG
  176401  ATTAGTGGAT GTATGAATGC TTGTGGTCAA CACAACATGG CAAACATTGG TTTCCAAGGA
  176461  ATGACCATTC GTACAAAAGA TAAAAAAGTA GCACCTGCAT TACAAGTATT ACTTGGAGGA
  176521  GGTAACTTTG GAAATGGTGA AGCTCGTTTT GCCGATAAGG TAGTAAAAAT ACCAAGTAGA
  176581  CGTGGACCGG AAGCTTTACG TAGAATCTTA AATGATTTTG ATGCTAATGG GAATGGTAAA
  176641  AAGTTTGAGG AGTATTATGC TGAAAAAGGG GAACGTTATT TTTATGATTT CCTAACTGAA
  176701  TTGTCAGAAG CAGATAGTCT TCCAGCTGAA TACTTTATTG ATTGGGGAAC TAATGAAGAG
  176761  TATGTAAAAG CAATTGGTGT AGGTGAATGT GCTGGTGTAG TAATTGATTT AATTGAAACA
  176821  TTATTCTTAG AAAGTGAAGA AAAAATAGCT AATGCTAAAA TTTCTTTTGA TAATGGAGTA
  176881  TATAGCGATG CTATTTATCA TGCTTACAGT TCTCAAATTA ATTCTGCAAA AGCAATTTTG
  176941  TTAGCCGAAA ATAAAAAGAC AAATACACAG GCAGATATAG TAGCTGGGTT TGATAAAGAA
  177001  TTTGTGGAAA CAGGTGTAAT CAAATTAGAA GGTACATTTG CCGATAGTGT GTATGCGATT
  177061  AATAAAAATG CGCCAACAAA AGATTTTGCA ACGGATTATA TCGCTGATGC AGAAGCATTT
  177121  TTAGTAGCAG TACGTAAATT TAGAGCAGCC TCACAAAACG CATAAGTATT GAGTAACTAT
  177181  AACGAAAATA CAAGTAAAGG GAAGTTAACC GTAGTTGGAG CAGGTCCAGG TGACGTGGAA
  177241  TTGATTACGT TAAAAGCCAT CAAAGCATTA AAATCGGCAG ATGCAGTATT ATATGATGCT
  177301  TTGGTAAACC CGGAGTTATT GGATTACTGT ACTAATGCAG ACCTTTTATA CGTAGGTAAA
  177361  CGTAAGGGGT GCTACGCTTT TCAACAAGAA CAAATTAATG AGTTAATAGT TCAGTATGGG
  177421  AAAAGTCATG GACATGTAGT ACGTTTAAAA GGAGGAGACC CATTTATTTT TGGACGTGGC
  177481  GCCGAGGAAA TGGAATATGC AGCAAAGCAA GGAATGGAAG TGGCTATGGT ACCAGGATTA
  177541  TCATCGTCAG TTTCGGTACC AGCAATGCAA AATATTCCAG TTACTAAACG CGGAAGTGCA
  177601  GAAAGTTTTT GGGTAATCAC AGCGACAACC AAGGAGCATA AGTTATCCAA AGATGTGTTA
  177661  ACAGCAGCTA AGAGTAATGC TACGGTAGTG ATTTTAATGG GAATGCATAA ATTAGGTCAA
  177721  ATTACCGAAG TTTTTGCTAA CGAAGGAAAA TCAGAAACAC CAGTAGCCAT TATTCAAAAT
  177781  GGTACACGAG ATACAGAAAA AGTTGTAGTA GCAACAATAG CAACTATTGA AAAGGAAGTG
  177841  AAAAAACAGG AATTGTCATC GCCAGCAATC ATAGTTATTG GTGAAGTGGT AAATCATAGG
  177901  ACATCGCTTT TGGAAATGCA ACAAAAGTTA AATGAAGTAT AATGTGAGCT ATTGGCTATC
  177961  AGCAATAGGC TTTTAGCTTT TAATTTGTAA AAAGAAAGCC AATTGCCATG GGCTAAAGGC
  178021  TAACAGCAAA AAGATGGAAA GAAATAATTT ATATCCCGTT TTTCTAAAAG TAAAAAACCT
  178081  TAATGTACTT ATAGTAGGTG GAGGTAATGT TGCGGAAGAA AAACTACATT TCTTGACCAA
  178141  GTCAAGTCCC GATGCTAAGG TGTTATTAGT AGCTCCAATG TTTAGAGAAG GGACAATTGC
  178201  TTTAGCAAAT AAGTTTTGTG CAACTATGGT TACCGATGTG TATCATGAAA AGTATTTGGA
  178261  AGGTAGGCAT ATTGTAATTG CAACTACAGA AAAACCAGAA GTAAATGTAC AGGTTTGGAA
  178321  GGATTGTAGA GCACAAGCTA AGTTAGTAAA TGTAGCAGAT AACCCTCCAT ATTGTGATTT
  178381  TTACATGGGA GGCATTGTTA CAAAAGGAAA TGTAAAAGTG GCTATTTCGA CAAACGGAAA
  178441  GTCACCAACA ACGGCCAAAC GTTTACGTCA ATTTTTTGAG GAAGTAATTC CTGAAAATGT
  178501  AGATGATTTG GTACAGAATT TGAACGAGTA CAGAAAAACC ATAAAAGGTG ATTTTGAAGA
  178561  GAAAGTAGAA ACTCTTAATG AATTCACTAA AGGATTAATA GCAAAAAAAG AAAAGTAATG
  178621  ATAAAAACTG ATATTCTTAT TATCGGAGCA GGGCCAACAG GATTGTTTTG TGTTTTTGAA
  178681  GCAGGTTTAT TAAAATTAAA AACGCACCTT ATTGATGCTT TACCACAACC AGGTGGACAG
  178741  TGTTCAGAAA TATATCCAAA AAAACCTATT TATGATATTC CTGGCTTTCC AGAAGTATTG
  178801  GCAGGGGATT TGGTAGATAA CCTAATGGAG CAGATTAAGC CTTTTGAGCC TGGATTTACT
  178861  TTAGGAGATC GTGCCGAAAC TATTGAAACT TTAGATGATG GTACGTTTGT AGTTACTACA
  178921  AAGCGTGGTG TAAAACACAA TGCTCCTGTA GTTGCTATTG CAGGTGGGTT AGGTTCTTTT
  178981  GAGCCACGTA AACCACCTAT CCCAGGAATT GAAGGATTTG AAGATAAAGG CGTTTCTTAT
  179041  ATTATACGTG ATCCAGAGGT ATACCGTGAT AAAAAAGTAG TTATTGCTGG AGGTGGAGAT
  179101  TCTGCTTTAG ACTGGTCTAT ATTTTTAGCT GATGTTGCAG CTGAGGTAAC TTTAGTACAC
  179161  CGTAGAAAAG AATTTCGTGG AGCTTTAGAT TCTGTTGAAA AAGTAGAAGA GCTTTCAAAA
  179221  GCAGGAAAGA TTAATTTGAT TACTGATGCC GAAGTAAAAG AACTTTTTGG TGAAGGAGAA
  179281  TTATCTGGTG TGGGGATAAA GCACAAAGAA AAGGGAGATA TTAAATTAGA GGTAGATAAT
  179341  TTTATACCAC TATTTGGATT ATCTCCAAAA TTAGGACCAA TAGGTAACTG GGGGTTAGAG
  179401  ATAGAGAAGA ATGCTATTAA AGTGGATAAT TCATACGATT ATCAAACTAA TATTCCTGGA
  179461  ATTTATGCAA TTGGAGATGT AAATACGTAT AAAGGAAAAT TAAAATTAAT TCTTTCTGGT
  179521  TTTCACGAAG CTGCAATTAT GTGTCAGAGT GCTTATCAAA GAATATTTCC AGATAAAAAA
  179581  TATGTAATGA AGTATACCAC TGTTGGTGGA GTTACAGGTT TTGATGGAAG TAAGAAAGAA
  179641  GCGAAAAAAG AAGTAGTAAA AGCTATTGGA TAATTTTTGT TGTCAGTTTG TAGTTGTCAG
  179701  TTGTTAGTTT AATAATTGGG AAACTTCACA AACTTGACTT TAATTAAAAT ATAAATATTT
  179761  AGTTGTTTTC ATTTTAGGTG TATAAGACCT AACAACTAAC AACTAACAAC TAACAACTAG
  179821  TATGTCAGAC GTTACAATAA AAATCACAGA CCGTGAAGGT AAAGTACACG AAGTACAAGC
  179881  ACCTACCGAT ATGGCAATGA ACTTAATGGA GGTTTGTAAA GCTTATGAAT TACCTGTTGA
  179941  GGGTACGTGT GGAGGAATGG CTATGTGTGC ATCTTGTCAA TGTTATGTAA CTTCCGATAC
  180001  TCCGTTACCA GAAATGGGTT ATGATGAGGA TATGATGCTA GCAGAAGCTT TTCATGTAGA
  180061  AGATAATTCA CGTTTAGGAT GTCAAATTCC AATTACTCCT GAATTGGATG GGTTAGAGGT
  180121  AACTTTAGCA CCCGAATAAA TTACATGAAT AATAATAATT GTAAAACCGC CTTTTAGGGC
  180181  GGTTTTTTTA TATGATATGT TTTAAAATAG TGTCAAAGGC ATAATGAAGA GCCTTGATGT
  180241  TACTTAAATG TTAATAAAAC TAATTTTTTA TGGTTAAATT GCATATTCAA TAGACTTTCG
  180301  CTGGAAGTAG TATAACTTCT TCTCTAAGAA TTGAAAAATA CATGAAACAA AAAAAAATTG
  180361  CCATAGTAGG AAGTGGTCTT GTAGGCTCAT TATTAGCTAT TTATTTAAGG AAAAGAAATT
  180421  ATCAGATTAC TGTTTTTGAT CGTAGACCCG ATATACGAAA GATAAAGTTT AGTGGGCGTT
  180481  CTATTAATTT AGCGATGTCT GTTCGCGGTT GGAATGCTTT GGAGGCTATA GGGATTAAAG
  180541  AAGAGGTTGA AGGATTAGGA ATACCCATGT ATCATCGATA TATCCATGTG AATACCAAAG
  180601  ATGATTATAC GCAAAAATAT GGAAAAGATG GAGAGGCAAT TTACTCTATA TCTCGTGGAG
  180661  TATTGAATCG TAAAATGATT GATTTAGCGG AAAAGGAAGG TGTAGTATTT AAATTTGAAG
  180721  AAAAAGTATG GGATGTAAAT TTGCCCGAAG CTAAATTGTA TACAGGTGAA ACTGAAAAAG
  180781  GAAAGTGGGA AGAACATGAA TTTGATTTAA TTTTTGGATG TGATGGTGCT TTTTCACGTA
  180841  TACGTCATAA AATGCAGCGT CGAAGTAGAT TTAATTATTC GCAAGATTTT TTAAATACAG
  180901  GCTATAAAGA ATTATCGATT CCTGCAGATG CTAATGGAAA ACATGTTATA GATAAAAATG
  180961  CGTTACATAT TTGGCCTAGA GGTAAATTTA TGCTTATCGC TTTACCAAAT TTAGATGGAA
  181021  GTTTTACTTG TACACTATTT ATGCCTCATG AAGGCGAAAA TTCATTTGAA AGTTTAACTA
  181081  CCCCACAAGA AGTTCGAGTA TTTTGGCAAA CCTATTTTCC AGATACGTTA CAAATTATGC
  181141  CAACATTGTT AGAGGATTAT ATGAGTAATC CAACAAGTGC CTTGGTAACT ATGAAATGTT
  181201  ACCCTTGGAC CTATTGGAAC AAAGTAGCTT TGGTGGGTGA TTCTGCTCAT GCTGTTGTGC
  181261  CGTTTTATGG TCAAGGAATG AATGCAGGTT TTGAAGATGT ATTTGAGTTG GATCAGATTA
  181321  TTGAAAGATT AGGAGATACA GATTGGCAAA ACATTTTTGA GACCTATCAG GAACAACGTA
  181381  AACCTAATGC AGATGCTATT GCGGAGCTTT CGTATCGTAA TTTTATGGAA ATGAGTCAAA
  181441  AAACAGCTGA TCCAAACTTT ATACTACGTA AAAAAATAGA AAAGAAATTT TCGGAACACT
  181501  ATCCTGAGTT ATGGCAGCCT TTATATTCGC GTGTGACCTT TTCAAATCGC CCTTATTCTG
  181561  AAGCGATTAG TTATGGTGAA GTACAAGCAG AAATAATGGA TCAGGTGATG CAAATGGAAA
  181621  ACATCAAACA AGATTGGGAT ACTGATGTTG TTATGGAGTT TATTAAAGAG AAATCCTCAA
  181681  AAAGCATGAT TTAAAAAATG ATTTTTTTTA AATAGATAAA GCTCATATCA TTATGGAAAC
  181741  TCATTTTGTA AGTATTGGTT CATCATTATA CAAGGAAGCT TGTCAACTGA GAAAAGAATT
  181801  GTTTTTTAAA GACTTGGAAA ATGCAGAACT TTTGTTAAAT GATAACTATG AAAAAAATAG
  181861  TATGCATTTA GTAATAGAAA GTAAAGGTGC TGTCATTGGT ACTGGAAGAC TTACAATAAC
  181921  CGATAATAAT ACTATTGGAA TCATTTCTCA GATGGCTATT GATCCAGATT TTCAACGACT
  181981  AGGCTTGGGG AAATTTATTT TACAATCTTT GTTAAAAAGA GGCAGGGAAT TAAATGTAAA
  182041  TAGGATAACG CTAAATGCAA GACTGACGGC TATAACGTTT TATGCTAAAA ATGAGTTTAT
  182101  TCCTATAGGG GAGGTTTTTG CATCGACAAA AACAGGAGTA CTCCATCAAC AGATGGAATT
  182161  ACAGTTAGGT TAATTTCTGA TTTAAAAAAA AAGTTACCTA AGAATAAAAA GTAAATCAAC
  182221  TATTAGGGGT TAATTTCTTT TGTGTATTCA TAAACAAAAG CATCTACAAT ATTACCTTTT
  182281  GTAAAAACCT TGGTAGTTGT TCTGATGAAT AAGCTCTCTT CTGGTTTTTT TGGAAAAAAA
  182341  CCTTCGTAAA AATCAAGTTC AGAAAGTACG AAAGTGTTAT TTGATGTGAT TTTTAATAAT
  182401  TCACCATAAG TTTTGTAAGT CTTATTACTA TCAAGCTTTA TTCCTGGGAA TTCTCCTAAA
  182461  TGATATTTTT TAGCATAAAT ATAACCTTTA GCTATTTTTG TCGAATTTTT TTTGAGCAAT
  182521  TGAGCAAAGG GATTTTTGTG TTTGTTTAAG AGTGTACCGT AAACAAACAA GAAAATTTCG
  182581  TTATTCATTT TTTAACAATT CAGGGAATTT AGCTTTAAAA CGATTTAAAC GAGGAATTGA
  182641  AACTCTAACA ATATATGGAT ATTCAGGATT GCGCTTTTCA TAATCCTGAT GATATGCTTC
  182701  GGCTTTATAA AATTTTTCAA AAGGAATAAT TTCTGTTCTT ACTTTTTTTG AAATGGTATT
  182761  CTGCACTTCT TTTCTGGCTT CCACAGCAAT TAGTCGTTCA TTTTCATTTT GAAAGAAAAT
  182821  AATAGAACGA TAAGCAGATC CAAAGTCAGG TGCTTGACCA TATGTTGTTG GATTTTGTGA
  182881  GCCGTAATAA ACTTTTACAA GTGTTTTGAA GTTAATGATT TTAGGGTCAT ATTGTACTTC
  182941  TATAGTTTCA GCATGTCCAG AATTCCCAGA ACCAACTTGT TTGTACGTTG GGTTATCAGT
  183001  AATACCTCCA GAATAGCCCG AAACAACTTC TTGTACTCCT TTTACACTTT CAAAAATAGC
  183061  TTCAACACAC CAAAAACACC CACTAGCAAA ATAGGCGTTT TGCAAACCGT CATTACGTTG
  183121  AGTTTGTATG GGTTCCGAGT TAATTTTAGA AATAGGATTT TTTGGATTAT TAATACAGGC
  183181  ATTAATGCCC AAAATAAAAA GGGATAAAAT AACTAATGAT TTCATGACTG TAGGTTTTAT
  183241  ATAAGTAATA GTCTACATTG GGGAGTAGAC CTTTCTATTA AAGATACAAA AAAGCCCTCA
  183301  ACTATAAAAA TAGTGAGGGC TACTTGTTGT TAAAAGAAGG TTTTATCCGT TCATAGATAT
  183361  TAGAAACTCT TCGTTGTTTT TTGTTTGCTT TACACGTTGG TTTATGGATT CCATAGCTTC
  183421  TACAGGATTC ATATCAGCTA AAAACTTACG TAATACCCAC ATGCGTTGCA TAGTAGTGTC
  183481  ATCAAGTAAA ATGTCATCTC TACGAGTGCT ACTTGAAACA AGATCAATAG CAGGGAAAAT
  183541  ACGGCGGTTA GATATTTTTC GATCTAACTG TAATTCCATA TTACCAGTAC CTTTAAATTC
  183601  TTCAAAAATA ACTTCGTCCA TTTTTGAACC AGTTTCTGTT AAGGCTGTAG CAATAATTGT
  183661  AAGTGATCCT CCACCTTCAA TATTACGGGC AGCTCCAAAG AAACGTTTAG GCTTGTGTAG
  183721  GGCATTAGCA TCTACACCAC CACTTAGAAT TTTACCACTA GCAGGTTGAA CCGTATTATA
  183781  GGCACGAGCT AAACGCGTAA TAGAGTCAAG TAAAATAACT ACATCATGAC CACATTCAAC
  183841  CAAACGCTTT GCTTTTTCTA AAACAATGTT TGCTACTTTC ACATGTTCAT GAGCTTCCTT
  183901  GTCAAAGGTT GAGGCTATAA CTTCACCTTG AACATTACGT TGCATATCTG TTACCTCTTC
  183961  AGGGCGTTCA TCAATAAGTA ATATCATCTG ATAAACTTCA GGATGGTTGG CTGCAATAGC
  184021  ATTAGCAACA TCCTTTAGTA GCATAGTTTT ACCAGTTTTT GGTTGTGCTA CAATCATTCC
  184081  ACGTTGCCCT TTTCCTATAG GAGAAAACAA ATCCATAATT CGAGTTGAAA TGGTACTTTG
  184141  TCTATCTGCA ATATTAAATT TTTCTTGAGG GAAAAGTGGT GTCAAGTGTT CAAATGATAC
  184201  ACGATCACGA ACCACTTGGG GACTGAGTCC ATTAATTTGG TTTACTTTAA TTAAAGGAAA
  184261  GTATTTTTCA CCTTCTTTGG GTGGGCGTAC TTGACCAAGT ACGGTATCAC CAGTTTTTAA
  184321  ACCAAATAAT CTTATTTGAG ATTGTGATAC ATAAATATCA TCGGGTGATG ATAAGTAGTT
  184381  GTAGTCACTG GAACGTAAAA AACCATAGCC GTCCTGCATA ATGTCTAAAA CACCTTCGCT
  184441  CTCTATTATG GCGTCAAATT CAAAGTCAGG CTCCTTGTAA CGATTTCTAG GGTCTCTGTT
  184501  TCCTTTATTG TCTCTAGTAT TTCCGTTATT ATTTTTGTGA TTTTTGTTTT TGTGATTGTT
  184561  GTTAGCGTTG TTGCCACGAT CGTTTTTTTC AAAACGAGGT TTGTTGGGCT CTCTTTTTTC
  184621  ATTTTTTACA ACTTCTTTTA CAGGAGCAGC ATCTTTTTCA GGTGCTTTTC GCTTTGGTTT
  184681  AGCTAATTCA GGAGTGTTGT TGTTTTCCTT TTTAGGAACA ACGCGCTCTT TACGCTCCCT
  184741  TTTAGGTTTG CTAGGAGCAG GAGTTGTTGT TTCTTTGGCT GTTTTAGTTG GAGCTTCTGG
  184801  TTTGCTCTCA TTAACTTTGG TTTCAGTAGG TTCCTCCTTT AGAACAGAAG CTACTTTGGC
  184861  TACTTTAGTT GGGTCATCAG CTTGATGATC CAAAATTTGA TATACTAAAT CCAGTTTTTT
  184921  TAAAGTACGA AATTTAGGAA CTTTTAATGC CTTAGCCATT TCCTGTAGCT CAGGTAACTT
  184981  TTTTGATTTT AAATCAGAAA TTTCTAACAT GTAATTTGTT AATTATCTTT TTATTTATAG
  185041  AGAATAAATA CTAGAAAGTA TGTATTGAGT CTGAAGATTG TTAAATAGTT TTGAAACTAT
  185101  TCGTTATTGC AAGTATACAA CAATATTTTT ATTAGAAAAA CTCTTTATCA AATTACTTGT
  185161  TAGTTAATTG CTTAAGTTTT TTTAGTTAAA TTGAGATTGA CAAGAATAGA GATTGTTAGG
  185221  TGACTCATAT TTCTTTTTTT GAGTTTATTT GTTGATTTTT AAAAAGAAAC AGCTATTTTT
  185281  GTAATACAGA AGAAAAAAAG TATGATTCAA CGTATTCAAA GCGTTTATTT ATTATTAGCA
  185341  GCATTAGTAT CCGGAGTTTT GTCTTATTTT TTTCCAACTG GTTTTGATAA AGTAGGGGAA
  185401  ATAAGTGCTC CATTTTATTA TGAAATGTTG TTGATTTCAG CTTTATTATC GTTCATTATT
  185461  ATTTTTGTTT TTAAAAATAG AAAGCTTCAA TTTGTTTTGG GGCGATTAAA TATACTATTA
  185521  AATGTTATTT TACTAGGCGT TTTCGTGTAT TTGACACTAA CTGTATCTGG AGAGGTTTTT
  185581  GCTTCTGAGA AGGGTATTGG GCGGTTCATA CCTGTGCTAT CTATCGTTTT AATTGTGTTA
  185641  GCCAACAAGG CTATTAAAAA GGATGAGCAG CTCGTAAAAT CTGTGGACAG ATTACGATAA
  185701  ACACTTAACT AGTATTTTGT GCGAAAAAAA GCCAGCGTCT GCCAACGCTG GCTTTTTTAT
  185761  TTTCAAAATT ATTTCACATC AAAATTGATT ATTTTCTGTG AGATCCATCA CAATAGGGTG
  185821  GATTGTTGGT GAGTTTACAT GTGCATAATG AAGCTTCTTT TGCTTCAGTT ACTTCGAATG
  185881  CTAAAGAGGG TGTAGCATTG TGTTTTCTGT GAGATCCATC GCAAAAAGGT TGATTTTCAC
  185941  TATGGCTACA TGTGCACCAT GCATATTTTT TACCAGGTTC TAGGCTTACT TTAATGGGTG
  186001  TTTTTTTATC AGACATAGTA TATTTTTTTA ATTCTAAATT ACAATATACT TCTACTTGAG
  186061  TTAAGATTGA TTTTAAATAA TAGCGCATTT TAAGTGTGTT TTTAGAAGAC TTTGCTTTGT
  186121  TAACTATGTA TGGGGTGTTA TTTGTTAATA AATTGTAAAT AATTAGCTGA ATTTTGACTG
  186181  TAATACTTGG TTTAATTCAC TATTTTGCTT GTTAGAATTG AAATAAAAAA AATTAAATTT
  186241  TTATATATAT GGCTGACGGA GAAAAGCTGA TTCCTATTAA TATTGAAGAG GAAATGAAAT
  186301  CGGCATACAT CGATTATTCG ATGTCTGTAA TTGTTTCTAG GGCGTTACCC GATGTACGTG
  186361  ATGGACTAAA GCCAGTACAC CGTAGGGTGT TATTTGGAAT GCATGAGCTG GGTGTTAGGG
  186421  CTTCAAGTGC TCATAAAAAA TCTGCAAGAA TTGTTGGAGA GGTACTAGGT AAGTATCACC
  186481  CACATGGTGA TACATCTGTA TATGATGCAA TGGTACGTAT GGCTCAGGAA TGGAGTATGC
  186541  GTTATATGCT AGTTGATGGA CAAGGAAATT TTGGATCTGT TGATGGAGAT AGTCCTGCAG
  186601  CAATGCGATA TACCGAAGCA AGAATGCGAA AGATATCGGA AGATATGCTT GCTGATATTG
  186661  ATAAAGAAAC TGTTGATCAT ACATTAAATT TTGATGATAC GTTAAAAGAA CCTACAGTGC
  186721  TTCCAACACG AGTGCCCGGT TTGTTAATTA ACGGAGCATC TGGAATTGCG GTGGGTATGG
  186781  CGACTAATAT GCCTCCACAT AATTTAGGAG AAGTTATTGA TGGTACCGTG GCGTACATTG
  186841  ATAATAATGA TATTGAAGTT GAAGGTTTAA TGGAGTATAT AAAAGCTCCA GATTTCCCTA
  186901  CCGGAGGAAT AATATATGGC TATGATGGAG TGCGTGAAGC ATTTAAAACT GGTCGAGGTC
  186961  GTATTGTGAT GCGAGCTAAA GCTACTATTG AAGAGGTTAG AGGTAAAGAA TGTATTATTG
  187021  TTAGTGAGAT TCCTTATCAG GTAAATAAAG CCGAAATGAT TAAAAAAACG GCTGAGCTCA
  187081  TTAATGATAA AAAAATAGAT GGAATTTCTT CGATTCGTGA TGAATCCGAT AGAAAAGGAA
  187141  TGCGTATTGT TTATGTGTTA AAGCGTGACG CTATTCCAAA TATTGTATTA AATATGCTTT
  187201  ACAAGCATAC GCAATTGCAA ACTTCATTTA GTGTAAATAA TATAGCATTA GTAAATGGAC
  187261  GACCTCAGTT ACTTAATGTG AAAGATATGA TTCACTATTT TGTGGAACAT CGACATGAAG
  187321  TTGTGGTAAG AAGAACTACT TATGAATTAA GAAAGGCAGA GGAAAGAGCT CATATTTTAG
  187381  AAGGTTTAAT CATTGCTTCG GATAATATTG ATGAGGTTAT AGCATTAATT AGAGCATCAA
  187441  ATAATGCGGA TGAGGCTCGT GCAAAATTGA TTGAACGTTT TAAGTTAACT GAGATACAAG
  187501  CTAAAGCAAT AGTTGAAATG CGTTTGCGTC AGTTGACTGG ACTGGAACAA GATAAATTAC
  187561  GTGCTGAGTA TGATGAGTTA ATGAAGACAA TTGAAGATCT GAAAGATATT TTAGATAAGA
  187621  AAGAGCGTCG ANNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN
  187681  NTGGACGTCG TTCTCAAATT GAATATGCGG GAGGAGATTT TAGTATTGAG GATATGATAC
  187741  CTAATGAAAA GGTGGTAATT ACCATTTCTC ATGCCGGTTA TATAAAACGA ACTTCGCTTA
  187801  CTGAATACAA AACACAAAAT AGAGGTGGAG TAGGTCAAAA AGGAAGTACA ACACGTAATG
  187861  AGGACTTTTT AGAGCATCTA TTTGTTGGGA CAAACCACCA ATACATGTTG TTTTTTACTC
  187921  AAAAAGGAAA ATGTTTTTGG ATGCGTGTGT TTGAAATTCC AGAAGGAGCT AAGGCAACAA
  187981  AAGGAAGAGC TATTCAGAAT TTGATTAATA TTGAGCAAGA TGATAAAGTG AAAGCTTTTA
  188041  TTTGTACTCA AGATTTAAAG GATGAAGAGT ATATTAATAA TCATTACGTG ATTATGGCAA
  188101  CAAAAAAGGG TCAAGTTAAA AAGACCTCTT TAGAGCAGTA TTCTCGTCCA AGAGTTAATG
  188161  GAATTAATGC CATAACTATT AAAGAAGAAG ATGAGCTTTT AGAAGCTAAA TTGACAAATG
  188221  GTGAAAGTCA AATTATGCTA GCTTTAAAAT CGGGTAAATC AATTCGATTT GAAGAGGCCA
  188281  AAACGCGTCC AATGGGTCGA GGAGCTTCTG GAGTTAGAGG AATTAGATTG GCGCATGAAA
  188341  AAGATGAAGT GATAGGGATG GTTGCGGTGA ATGACCCGGA AAGTAATATC CTAGTTGTTT
  188401  CTGAAAATGG ATATGGAAAA CGTTCAAGCC TAGAAGACTA TCGTATAACC AACCGAGGAG
  188461  GTAAGGGAGT TAAAACTATT TCGGTTACTG AGAAAACTGG AGAGTTAGTG GCAATTAAAA
  188521  ATGTTACTGA TGCCGATGAT TTAATGATTA TTAATAAATC GGGTATTGCA ATTCGACTTT
  188581  CGGTTGAAGA ATTAAGAGTT ATGGGGCGTG CTACTCAAGG GGTGCGTTTA ATTAACTTAA
  188641  AAGGAAAAGA TTCGATTGCA GCGGTAGCTA AGGTAATGAA TGATGATGAG GATATAGATG
  188701  ATGCGGAATT AGTAGCGGGT GCTAATGCGG ACGTAATTGA AAGTAATGAT GTAGTTGCTG
  188761  ACGCTGATCA GGAAGCTGAT AATGATAATG CTTCTCAATC TGAGGAGTAA TATTAAAAAT
  188821  AAGCTTAGGA TTAAAAATAG GTTAAGTATT TATTTACTTG ACCTATTTTT TTTGCTTTAA
  188881  CTCTTTGGGA TAGGAGTGTT TAGGTATACT AGATATTAGT ATTCTCTTGA TCTTTATAGT
  188941  ATTTGTTGTG TTTGAATTAA ATAATGTAAT TTATAATATG ATCATTAAAA AAATTAAATA
  189001  GGCTGTGTGC TTTGTATAAT GAAGGAAGGG GTGTTGAGAT AAGGTTAAAA TTTATCTGCG
  189061  TTGCCTTGCG AAATTTGAGT TTGAATATAA GTTAACGGTG GTTTTTTTTG ATGTTTTAAC
  189121  TTTAGCTAAG CTTTGGGTGT AAAAAAAAAA GACTGCCTTT TCAAGCAGTC TTTTTTATTT
  189181  TTATTGATGT GTAAGCTTAT TTCAATTTGA AAGTTACTTT TCTTCTTAAT TGTAAAGATT
  189241  CTTTTGATGT TCCAGATGCC GTTTCACCAT TTCCTGTGTG TGATAATCTT TCAGCAGCAA
  189301  TTCCAGATTC AATTAATATG TCATAGACTT TCTTTGCTCT TCTCGCTGAT AGGCTTGAAT
  189361  TAAAAGAATC ACTACCTCTT TGGTCAGCAA AACCAATTAA CTCGGCTTTT GCCTCTGGGT
  189421  GTTCTTTCAT GTATTCAATT AAGTAATTGA TTGCGTCAAG AGAGTAAATA CTAGGTGTAG
  189481  CACTCGCAGT ATTAAAGTAA ACATTAACAT AGCCTTCACC TAATAGTTTT TTAATAGCTT
  189541  CGTCATAAGA AACTTCAGGA GCGGTAGTTG CAGTAGGAGT GTCATTTGCG TATTTTCGGT
  189601  CCAAAGCAGT TTCAAATTCG TCAGGAATAC CGTTTCTGTT GTTGTCAATA GTAACACCCT
  189661  TAGTGTTTAC TGTTACACCA GAAGTAGTGT TAGGTTCTCT GTCTAAATAA TCAGCTACAC
  189721  CATCTTGATC AGTATCAATC ATGTCGGCTT CAATGTTAGC TATTTTTGTA CTAAGCTCTT
  189781  CAAGTTGTTT AGAACTAGCT CCATCTTCAA TAGTCCAATC TGCGTGATTT TCATTTTTAC
  189841  CTAAATTAAT AGCAAAACCA GCTGTAGCAG TAAGCATTGA TCCAAAACCA GAAACGTTTT
  189901  GGGCTCCATC CCAATTGAAA TTTTGTCCTA AATGCCTTAA GTAGCTTAAA TCAACTTGAA
  189961  AAGATACTCT TTTTGATAGT TTTAATTGAG GGGTCAATCC TAAAATAAAA TTAACAGCAA
  190021  GCTCGTCACC AGTATTACCC AAAGTATTAT AATCAAATGA GGATAAACCT CCACCTCCAT
  190081  GGAATAATAA TCCAATATTT TTAAATGCAG TGGTTCTAAA TCCCATGATA TTGCCAAGGT
  190141  TTATTACTCC TTGTATTGAT CCTCGGTAGT ATTTAGTTTC AAATTCAATA GAATTATCGT
  190201  CATTGTTAAT ATCTTGATAA CCAAAATCTG CTTTAATTCC AAATTTAGTA TTAAGGCTGT
  190261  AGCGTACTCC AAAATTACCT GCTACAAATT CGGGTACTGG GGAAAAGTGC CCTGGAGAAG
  190321  CTAAATTAAA TGTTTTAAGT GCCCCGGCAT CAAGTTCAAT AGACCATTTG TTGTAAGTGT
  190381  TTTCTTGCGA ATGTAAAGCA CCTATAGTTA AAGTTGTTAT GATTATAAGT AGTGTTTTTT
  190441  TCATGGTTAA GCAGTAGTAA ATTAGTATAT ATTTACAACC AAAAGTATGA AAAAGTACAT
  190501  TAAAAATAAT GTTTTTTGTT AAATGTAGGT GTTTTTATTT GTTAATTTAT TAATTTATAA
  190561  GGTTTTGACA TTTTTTTTGT AGGAAGATTT TTAGCATTTA AAATGTTAAA ATTCTATATT
  190621  TTTGTTTAGT TTTTTATTAA CTACACTTTT AGCTAAGGTG TATTCTGTTT AATATATCAA
  190681  ATTAACATGG TATTTTGCTT AGATGAAAAA AAGAACTTTA ATTAAAAAAA TAGTTTATTA
  190741  GTTGTATAAT TATAAAAAAT GCGTATTTTT GCCATCCGAA AACGAAAAGA TTTTTAGCAA
  190801  TGAAACAAGG TATTCACCCA GAGAATTATA GATTAGTAGC TTTTAAGGAC ATGTCTAATG
  190861  ATGATGTTTT TATTACTAAA TCAGCAGCAA ATACAAAAGA AACTATTGAA ATCGATGGAG
  190921  TTGAGTATCC AGTAATAAAA TTGGAGATTT CAAGGACATC TCATCCGTTC TATACAGGTA
  190981  AGTCTAAACT TATCGATACA GCAGGACGTA TTGATAAATT TAAAAACAAA TACGCAAAAT
  191041  TTAAAAAATA ATTTTGTAGT TTTCTTATAG CAAAAGCCTT CTTTTAGAAG GCTTTTTTTG
  191101  TTTGTCCTAA TTAAAATAAT AAATGTTCAG GTATTTAGTT GTTTCAGCAT ATTTACATTA
  191161  GTATTTTCGT AAGTATAAAT ACTAGCAAAA TGAACTATAT TTTATTTGAT GGACCGCAAA
  191221  GGCAAGCTTT ATTACCTTTT ACCTATACAA GACCTGTTGC CGATATCCGT ATTGGAATAT
  191281  TAACCATACG AGAAAAATGG GAACGCTATT TAGGAAGCAC TACTTCAACA GTTACCGAAG
  191341  ATTATTTAGC TGAAAAATGG CCAATGGTTG AGCTGGAATC AAATACATTT ATTTGTGGAG
  191401  GCATTCTACC TACCAAAAAA TTGGTAAAAG CAATAAAAGC TTTACAATTG AAAGAGGTTT
  191461  TGTATTCAGA AAATGAAGAA TTGATTGCTT TTTGTGTGCC CGAAGGGGAG GATCCTGATT
  191521  TGGATTCTTA TAAAGCAATT CAATTTAATG ATGCTTTTGC TGAAGTAAAA AATACATGGG
  191581  ATATTTTTAG TTTAAATGAA CAAGCAATTG AAGCAGATTT TGAGTTATTA ACTGTTGACG
  191641  AAACAAGCCA AAAATTATCT GAAACGAATA AAGTAATAGG TGATGGTAGG GTTTTTATAG
  191701  AAGAAGGGGC TTCGGTCGAA TGTGCTATTT TTAATACTAC AAAAGGATCC ATTTATATAG
  191761  GTAAAGAAGC TACGGTTATG GAAGGGGCAA TAATAAGAGG ACCTTTCGCA TTATGTGAGT
  191821  ATGCAACAAT AAAAATGGGA GCTAAAATTT ATGAAGGAAC CACAGTTGGA CCTCACAGTA
  191881  AAGTAGGAGG GGAAGTAGGT AACTCTGTGA TTTTTGGGTA TTCAAACAAA GGGCACGATG
  191941  GATATTTAGG GAATTCTGTT CTAGGTGAAT GGTGTAATTT AGGTGCAGAT ACAAATACTT
  192001  CAAATTTAAA AAATAATTAC GCGGAGGTGC GTTTATGGAG TTATGAAACG AGCGGCTTTG
  192061  CTAAAACAGG TTTGCAATTT TGTGGATTAA TGATGGGGGA CCATTCAAAA AGTGGTATTA
  192121  ATACCATGTT TAATACAGGT ACAGTTATAG GAGTTAGTGC TAATATTTTT GGAGGAGGGT
  192181  TTCCTCGTAA TTTTATTCCG AGTTTTAGCT GGGGCGGAAG CGCCGGTTTT GTAACTTATA
  192241  AAACAAATAA AGCTTTTGAA GTGGCCGAAA AAGTAATGCA GCGTAGAAAA ATTGATTTTA
  192301  CAGCGCAAGA GCAAGCTGTT TTGGAACATG TTTTTGAAGA AACTGTTCGT TGGCGAAAAG
  192361  AGTAATAGTT GCTGGAATTA ATATTGATCA ACAAATAAAA AAGAGCTTTT TTCATTAAGA
  192421  TAAAAGCTCT TTTTTTATTT TTTTTAAATT ATGAGACAAC CATTGTTGAA AAAAAAGCGT
  192481  CTTTATAAAT AGAAGACTAA ATGAAATCAC TTTTGAAAGT AATAGCACTC TATAAAAATG
  192541  AAGAAGCACT GCTAAAAGGG CTGTTAAAAA ACAACCGAAG TGCGCAGCGT AAGCTTTACG
  192601  AATTGCATGC ACCAAAAATG TTAAGTGTTT GTCGGTATTA TATAAAAGAT TTGCATCATG
  192661  CAGAAGAAGT GATGTTAAAT GGTTTTTTTA AAGTATTTCA AAATGTGAAC AAATTTAAGA
  192721  ATGAAGGTAG TTTTGAAGGT TGGATTCGAA AAATTATGGT AAGAGAGGCT ATTTCTTATT
  192781  TAAGAAGTCA AAAGAAAATT GAATTCATAA CAGAAACTAT AGTATTAGAG AGTGAATATG
  192841  AAAATAATAT TCATTCAACT ATTGAGGTAG ATCAAATACA ACATTGTATT GATTTGCTTC
  192901  CCGAAGGGTA TAAAATAGTA TTTGTGATGT ATGCTATTGA AGGTTATAAA CATAGTGAAA
  192961  TTTCAAAAAT GCTAAAAATC ACAGAAGGGA CATCGAAATC GCAATTATTT AAAGCGAGAA
  193021  AGTTATTGCA AAAAAAGGTT AATGAATTAA ATAGGACTGG CTATGCTACA AAATGAGTTT
  193081  GAAAAAGTGA ATAAAGAAAT GTTAGAAGCT AGGTCAATAC AACCTTCAGT AGATGCTTGG
  193141  GATAGATTAT CAAAACGTTT AGATGATGAT CAACAAAATA AACACAAGCA GTATAAACGT
  193201  AAGTATTGGT GGTTGGGTAT TGCAGCCAGT TTGATAGGGG CGTTATTTAT TACACAACAA
  193261  TTTTTGTATA GTGATTTTAT AACTAGATCA ACAGATGTTG ATATTGTGGT TACTGAAAAT
  193321  AAAGACATAG ATCATTTAAA TAGAAAGAAA ATACTTAAAA CAACAACCTT AGTCACGGAA
  193381  AAACAAGAAT TCAATATTGA TTCAAATAAA AGTGTTAAGC ATAAGACTGC GTTGGTAAAT
  193441  AGAGAGGAAA AGAGTTCAAA AAAGGAGGCT AAAAAGCTTG TGGTGCTAAA TGTTGTACCA
  193501  AAAGAAAAAG TGATGATGCC TTCTCAAGTA GCACACTTGG AAAAAAAAGA TACGGTGTTA
  193561  AAGGGAGTAA CATTTCAAGA TCAAAAAATA AAAGAGCTAT TAGTAGAGGT TGATGCTTTA
  193621  GAGGAAACAG AGGTAGTATT GTCTAATGAA ATTATAGAAG ATTTGTTGTT AAAAGCACAA
  193681  ATAGAAATTG ATATAGAAAA TTCGCAGATA GAAAATAAAG AAACAGTCAA CGCTAGTTCA
  193741  TTACTAAAAA GTGTTGAGAA TGATTTAGAT ATGTCTTTTA GAAATAAAGT GCTAAAAGCA
  193801  TTAAAAGAAA ATTATTCCAA AGTTAAAACG GGTATAGTGC AACGTAGAGA TGATTAGCTA
  193861  GATCAGATAG CGTTACGCGA AAGGATGTTT TTTATTCCAG TTAAATTTTT AAATAATTAC
  193921  TAATAGTTGA CTCAGTATAA TTACTTGAGG GTGATAACTA TTGTCTTTAA GCAAACAGAA
  193981  AAAATAATAA TTAATTCAAA AAAAAAGAAT CATGAATGTA ATTACAAAAT ATATGGTATT
  194041  GGTATTGGGG TTTGTTATGA ATATCCAAGT AGCCAATGCT CAGGATACTA TTCAAAAGGA
  194101  TGTAAATCAA TTTAAAATCA AAAAGTTAGA AACTTTAAAA GCTGATATTA AAAAACAAGA
  194161  GCGCGAATTT TTAAAGCAAG AGGTGGCGGC TATTGATGAA TTGTATAGCA AAAAGGAAAT
  194221  AACTAAAGAA CAAGCAGCGT CACAAAAAAT GGAAGCAGCA AAAAAGCGAG CGTTAAATAT
  194281  TGATAATCGA ATAGCTATTA TTAATAATAA AATTTTGATT TTAAACCGGA ATCAAAAGGA
  194341  TGCTAATTAC AAAGGAGTGA TAATAGGTGA TTCTTTAAAA GAAGTATTTA ATAGCATCGA
  194401  TTGTGAATCT GATGTTCCGG ATGAAAAGGA ATATGATAAG CGTATTAAAA GTGGTTTGGT
  194461  CTTGGCCTTT GGTTTTAATA ATGCACTTTT TGATGGAATG GATTTGGAGG ACTCTCCATA
  194521  TAAATTTGCA GGATCACGTT TTTTTGAAAT TGGATGGGCA TGGAATGCCA GAGTTTTTGA
  194581  ACATACTAAT TTTATGAGGC TTCGTTATGG GTTATCAATG CAAATAAATA GATTAAAGCC
  194641  AGATGATAAT AAGTTTTTTG TACAGGAAGG GAATAAAACA ATGTTGGCAA ATTTCCCAAG
  194701  TAATCTTAAA AAGTCTAAGT TAACCATGAC AAATTTGGTA TTGCCTTTGC ATTTTGAATT
  194761  TGGACCTTCG AAAAAAGAAG AAAAAGAGAC TTATACAAAG TATTCAACAA AGCATAAGTT
  194821  TAAAATTGGT GTTGGAGGTT ATGGAGGACT AAATATAGGA ACTAAGCAAA AGCTAAAATT
  194881  TAAAGAAGAT GGCGAACGTG TAAAAGAAAA GCAAAAAAGA GATTTTAATA GAACTAAATT
  194941  GATTTATGGC GTGAGTAGTT ATATTGGTTT TGGGGCAAGT ACACTGTATG TAAAATATGA
  195001  CTTATCTCCA ATTTTTAAAA ATCAAGATGT TGATCAAAAT AATATATCAA TAGGTATTCG
  195061  TTTTGATGTA GATTAAAAAG GTACAGATAA AATATTATAC GAAATTCTTA TCAGTAAATC
  195121  GTATTAGTAG AAAGCTATCA TTTATACATG ATATTAATTA TATAAAAAAT AAAGAGCTAT
  195181  CTTAAAAAAA GAAGCTCTTT ATTTTTTATA TATCCCACCT AAATTTAGAT TAATTTAAGG
  195241  TAGGAGTTGT GTTGAAATTT AGCGAGAAAT TTCAATTAAA TGTTCCTCAC TTGTACCATT
  195301  GTTAAAGTTA ATTTTTAATA GATATATTCC TTGAGGGTAG CTAATTGTAC TAAATTGTAG
  195361  CCCATTAGGA GTCTCTAGTT GATTGGTAGT AAAACTAGCG ATTAATATGG CAGAATTACT
  195421  ATCAAAAAAA TCAATGCTCT GAATACTATT GATATCTTGT GTTTGAATAT TTATTAAGTC
  195481  ACTAGTCGGA TTAGGGAATA TTATAATATC ACTATTTGTG GTGGTAGCAT TCGTTGTAAC
  195541  TATAGGTTGA GTAGGAGGAT TAGTATCAAT TATTGCTAAA GTAAATTCGG TACTGGCTGT
  195601  TAATCCATTA AAGTCTATTG CTTCAATAGC AATGCTTAGT ATGGAGCCTT GTGAATTTAC
  195661  TGGAGGAATT CCAGATACTG TTCCTGTAGC TTCATTAAAT GTTAACCAAT TTGGTAGTGC
  195721  TGTTCCGTTG CTTAAATTTA CAATATAAGT TAGTTTATTT CCGGGGTATC CCTTATCAAA
  195781  AGAATCAGTA ACATTTAATT CAAAATTTTG AGCAATAGTT GCCGTTTGAT TAGTTATCGC
  195841  GGTTGCAGTA GGCACGGCTT GTGGTCTTAT ATTTTTAAAG TAAAAAATAT TATCATTCCA
  195901  ATCACAATTA GCAGAACCTG CGCCACATCC ATTTTGTACA AAATCTTGCA GTACAATATA
  195961  TTCATTAGGA ATAAGCTCAC CTTTATTATT TATCACACGA TAAACACGTG CGCCAAGTAG
  196021  GTCAGGTCTT CTGCCATCAA TATTATTTCC ACCTGTAGTT AGGTAATTGG AAATTGCAAT
  196081  TCTAAAAGGT TCACTAATAG TAGTCGCGGT ATCAAAACTG ATATTGTCAC CTCTATTATT
  196141  TCGGGGTAAT AAAGTTTGGA ACCATGTGCG CGAATGAAAA AAGTTAATAT CACCAACCGT
  196201  ATCGGTATTG TCGAGTGCAA CAAATCGAGC ACCATTTCCA CCTGGACCAT GCATTGCCGA
  196261  AATTTGAAAT CCAATCACAG GTTGAGTAGG ATCGGCCTGA ACAAAAGCTT CAGAAAAAAT
  196321  CATATCACCT TCATAGCCCA TGTCAATATT TGTGGCAATA GGAAAATTTG AAGAAGGTCT
  196381  AAAAGATCTA AAATTTGGAG GTGTAATGGT ACCATTGTCA TTTACGATAC TTAACATGGA
  196441  TGTTTGTAAG CCAAAAGCAT CAAATACCTG CTGTGCATTA ATTTCTCGAC CACCTTCTTG
  196501  ACCCTGTTGG TGTGATCCAT TAAGTGTGGC TTTAACTTCT GGTGTGGTAA TAGCATCAGA
  196561  TGTTACGGTC ATTTCATTTA TAAAAAAGCT TTTACCATCA CTGCCATCTC CATCAAAAAT
  196621  AATAGGTAAA TCAGCAAAAC TACCTGCTTC AATACTAAAA GGTAGACTAA TAGGATTCCC
  196681  TGTAGTATCT AAAATAGAAA AGCTAAAAAC TGATGGACCG GAAATTTTAA TGTCCGAAAC
  196741  AACTAAAGCT TCAGTACCTA CATTGTTTAA TCGTAGGGTG TTTGAATCTT GAACGTCGGT
  196801  ATTTGGTCTA ATGTCTCTTA TTTTATGAAA TGTAAGGTAG TCCTCAGCAG GGAATCCGAT
  196861  ATTGGTTGTT GGGATTTTAG TTAAATTTTC TAAACTAAGT ATTCCATTTG AAGTAGGAAG
  196921  TATGGTTGCA GGAGTAGCAT TATCCAGAAT AAAAACATAG TCTTGATAAT CGCCATTGTT
  196981  CAAATCTTCA AAAGCAATTA AAAAACTGTT TTCAATAATA CTTCCATTTC TATCTTTATT
  197041  AGGATAAATA CGAGTTCGAT GTGCAACATC TATATTTAAA GGATCTTGCG TATAACTTAT
  197101  TCTATTAAAG AAAAGGGATT CGACAAATAT TCCAAAGACT TCATTTTGAG GGTCAAATTC
  197161  TTTAATTCCA GATTTAGAAG GAGGAAATAA TCTTTGCGCA TTTTGTAAAC CAGTTTCCAA
  197221  GGTGTCAATT ACATTAAATT GTTGTGTTGT TTGTTGGTTA GTGTACCATC CATAAGGTAA
  197281  TTCCTCGGCA GGGGAATACC TAGCTACAGG AGTCAAGGTT ACAGGAGCAT CTGAGGCTTT
  197341  TACCCATAAT TCTGTTTCAA CTTCGTCACC AATAGGATCA GGATTTACAC CATTAGCTAA
  197401  TGTTGTCCAT CCTACATCAA TACCAACACC AATGGTGTTA ACAACACTTT GTAGCGTAGG
  197461  TTCTTCTCCG CCTTCAAAGC CTCTCTTTTT AAGTGCGTAC AGGTTAATTC TGGTATTTGG
  197521  ATTGGCAGGA TTATTACTTT CAATAGTTAA AATAGCATCC TGAAAACCTA GATCTTGTTG
  197581  GTTTAAGTCA GGTGCGTAAA TAATATCCAA TTCATAAGTT TCGCCAGGAT TAATACTTAC
  197641  TGCAGTTGCT GTTGGGCTGA AGCTAAATTG ATTTGAAAAA TTTCCAGAAA GACTAATGGT
  197701  ATTAATTTCT AAAGTACTTT GTCCTGTGTT GCTAACACTA ATGGTATTGG TTTCGGTCAT
  197761  TGGACCATCG GTATTAACGG TAGTTTCAAA AAACAATTCA TCCGATGATA CGGCTATGTT
  197821  ATTTGGACCA GATAAAGCCC TTAATAAAGT CAATCGAGGT GTTCCTCCTC CAGCTCTGTC
  197881  ATATTCGGAA ACATATAAAT TTCCTGTAGT AACATCTTCA ACAACATCTA ATGGGTCATC
  197941  AAAACCTTGT AAACCGGGTA TGGCATTGTA AGCGTCAATA ACATCTCCAC TGGCGCTATT
  198001  GACATCTAAC CCAAGTAGGT CATCTTGACC GCTAAATCGA GATACAAACA AAAGACCTTG
  198061  CAGGCGACCT CCAAAAGCAT TGCTTTTATA TTCAATTACT CCGTTGGGTG ATTTGTTAAA
  198121  ACCAAAATCA TAAGCAGGTT CTTGATAATT AGGATCGGGA AGTACTGTAG AGGGATATTT
  198181  GGGTACATCT ATATATGGAT TATCTTCTTG TCCTGGTAAA TTACTATAAG CTAGTCCTCC
  198241  GTGGTTTAAT ACGAATTCAC CTCGGTAAGG GTTTGGATGA CCGTGATATG AACCTCCTTG
  198301  TGTTTTAAAT AACCAATCTT TTTGTGTGTT TCCTCCTTGA AGGGCTGGTA CATCTGGTAT
  198361  ACTTGTTAGT CCATCAATTC TTCTAGCTAA TGTATAATCC GCGGTGGAGG GAGCGTTAGG
  198421  GGAATTAGTA TTGTTTCCCG CTGTTCCATT TGTTGGGACG TATAACCAGC CATTAGAGTG
  198481  CCATATTAAG TCGTAAGCAT TTCGTACCCC ACTAGCAAAA ATGGTAACAG GAGAGTTTGT
  198541  GGCATATGGA TTATATGTAT TGTTACTCAT TAAAATGTTA TCACTTGGGG CATTATTAAT
  198601  AACCGAAATA TCATCGGTGG TGTATACACT TAAGGGTAAG TTTGTGGGTA ATTTATCTAG
  198661  TTCTACTTTA AGAATAGCTG CCGCTAAAAG TCTTTCGGGG CGAAATGCCC AAGCAGGGTC
  198721  AATTTCACCA CCTGCACTAT TACTCCCTTG GCTTATGTAT AAATCATTTG ATTCATCAAA
  198781  AGCCAGACTA TTGGTTAAAT GATCTTTTGC TGATCTGGGA AGGTGAATAA GGATATCTTC
  198841  AACAACTTCT AAGTTTGGAC CACTTAAACG GCTAAGTACT CCATCCCATT CTGGTGCATT
  198901  AGATAAAGCA GATTTACTAT GAGTAATATA AGCGATAGGG TTGGTTGGTG TTGAGGTCGG
  198961  ATCAAAAGTG AGTCCAATAA TTAGCCTAGT GTCATTATCA CGTATGCCAT CAATAGGGTG
  199021  AGGAGCACCG TTTAATTCAG GAGAAAGTAT TTCTAAATTA GAAAGTGATC CATCGGTTTC
  199081  AATGGTCCAA CGATGTATTT TTCCATCAGA AGCAAAATTT CCTATGGTAC TAGCATAAAG
  199141  TTTTCCATCT GGGCCAATGA TTAAGCTTGA AAAGCGTTCA TTTTCTGTAC CATCTCCTAG
  199201  ATCAGTTCCA AATACTTTTT GGAAAGCTAC ACCTGTTAAA TCACGAGAGT TGGAGCCTTG
  199261  AGTGCTTCGC ATGCCTGTAG TAAAGGTAGA TTCGAAAGGG AAAAATGATA AACGATCATT
  199321  TAAATTCCCA ATTAAATTAG CTTCAACATT TGATGTGATT CGGTATATAT ATGTAGTATT
  199381  TTCTTTAAGA GGAGTAAGTG GAGTAAGGTT AATAAAATCA CCTCCACCCG TATCGTTAGA
  199441  GTTTGATGGG ATTAAAACTT CTCCAGTAGG GGTAACTTCA AATAGATTTA CGTTTCCATC
  199501  AATGGTATTT TCATCCAGTT CATATCCGTT TGGAGTTATT AAACTTACTC CAATTTGGAA
  199561  ATTTTCTAGG GCTACATCAG TGGTGTTATT TGCAGGATTT ACATCAGTAA AAAATGGACG
  199621  TACACTATTT GCAATTTGTT CAATTTCAAT TGAATTTATT TTAGTGTTGA ACCCGCCACT
  199681  AGCATCAATA GTTAGTCTTC CATCGGTAAT ATTAGTTGTT AGGGTTGCTG TCGTAAAACG
  199741  ATTGCCAGTA GTGGCGTTTC CAGTAGGAGT GAAATCATTA ATGGTATTTA TGCCTTCTAT
  199801  ATTAATTGTG TGTAATGGTG TTGTGGCAGG ACTATCAACT AATGGATCAC CTACAGATAC
  199861  TATTATGTTG TAAAGTCCTT CGGGAAGTTC TAGTTCCCAT ATACCCTCAG TTGTATTACC
  199921  GTTGTTGCCC CCGGTGTCAC CATATTGCAT GTGTAGCAAT GTGTTTTGTA ATTCACTTAC
  199981  TCCATTTGTG TTTCTGTTGC GTGTATTTCT AGATAAATCT AAAGGCGAAG TACCATCTGT
  200041  AGTTAGCCAA CCGTAGCTAA AGTTGTTTCC TCTATCTTCA AAAGGAAGTC CTGTATCTTT
  200101  AAGATAATCA ATAATATCAG GGCTTCCGTT AGTGGTGAAG TTAATTTTTA AATTAATAAG
  200161  TTCTTCTTCT ATAGTAGGGA TAATTGAAAA GTCTTCAAAT GTATAAGTGA CTTCGGTGTT
  200221  CTCATTTTCA TTTCTTTTTG AAACATAAAT ACCGGCAAAG CTTAAGTTTT GGTAGTTGGT
  200281  GTTTCCGTCT CGAATTTCTT GAGGTAACTC AATAGTTCCT ATTGAAACTT CTGTAGTGTC
  200341  GTTTAATTTG TAAAAAGCGG TAATACTATT GGTGTTAACA TCAATATGTA ACCTTAGTTG
  200401  AACTTTACTT GTATTTAAAT TAGGGACATT TAGGTTTATT CTTTCAGCAT TTGGAGCCAA
  200461  AGCGTTAAGT TCGGTGAGTA CTTCAAGATT GTTGCCATTT CGGATTACAA ATTTGATAAA
  200521  GTTATCTTCA TTAAGACCTA ACCATATTCC TGCTTGTTCA AAATTGTTTG AAGTGTCTGA
  200581  ATAGGGTTGA TTAATAGTGG TAATAATATC AAAATTGGTT AGTTCGCTAA AATCGATACC
  200641  AGTTCCTAAG GCGTTTATTT GTGAGTTTGT GTTTCGGCTA GTAGTGTTGT CCTGATAGGC
  200701  TATTCCTTTT GTAGCTGTGA TAATTAATTG GTTGTTTTCT AAAAGTAATT TAGAAGGCTC
  200761  GTACCCTGGT ATTTCATTAG AAAAAATAGG TTGGTCGCTA GCAAGTCTAG CAGATGGAGC
  200821  GTCGACCATG GTAAATCCAG TATTTGAAAT ACCACCTTGG CTACCATCAA AAGTTAATTG
  200881  AAGTGGTAGT TTAGCTTTTA ATTGGTTGCA ATCTAAGGTG CTAATTGGGT TGCAAGGAAT
  200941  AATGCCTACA GTTAATGCTA GGTTTATTAT AGCAGGTTTG TAGCCTTTTG TTGTGGCTAT
  201001  TATTGTAGCT GTTTCTTGTG TGCCATCTGC TAAATTTGAA GTGTTAATTT CAAAAGTATA
  201061  GTTGCCTACT ATTCCTGTTT TTTGAATAGT AAGCCATCCA TTAGTTATTG AGGTGTCTGC
  201121  AGGAACTTCC AGCAGGTTTT CTATTGATAG CGTGAGTGTT GCAGGATCGG AAGAGGCTGT
  201181  TAATTCTTCA ATTAACGTAA CTGTTGTGTT TTCGGGAGTA ATGGTTGATA CATTAGTGTT
  201241  GGTGAAGTTT AAACTATTTA GATCAGCAGT GTTCGTTGAT GTATCAATGT TGATGTAGTT
  201301  GATTTTTGTA TTAAACCCGC CCAAAGCATT AACAGTTAAT AAGCCATCAG TAACTTCGAT
  201361  AGTTAATGTT TCTTCTCTAG TTTCTCTTGG AGTAGGTATA AAACCAGGTA CAATGCTAAT
  201421  ACCTTCAATG GTTAATGCAT GGCGACTATC TATGGAATTA CTTACATCTC CAACTCCAAT
  201481  AGTGATATCA TATATTCCGT TAGGAATTTC AATTTCCCAG TATATTTCAT TTCCTCGAGG
  201541  TTGTGATTCC CAAGTTGAAA TGTGATTTCC TTGCAAATGG ACGAGTGTAC CAGTTAATTT
  201601  TTCGATGTCT GTAGCGTTAT CGTAAGCTAT ACCAAGTCTG TTTCTTCCAA TTCCATTGTT
  201661  GTTTCCTGGA ACATCTGCCG AAGCATCAAA AGGGGTATCG TCACTTTTTA ATTTCCAACC
  201721  ATAATTATAG TTGCTGTTAT CAATGGTGAT CTGAGATGTT CCAAAAGCTT TACCGTGATC
  201781  AGCTATATAT CCAGTAGGTG GAGTGGTGAT GTTTGGGTTG TTTTGGAAGT TGATTCGTGC
  201841  CTCATAAGTT TGGGCGTAAC TACTCAGTGT CACTAAAAAT AGTAACACTA GATAAAGTGT
  201901  TTTTGTTTTC ATAAAGGTGG TTCTATTTAT TTGTTGTACA GTTTAATACA CTTATAAATA
  201961  TACTTTGAAT GAATTGTAAG TTTGATGTTG GGTTAGCTGA TTTTTTAACA ATTTTATTGG
  202021  CTGTGCTAAA CTGTTAATTT GGTTTTTAAG GCTTTTATCA GAATTAGTAT TGAGCTGATA
  202081  AATTTTAGTA AAAAATCTTT AAATGAATAT AAAAAAAGGA TGTATCAAGT ATTTTAAGAA
  202141  TTAAACTAAA TAACATGTAG TCAATTTCTT ATGATGTAAT GTTTAATAGA GAAGATGTGT
  202201  TTTGTCTTTT TGAAAACCTT ACAACTATTT TAATTTTTTT TTCAACATTT TTATAAAGCT
  202261  TAATGTTTGT TAAATTTGAG TTTTTGGGTG ATTTTTCTTC GCAAACAGGA GAGTTTGTGT
  202321  CGTTAATGAT TGTCTTTTTT TAGTTGAATG GGCTAGTTCA ATTTTTTGAG CTTGGTTTGT
  202381  TTTTTGTCTA AATTGTTAAA AATATAATAA TTAGATCTGA TAAAGAGGGG GTTACTTGAT
  202441  TGGTTTTTAA TAGGATTTTT AATTATAATA AGTAATTTGT TTTTTTCTTA CAATTTGAGT
  202501  TTTGTGTCAT TAAACAGCCT ATTTTTTGAG ATTGATATTT TTTGTATTAC TCAATTTCAT
  202561  TTAAAAAAGT AGCTATGCTA TTAATTGGAT GGAAAATTTT GCCTTTTACG GAGGCTAAAG
  202621  GGAGTTTAAG GGTGTCTGTT CTGTAACCTT TTTTTTCGAG TAATTTCCAA GTATATTTAT
  202681  AAAATCGTTC TCGTAAATCA ATATCAATTT CTCGATATTT AATGTGTTTG TTATTGAGTT
  202741  GCTTTTTTAA ATTGTCACAT TTGCTGCAGG AGCTATTTGT AAAAACAACA ATTTCTTGTT
  202801  TCATTAATTC GGCAACATCT GCTTCGCTTT CCTCTTTTCC TTTTAGTTGA ATGTTTTCAA
  202861  GTGTTTTGTT AGCTACAAAA GTATAGGTAT ATCTTGAAGG AACATCAACT AGTGGAATTA
  202921  ATGTAATTAA AAGTGTTTTG GAATTGGGAG GCAGTTGTTT AATAACGGGT CTATCTCCGC
  202981  TTCTGCGATA GCCATTAGCA TGTACTTTAA AAAACACACT TCTTGGTTTA TTGGTAGTGT
  203041  TCTTTGCAAA AATTAATGTG CGTTTTTTTC CGACTTCTTC AATAATATTA ACTCCATTTT
  203101  TTTGGCTGTA CGTGTTTAAA AAGAATAGGA TTGAAATGGT TAAAAATAGG TTTTTAATCA
  203161  TAGTTTATAT ATTTGATTAT CAATAAATTT ACTATTTTTA AAACTGTTAT TGAAATTGCT
  203221  TTTAATTATT TTTTTATCAT AGTTTCTTAG TAATGATCAC GATTAGGCTT TGATTAGGTT
  203281  TATTAGTAAC TTTACTTTTT AAATTTATTT ATGGAATTAA AGTTGAGTCG CCCCATTTGT
  203341  TTTTTTGATT TAGAAACTAC GGGTGTTAAT ATATCTAAAG ATAGAATTGT AGAAATATCA
  203401  ATTCTTAAAG TTTTCCCTAA CGGAAATAAA GAAAGTAAAA CCTGGTTAGT GAATCCAGAA
  203461  ATGCCAATAC CGACGGAAAC TACGGCTGTT CATGGTGTGA CTAATGAAAA AGTAGCAAAC
  203521  GAGCCTACTT TTAAGCAACT AGCAAAAGTA ATAAGTGATA TGATTAAGGG TTGTGATTTA
  203581  GGGGGGTATA ATTCAAATAA ATTTGATATT CCACTATTAG CAGAAGAAAT GCTTAGAGCT
  203641  GATATGGATT TTGATATGTC AAATAACGTG GCTGTTGATG TGCAAAATAT TTTTCATAAA
  203701  ATGGAACAGC GTACACTTGT TGCTGCGTAT AAATTTTATT GTGATAAGGA TTTAACAAAT
  203761  GCGCATAGCG CCGAAGCCGA TACTACGGCA ACCTATGAGG TACTTTGTTC TCAATTAGAT
  203821  AAATATCCAG ATTTGGAAAA TGATATGGAG TTTTTATCTG AATTTAGTAC ACGAAGAAAA
  203881  ACAGCAGATT TTGCTGGTTT TATAGCCTTT AATGAAAAAG AACAAGAGGT GTTTACCTTT
  203941  GGAAAGCATA AAGGGAAATT AGTTGAGGAA GTGTTGGATA AAGAGCCTGG TTATTTTGGA
  204001  TGGATCCAAA ATGCAGATTT TCCATTGTAT ACAAAAAAGA TTTTAACAGC CATTCGTTTA
  204061  CGTAAGTTTA ATGCTTAATT GTTTATGAAA ATAATTTGTA TAGGTCGTAA TTATGCGGCA
  204121  CATATTGAGG AGTTGAAAAA TGAAAAGCCA AGTGATCCTG TAGTTTTTTT AAAGCCAGAT
  204181  ACTTCGGTAT TGTTAAAAAA ACAACCATTT TTTATGCCCG ATTTTAGTAA TGATGTGCAT
  204241  CATGAAATCG AATTTATAAT TAAAATAAAT AGAATAGGAA AGCATATAAA TCCAAAGTTT
  204301  GCACATAAAT ATTATGATGA GGTTAGTGTT GGAATAGATT TTACGGCACG AGATGTTCAA
  204361  AATGAACTTA GAGCTAAAGG TTTACCATGG GAATGTTCCA AAGCTTTTGA TGGGGCTACA
  204421  GTGCTTGGTA AATGGGTTTC GAAATCAAAA TTCCCGGATA TATCGAATGT AAATTTTAAA
  204481  CTTTACAAAA ACGATGTAGT TGTTCAGGAT GGATTTACTA AATTAATGTT ATATTCGGTG
  204541  GATGAGTTGA TTGCCTATGT TTCAAAATAT TTTACATTAA AAATAGGAGA TATAATTTTC
  204601  ACAGGAACCC CAGCAGGGGT TAGTCCGGTG GCAGTAAATG ATCAATTAAA GGGTTATTTG
  204661  GAAGAAGAAG AAATGTTTCA CATAAAAGTT AAATAGATGA GTATATCGTA TGACCTGGAA
  204721  AAGGTTAAAG AATTGGCAGG TGGGGATGAA AGTTTTGTGG AAATTTTATT GCAAACTTTT
  204781  TTAGAGGAGA TACCAGAGGA TTTAAAAAAT ATGTCCGATG CTGTGGCTGT TAATGATGCT
  204841  AAAGTAGCTT ATCAATATGC GCATAAAATG AAACCTAATT TTCAATTGTT TGGCATTGAT
  204901  GTTATTGATC ATATAAAACG TATTGAATCT TGGGCTAATG AAGAAATAAC TTTTGATGAA
  204961  GCTAAGGTGG CATTACTTGT TGTGGAAGAA AAAGCCGAAA AAGCGATTGT TTCGCTTAGG
  205021  GAATTACTTA ATAAGTAACA TCAAATGCTA GCAGAAATTA TAACGATTGG TGATGAAATA
  205081  CTCATTGGTC AAATTGTGGA TACCAATTCC GTTTTTATTG CGACTGAACT CAATAAAATA
  205141  GGAGTAGATG TACATCAGAT TAGTTCCATA CGGGATGATC GTGAGCATAT TTTAAAAGCA
  205201  CTCGCCGAAG CACAATCACG AGTAGATTTA GTTTTGGTTA CCGGAGGATT AGGCCCAACT
  205261  AAGGATGATA TTACAAAACA TACTTTTTGT GAGTTTTTTA ATGATACTTT AATTGAAAAT
  205321  AAAGATGTTC TTGAGCATGT TAAAGGTTTA TTTGATAAGT ATATTAAATC TCCGATTTCG
  205381  GAAGTAAATA AAAAGCAAGC CTTGGTTCCA AGTAAAGCAG AAGTGCTTAC TAATGAATTT
  205441  GGAACAGCTC CTGGAATGTG GTTGGTTGAT AAAAATACTG TTTTTGTATC CATGCCGGGA
  205501  GTACCTTTTG AAATGAAGGC GATCGTAAAA GATCAATTGA TACCCCGTTT GCAAGAACGA
  205561  TTTAATCGTC CTTACATACT CCATAAAACA ATATTAACTT ATGGTATGGG GGAGAGTAGG
  205621  GTTGCGGAAC GGATAGAAGA TTTTGAAAAT AACCTACCTA CTTATATTAA ATTGGCTTAT
  205681  TTGCCAAGCT TAGGTCGTGT ACGATTACGT TTAAGTGCCC GTGGAGACAA TGAGAAACAA
  205741  TTGAAACTAG GAATAGCTAA AGCTGTTGAG CAATTAAAAG ATTTAATTGG AGATATTATC
  205801  GTTGGTTTTG ATGAGAATGA AAGTTTAGAA CATGTTATAG CTAATTTGCT TACTACTCAT
  205861  AATTTTACAT TAGCTTTGGC AGAAAGTTGT ACGGGAGGTA AGATCGCTAG AGGTTTTACT
  205921  AAAATAGGAG GAGCTTCAGC GTATTTTAAA GGAGGTTTAG TGCCTTATGA TACGGCTTTA
  205981  AAAACAACTA TTTTAGGTGT ACCCAAAGCT TTAATTGAAG CGCATTCGGT AGTGAGTACC
  206041  CAAGTGGCAG CATCAATGGC CGAGCAATCG TTAAAACTGT TTCAATCAGA TTTTGCGATA
  206101  GCTACCACAG GTAATGCTGG GCCAACCAAA GGAGATAGTG ATGCCGAAGT GGGGACAGTT
  206161  TGTATTGCAA TTGCCTCGCC GAAAGGCGTA GTTTCTGAAC AATTTGTGTT TAGTAACCAC
  206221  CGAGAGCGTA CCATAGGTAA GGCAGTTAAT AAGTCATTAG AGTTACTTCA GGAGCAAATT
  206281  TTAGCAGTTT TAGGTACTGC AGAATAGTGC TGTTTTTTAA GTAATGTTAT CTAAAAAGTA
  206341  ATTAAATAAA AAAAAACTAA TTTATTTTAA AAAACAGTTT GTTTGAAAGG TAAAAAATTC
  206401  GTTAATTTGC ACCCTGTTTT GAAATAATAC AAAAGATACA ACCATGTCAA GAGTTTGTGA
  206461  GCTTACCGGA AAGAAAGCAA TGGTGGGAAA CAATGTTTCT CACGCAATGA ATAAAACTAA
  206521  ACGTAGATTT AATGCAAATT TAATCAAAAA GCGTTTCTTT ATTCCTGAAG AGAATAGTTG
  206581  GGTAACACTT AAGGTGTCAA CTGCAGCGTT AAAAACAATT AACAAGATCG GAATCTCGGC
  206641  TGCTATTAAG GAGTCTGTAG AGAAAGGTAT TTATAAAAAA TAATTCCTTA ATAGGGTTAA
  206701  ATAAAGCACC ATGGCAAAAA AAGGAAACAG AATTCAAGTA ATTTTGGAAT GTACGGAGCA
  206761  TAAAGCAACC GGGCAACCAG GAACGTCAAG ATATATAACA ACAAAGAACA AAAAAAATAC
  206821  GCCAGATAGA ATTGAAATCA AAAAATTCAA TCCTATTTTA AAGCGCATGA CTGTTCATAA
  206881  AGAGATTAAA TAATTAAGTT ATGGCAAAGA AATCAGTAGC AACATTACAG ACAGGTTCAA
  206941  AGAGATTAAC TAAAGCCATC AAAATGGTGA AATCTCCTAA GTCAGGATCA TATACTTTTG
  207001  TAGAATCTAT CATGGCGCCA GACGCAACGA AAGATTTTTT CAACAAGAAA TAGTATTTTC
  207061  AAAATAGATA AAAAGCCATT CTTCATTTGC AGAATGGCTT TTTTTGGTTA TGGCTAAGTT
  207121  GTTATCTTTG TTATATAACC ACTCAAACTA TACAGCATAT AAATTATGGG GTTTTTTAAG
  207181  AAAATTTTTT CAAAAGATAA AAAAGAGAGT CTTGATAAAG GACTGGAAAA ATCTAAAACT
  207241  AGCTTTTTTT CTAAACTAGG TAAAGCAGTA GCCGGAAAAT CAAAAGTAGA TGATGAGGTT
  207301  TTAGATAATT TAGAAGAAGT TTTGGTGAGT AGTGATGTAG GGATTAAAAC TACAGTGAAA
  207361  ATAATTGATC GCATTGAAGC GCGTGTAGCT AAGGATAAAT ATTTAGGAAC TGCAGAATTG
  207421  GATCAAATTC TTAGAGAAGA AATTGCAGGA CTTTTATCTG AAACTAATTT AGGCGAAGCG
  207481  GAAGAATTTG TTATTCCTAA GGATAAAAAA CCTTATGTGT TAATGGTGGT TGGTGTAAAC
  207541  GGAGCAGGTA AAACAACTAC TATAGGAAAG TTGGCGAACC AATTTAAAAA ACAAGGTTTG
  207601  AGCGTTGTTT TAGGTGCAGC AGATACGTTT AGAGCAGCTG CTATTGATCA GCTACAAGTA
  207661  TGGGCAGATA GAGTGGATGT GCCTATTGTA AAGCAGAGTA TGGGGAGTGA TCCCGCATCG
  207721  GTAGCTTTTG ATTCGTTAAA ATCGGGTGTA GCACAAAATG CTGATGTAAT TATTATTGAT
  207781  ACAGCAGGAC GTCTGCATAA CAAGATTAAT TTGATGAATG AGCTTACGAA AGTAAAAAAT
  207841  GTAATGAAAA AAGTAATTCC CGATGCTCCA CATGATGTTT TGTTAGTTTT AGATGGTTCC
  207901  ACAGGGCAGA ATGCTTTTGA ACAAGCGAAG CAGTTTACAG CAGCTACCGA GGTGAGTAGT
  207961  CTGGCAATTA CAAAACTGGA TGGTACCGCT AAAGGTGGTG TGGTGATCGG AATTAGTGAT
  208021  CAATTCCAAA TTCCCGTAAA ATATATTGGA GTAGGTGAAG GGATTGATGA TCTACAGGTA
  208081  TTTAATAAAT TTGAATTCGT AGATTCATTT TTTAAATAGG AGAAGAAATA TTGATAAGAG
  208141  TTCCGCTTGG ATCTTTTATG AAGCATATAG AAAGAATGGA TCATAAAAAA AAAGACCATA
  208201  ACTTTTATAA GTTTGGTCTT TTTTTTTCTA TGATTGTGAT GTGTCGCTTC TTAGAATTTA
  208261  TCAGTAATTA CAGATCCTTC ATTGGATGTA GTACCATCTT TTGTAGCTTC ACCAGGGGCG
  208321  GTATGGTTTT CAATGGTCCA AGTTTTAAAT CCTCGGATGT ATTGATAATC ATAATTCATG
  208381  TATTTGTGAG TAACCCCCCA TTGTAGAATT TCTACGGGTC CTTTTTCACT ATCTAAGGTT
  208441  CTGTTTAATC CAATAGCATG TGGCGCACCT TTAATAACAG ATTTAATATC AAAGTTAATT
  208501  CCATCGGGTG ACCATTGTAC GGTGTTTTTT TCAGGGCCAT CGGTAGTGAT TAATGCGGCA
  208561  ACACCATTGT TATATGGCCA TACGCAAATT TCATGTCCAC TATTTGAAAT GGGATTATAT
  208621  TCAGATTTAA TATAAGGTCC TTTTGGATTA TCGGCAATGG CTACGCCATG GCGAATTTGA
  208681  CGTCCACCAA ATGTAATTTC TTCACCCATT TGTTCTCCTT TGTAGTATAA GTAAAACTTC
  208741  CCATTAAATG GAATAATACA AGGGTCGTGT ACCTTATGGC TGTCAAAATC ACCTTTTTTC
  208801  TCTACTCTAA ATCTATTTTG TTCTGTTCCT TCCCAAACTC CATTGTCGGC AGGACTTAAA
  208861  ATAGGCTCTT CACTTTTAGT CCACGGTCCA TTAGGTGAAT TGGACCAAGC TAAACCAATT
  208921  TGATTTTTTA CACGAACCGT GTAAGGTGAT TTTACGGTTT GGTAACTTAA GTAGTAAACC
  208981  CCTTCGTGTA CCATAATTTC AACAGTAAAA ACAGATCGGT CATCATAAGC TCCTTTAGGA
  209041  CCTCTTTCAA CCGCAGGACC TTGTTCTTTC CATGTAATAC CATCTTCCGA AGTAGCGTAC
  209101  CAAATATCAC AACGATCCCA AGGAAATACT TTATCATTTT CGATATCACC ACCAAATCCT
  209161  TGGCTAGGAC CAGTACTACG GGTGTACCAT ACATAATATA ATCCGTCAAC CTTTATTAAG
  209221  GCACTAGGAT CTCTTCGAAC AACACCTTCC TCGTAAGCAA GGTCTCCTTT TAAATCATAA
  209281  ACTTCATATT CAAAAAACCA ATCTTTACCA AGGTCTCTTG GCCATTTTAA AGCTCGCTTA
  209341  GTAGCAGCAC TTAACTTATC TGGATTGGTA ATCCCAAATT TGTCAATTAT TTCATCCGTT
  209401  AATTGATATT CTTCTCTAAG ATTAGTCTCT TTTTGTGTGC TCATTTTCTT TACTTTACTT
  209461  ATTATCACGC CACATAAGTA GCTATAGCAA TATTAGCAAA AATTTTAATT TTGGTCTAAG
  209521  ATTTTGATTA ATTAACTTTT ATTAATATTT CGTTAGATTT AAGTGTATTT GACGTAGCGT
  209581  TGATTGTAGC TTCGGTGATA GTTTCGGTGG ATTGTACAAT TAGTAAAGCT CTTCCTTTAC
  209641  TTGTTGTGAG GCTGTTGGAA TTAAAATCTT GGTTGTTTTG TTTGTCACCA TTATCAACAC
  209701  CTAAAACACG AAGTGATGCA GGTACATTAA ATGTGATTTT TTGTTCTTCA GTTTTAACAG
  209761  GATTACCATC CTTATCTACT AATTGAGCTA CAATGTGCGA TACATCGTAG TTGTTGTTAG
  209821  TAAGCTGTGA ATTGTCAACG CTTAATTTAA TTTTAGTAGG CGCTCCAGCG GTAGTTATAT
  209881  TTTCTGTGAT TGTTTTTCCA TCTTTTATCC CGACTAATTT AATAGTACCA GCATTAAATG
  209941  GAACGGCCCA TTTGTATATG TGGTCATCAT TGTCTATTAA GAATTTTTTA CCAAATGATT
  210001  TTCCGTTTAA AAATAGTTCT ATTTCGGTAC AGTTAGAATA AGATTCAACG GCAATCATTT
  210061  TTCCATTTTC GTAATTCCAA TGTCTATTAA TAGGGTGCCA TTGCCACAAA GCATGTTTCC
  210121  AAGCTTCGGG GTCTTTTGCA ATGATTTTAC CTTTGTTGTC TAATTTGTAT AAGGATTTTT
  210181  CAATGTGTTG TGTAGTCACA AACATATTTG GCTTATTGTT CCATAAAGAG CGCATCATAC
  210241  CAAACGAGCC ACCTTCAAAA CCTGCAATGT CTAATAAGCC CGAAGGTTGT ACTACAGTAG
  210301  GCCAAGGTTC TCTAATTTCA CCTTGATAAT CTATTCCAGT CCATAGGAAA GTACCCGAAA
  210361  TATGAGGGCG TTCCATTATG GATTTCCATT CATGCCATTG TGCTAAGTTT TCGGTACCCA
  210421  TAATTGGTTT GTTAGGGTAG TTTTTATGAC CATAATCATA CAATACCCTT CGGTAACTGT
  210481  AACCTACAAC ATCAAGGGCA TCAGCATAAC CCGACAAATG ACTTGCCGAG GGTAGGATGC
  210541  AGTTCGCCGT TACTGGACGT GTTTTGTCCA ATTCTTTTGT CCATTTAGAT AATTTTTGGG
  210601  CAGTAGTGGC AATATCATAC TTTCCTTTAG GAAGTGTTTC TAATTGTTTT TTAATTTCTT
  210661  CGGGAGCGTA AGGAGGTTCG GACCAAAAAT AATTTCCATC CCAATTCATG TTATTAAAAA
  210721  ATCCAGTCGC AGCAGCATTT CTAGGGTAGG TCCATTCGAT TTCATTCCCA ATACTCCATT
  210781  GGAAAATCGA TGGATGATTG CGATGACTTA GAATAGTGTT TTTTAAATCC TTTTCAGCCC
  210841  ATTCTTGAAA AAAGCGTGGA TAGCCTTCCG TTTCTGGGAG TGCTTTCTTT TCTTTTTGAT
  210901  TAAAACGTTT GTCTTTAGGA TAATCCCATT CATCAAAAAA TTCATCTTGT ACCAAAAATC
  210961  CCATTTCGTC ACATAAGTCT AAAAATTCGT TAGAGGCTGG ATTATGCGAA ATTCGAATGG
  211021  CATTTACGCC TCCTTCCTTT AATTTTAAAA GCCTGCGTTT CCAAACTCCT TTGGGTACAG
  211081  CCGCTCCCAC AAGACCACCA TCATGGTGCA GACAGACTCC TTTTATTTTG TGGTTTTCTC
  211141  CGTTAAGGAA AAATCCAGTA TTTGAGTCAA AACGAATACT TCTTACTCCA AAACTAGATT
  211201  GATCACGGTC TATTATTTTG TCATTTTGAG TAATTGTGGT TTCAATTTTG TACAAGTTGG
  211261  GATGCTTAAT ATCCCATAAT TTAGGAGACG TAATGTTTAA AATATGAGTG GCTTCAATAG
  211321  TTGTATTAGT TTCAACTGTT TGTTCGCTTG CGCTAGAAGT TATAATATTG TCCGTAGTAG
  211381  GGTCAATGAT TACTGTTTTG AGTGTAAAAT TTTGAGTTGC TTGAGTGTTG TTTTTAAGTG
  211441  TTGTTTTAAT AGAAACGTCA GCACTCTCTT TACTTACTTT AGGTGTTGTA ATAAAAGTTC
  211501  CCCAAACAGG AATATGTAAT TTATTCGTAG TTATTAAGGA AACATTACGG TAAATACCTG
  211561  CTCCAGAATA CCAACGACTA TCGGCATAAG TGCGATGATC AACTTTAACA GCTAGGATAT
  211621  TTTGAGTAGC ATCGGTTTTT AATTTGTTCG ATATATCAAA ATAAAATGGA GAATACCCAT
  211681  AGGGATGAAT GCCTAATGAT TTTCCATTTA AAAAAACTTC AGAATTATTA TACACTCCAT
  211741  CAAATAAAAT GTACACTTTT TTATCTTTTG AAGGAGAAGC AAATGATTTT CGGTACCAAC
  211801  CAATGCCTTC CCCTTTTCGA TAGCCCGATC CCATGTATAA TTGATTGGAT GCGTTTGTAG
  211861  TATCAATGGA TTCTTCAATA ACCCAATCAT GAGGTAATAG CACGGCATTC CATTTGGAGT
  211921  CGTCAAAGTT TTCGCTACTT GCATCTGTAG TGCCTTTGTC TAAATAAAAT TTCCAACCAA
  211981  AATTAAAATC AGTGATTTTT GGAGTAACTG TGTCTTGGGA CTTTGGTTGG TTGCACGATA
  212041  TAAAAAAAAG TGCCAGTGAT GAAATAAGGA AAAATAGCTT CATTTTCGTT CAATATTCTA
  212101  TGAGTGAAAT TTTATTAATT ATATCGTTGT AGTAGTTGTT TGCTATGAAA TCATACCTGA
  212161  TCAAAAGTAC TTATTTTACC AGTGAAAAGC TATCTCCCTA TTTGTAAATC TACATATGTG
  212221  GTACATTATA GCACAAATAG ATTGGCTTTA GGTATAAATG GGTAAAAGTG ATAATTTTTT
  212281  ACTATGGTTT TGTTTTGTTA TAAGAGTTGC TCTTTTAAAT TTTTTACGGT TTCAACAGGA
  212341  TTGCTAGCTC CAAAAATATA GCTCCCCGCG ACCAATACGT TTGCACCAGC ATCAATAAGT
  212401  TGATTGGCAT TTTTATTGGA AACACCTCCG TCGATTTCAA TAAGTAAATC GGTTTGTTGT
  212461  TCGGTTGCCA TTTGACGTAA TGCTGTAATT TTTGAATAGG TGTTTTCAAT AAACGATTGT
  212521  CCACCAAAAC CAGGATTTAC ACTCATTAAA CAAACCAGAT CAGTTTCGGT AAGTACGTTT
  212581  TTTAATAATT CAATATTAGT GTGCGGATTA AGGGCAATTC CTGCTTTTAC TCCATATGAT
  212641  TTAATTAATT GAAGTGTACG GTGTAAATGC GTACAAGCTT CGTAATGCAC GGTAATGATT
  212701  TCGGCGCCTA ATTCAACAAA AGTTTTAATA TAACGATCGG GATCAACAAT CATTAAATGT
  212761  ACATCTAATG GTTTAGTGGC GTGTTTTTGA ATAGCTTTTA AAACAGGCAT TCCAAATGAA
  212821  ATATTAGGTA CAAAAACACC ATCCATAATA TCAATATGAA ACCAATCGGC TTGACTGTTA
  212881  TTAATCATTT CAATATCGCG TTGTAAGTTT GCAAAGTCAG CTGCAAGTAC GGAAGGTGCA
  212941  ATTTTTGTAA TTCCCATAGT TTTTATAGTT AATAGCGTTG GTTTAAGTTA AATTAAGAAA
  213001  GAATATAGTG TTTTGTACTA TATTTTTAAT TTTATAGTTG ATCAATACGC CAGACTTTCA
  213061  AAAGTATTAA ATTCTTCGCT TAAGCGAAAA AAAAGACTGT CTACAATTGC AGACAGTCTA
  213121  ATTAAATATA AATTTTTAAG GAATTTATCC TAAATAAGTT TTCAAAATTT TACTTCTTGA
  213181  AGTGTGCTTT AAGCGACGAA TTGCTTTTTC CTTAATTTGA CGAACACGCT CACGAGTAAG
  213241  GTCAAAAGTT TCTCCAATTT CCTCTAATGT CATTGGGTGT TGATTTCCAA GGCCGAAATA
  213301  TAAACGAATC ACATCAGCTT CACGTGGAGT TAATGTTTCC AAAGCACGTT CAATTTCCGT
  213361  GCGTAATGAT TCGTGCATTA ATTCACGGTC AGGATTTGGT GATTCTCCAG AACGTAAAAC
  213421  ATCGTATAGG TTAGAATCCT CACCTTCAAC TAAAGGAGCA TCCATGGATA CGTGACGACC
  213481  AGAGTTTTTC ATAGACTCTT TTACATCACT AATAGTCATA TCTAGCTCGT TTGCAATTTC
  213541  CTCAGCACTT GGAGGGCGTT CATGAGACTG CTCTAAAAAA GCATATGTTT TATTGATCTT
  213601  GTTAATAGAA CCAATTTTGT TCAATGGTAA ACGTACAATA CGTGATTGTT CTGCTAAGGC
  213661  TTGCAAAATA GATTGACGAA TCCACCATAC AGCATAAGAG ATAAATTTAA AACCACGAGT
  213721  TTCATCAAAA CGTTTAGCAG CTTTAATAAG TCCAAGATTA CCTTCGTTAA TTAAATCAGG
  213781  TAACGTAAGT CCTTGATTTT GATATTGCTT GGCAACCGAT ACTACGAAAC GTAAGTTAGC
  213841  TTTAGTCAAC TTGTCCAAAG CACGTTCATC ACCTGCTTTA ATTCGTTGTG CTAATTCCAC
  213901  TTCTTCATCA GCAGTAATTA GATCTACCTT TCCAATTTCT TGTAAATACT TATCTAATGA
  213961  TGCTGTTTCT CTATTGGTAA CCTGCTTGGT AATCTTTAGT TGTCTCATCT ACGCACTTGT
  214021  GTTTAAATGG TTATGTACAG TCTATTACGT AAATTGAGAG ATTAATGTTA CAAAAAAATT
  214081  AAATTTTTTT TAAGTTTTTG ATAATCTTAG TAGTTAGTAG CTGTTTTATG TTGGTTTATG
  214141  GAATTAGATT TGAGATAATT AGGTAGTGAT ATATAGTTTT TTCTATAAAG TAATATTCCG
  214201  CTTGAACGCA CAACCTAAAT CAACTATAGA ATCAGTTTTT TGAATTCCTT TTATATGATC
  214261  TAATTTATTG TATAAAATTT CGCGCATGTG CTCATGAGAT TTTGCATTGA TGCGTACAAA
  214321  AAGTGTAAAA GATCCCGTCA CAAAGTAACA TTCAGTTATT TCAGGAATTT CCTTTAGTTT
  214381  TTTTATAATC TTTTCACTGT CATGATCTTT TTTTAGGGTA AGCCCTGTAA ACGCCCCCCA
  214441  ATCATAACCC GCCTTTTTTT CATTAATTAT AGGGCCAATG CCTGTCAATA TCCCGTTTTC
  214501  GATCATTTTA TTGACACGTT GGTTGACCAT TGTGTTAGAA ATATCTAGTT TTTGAGCAAT
  214561  TGCAGAGTAG GCTTTTCTTC CGTCCAACTC TAATTCTTTT ATGATGCTTC TGTCGTAGTT
  214621  GTCAAGTTCA AAATTTTCCA TGCTGAAAAC TAAGAATTTT AAAATTAGCG ATGAAATTTT
  214681  TTTCAAATTA ATATAAATTT AATTAATTGT TAAATTTACT TTTTCAAGTG TCTTAAAAAT
  214741  TATTTTAAAT CATAAATTGC TTAATAAATT TAAAATTTAA CTTTTAAGGT ATTTTTATGA
  214801  TTAAAATTAA CTTTTTATTA GGATTGTTGT TATTGTCCAC ATTTGGAATG CTTGGCCAAA
  214861  TTGAAGTTAC AGGGTCGGTT ACAGACAATA TAGGGAATTT TCTTCCCAAT GCTGATATTA
  214921  TAGAAAAAGG AACAACCAAT GGTACGACAA CTGATTTTAA TGGGAACTTT AAGTTGGAAG
  214981  TTAATAAAGG AGCTACAATT GTAATTAGTT ATGTTGGATT TGAATCACAA GAAATCGAAA
  215041  TAACAACACA AACTTCTTTT CAAATAACAC TGAATCCAGA TAATTCACTA AAAGAAATTG
  215101  TTTTAGTGGG GAGTAGGAGT CCCAAGCGTA CTGTGGTTGA TAGTCCTGTT GCCGTTGATA
  215161  TTATTGATAT AGCCGAGGTG ACTTCTAAAA CTGGGAAAGT TGAAATTACG GAATTATTGC
  215221  AATTTGCAGC GCCTTCCTTT AATGCTCAAA AGCAATCTGG AGCAGATGGT GCAGATCATA
  215281  TAACACCAGC AACACTAAGG GGGTTAGGAC CAGATCAAAC ATTGGTCTTA ATTAATGGTA
  215341  AACGTAGGCA TCAATCTTCA TTAGTTAATT TATTTGGAAC CCGAGGTCGG GGTAACACGG
  215401  GGACAGATTT AAACGCTATT CCTGCTTCTT CAATAAAAAG AATTGAAGTT TTACGAGATG
  215461  GGGCATCTGC TCAATATGGA TCTGATGCTA TTGCTGGGGT AATTAATATT GTATTAAAAA
  215521  CAAGTGTAAA TAAGTTAACA GGCGAAGTTT TTTATGGAGC TAGTGATGTA AATGATAACG
  215581  GAGGCTTTGG TATACCAGCT AAAGAAGGAT TAGATGGAAA TACGTATAAA GCAACAGCAA
  215641  ACTATGGGGT AGCTTTAAAT GAAAAAGGAG GCTATGTTAA TGTAACTGGT GAGTTTTTAA
  215701  AAAAGGAAAA AACATTTAGA CCTGGTGCCG ATTTTAGATC AAAATTTGGA GAAGCAAGTA
  215761  TTGATGCTTT TCATGGTTTT TTTAATTCGG AAATTCCCAT AAATGACCTG TCAACATTTT
  215821  ATGCTTTTGG AGGAGCAAGT ATAAAAGATA CAGATGCTTT TGCGTTTGAT CGAGGTGCTA
  215881  ATGATAATAG AAATGTAACA ACAATTTATC CAAATGGATT TACACCTCGA ATTAGTTCTA
  215941  TAATTAGAGA TCGTTCTATA TCTGCAGGAA TTAAGTCTAA ATTTAGAGAC TGGGATGTAG
  216001  ATTTTAATAC TACTTATGGT ATTAATGAGT TTCATTATTT TATCAAAGGA AGTTTAAATG
  216061  CGTCATTATT GGAAGCTTCA CCAACAGAAT TTGATGCGGG AGGACATAGT TTAAGTCAAA
  216121  ATACAACAGG AATAGATTTG ACCAGAAATT TTGATGTATT ATCTGGGCTT AATATTGCCT
  216181  TTGGCGGTGA ATATAGAATT GAAAACTTTA ACATTTTTAC AGGCGAAGAG GCATCATACA
  216241  CCCAATATGA TTTAAAAGGG GTTCCTTTAT CATCTGCCAC CCCAGTTGAA GATAGACCAA
  216301  CCGCAGCACA AAGTAGACCA GGCGGTTCGC AAGGTTTTCC GGGTTATAGC CCAGCAAATG
  216361  AAGTAGATCA ATTTAGAACA AATCTTTCTG CTTATATTGA TGGAGAACTT GATGTAAATG
  216421  ACAATTTTTT AATTGCTTTG GCAGGAAGGT TTGAACATTA CAGTGATTTT GGGTCAACAT
  216481  TTACCGGAAA ATTATCTTCA AGATTAAAGC TAATTCCAAA TTTAAATATG CGAGGCTCTT
  216541  TAAGTACTGG TTTTAGAGCA CCTTCGTTAG TTCAATTATT TTATAATTTA AAGTTTAGTG
  216601  ATTTTGAAGC AGGCGAGTTA ACCGAAACAC TACTTTCTCA AAATGCTAGT CCTGTAACCC
  216661  AATCATTTGG AATTGGTAAA TTAAAGGAGG AAAAAGCTAA AAGTGCCAGT GTTGGTTTTA
  216721  GTTATTCTGG AAATGGTTTT TCTGCTTCTA TAGATGGTTA CTACACTAAA GTAGATGATC
  216781  GTATTGTATT AACAGGTAGT TTTAATGAGT CCAGTGGGTT AAATCCGAAT TTAGGAGTAG
  216841  CTGCAGCACG CTTTTTTGCA AATGGGGTGG ATACCGAAGT CTTAGGTTTG GATTTCGTAT
  216901  TTACCTATAC TACCCGCTTT GATGAACATA AATTAGGGGC TAACCTTATA GGGAATTTAA
  216961  ACAAGCTTAA CATAACAGAA ATTAATACCG GTGATATATC TGAAGCGAAT ATTGATACAT
  217021  TTTTTGGTGA AGGGGAGCAA GCATTTTTAA AATTTTCGTC TCCAGAATAT AAAATTAGCT
  217081  TAGGTGTTGA TTACGCATAC TCTAAATACA GTGCCAATAT AGTAACCACA TTTTTTGGTA
  217141  ATGTAGGACC TTTTGTAAGT AATGATGATT CAAGCTTAAA AAATACTTAC GGCAGTACAT
  217201  CAACTACAGA TATAAGTGTT GCTTATAGCA TTACAGACAA TATAAAGATT ACTATAGGAT
  217261  CTAATAATGT GTTTAATCAA TATCCAGATG AACAAGATCC CAATGGAACC GAAAGCTTTG
  217321  GAATTTATGA TGCCGTGCAA CAAGGATTCG GTGGCGCATT TTACTATACA CGTTTAAGTT
  217381  ATAGTTTTTA GTTTTTTTTA GTAAAAAAAT ATAAAGAAGG CAATTCTGTA TTTGTAAATT
  217441  GGAATAGTCA AACTCGTTTT AAATACCATA AACAAATGAA TTTAGAAAAA ACGTTTATAG
  217501  ACCAAGAGGA AATGTATGGT GCACATAACT ATCATCCACT TCCAGTGGTG CTCAAAAAAG
  217561  GAGAAGGAGT TTATGTTTAT GATGTTGATG ATAAAAGATA TTATGATTTT CTTTCTGCTT
  217621  ATTCTGCAGT AAATCAGGGG CATTGTCATC CTAAAATAAT AGAAGCACTT ACTAGTCAGG
  217681  CGAATAAGTT AACCTTAACT TCTCGAGCTT TTTTTAATGA TCAACTAGGG CCTTTTGAGG
  217741  AGTTTATATC AAAAATGTTT GGTTATGATA AAGTCTTATT AATGAATTCC GGAGCCGAAG
  217801  CAGTCGAAAC TGCTATGAAG CTGGCGAGGA AATGGGGGTA TCAGAAAAAA GGAGTAGCGC
  217861  AAAATAAGGC AACATTAGTA TTTGTAACCG GTAATTTTCA CGGGAGAACA TTGTCAATTA
  217921  TTTCTGCTTC GCAGGATCCA GTAAGTAAAA ATGGTTTTGG ACCTTATATG GAAGGGATTA
  217981  GCATAGTTCC CTACAATGAT ATTGAGGCTT TGGAAGTCTG TTTGAGTACA AATAAAAATA
  218041  TAGTGGGATT TATAGTGGAA CCTATCCAAG GAGAAGCAGG TGTGATTTTA CCAGATGCTA
  218101  CTTATTTAAA AAGAGTAAGA GCACTTTGTA CGGAGTATAA TGTATTGTAT ATAGCAGATG
  218161  AAATTCAAAC AGGAATAGCA AGAACAGGAA ACTTGTTGGC TTCATGTGGT GATTGCAAAT
  218221  GTACCGATAG GTGTAATCTT ACAAAAGAAA TTAAACCAGA TATTGTAATT TTAGGAAAAG
  218281  CCTTGTCAGG TGGAGTGTAT CCAGTTTCGG CAGTTTTAGC AAATAATGAA GTAATGCTTT
  218341  GTATACAACC TGGGGAACAC GGTTCCACAT ACGGAGGGAA TCCTTTAGCT TGTGTAGTTT
  218401  CAAGAGCTGC TTTGGATGTG ATTATTGAAG AAAAACTGAC AATACAAGCA AAAGAAAAAG
  218461  GAGCTTATTT ACGTGATAAA TTAGAGATGT TAAAAGATAA ATACCCGTTA ATTATTTCGG
  218521  TAAGAGGTAA AGGCTTGTTA AATGCTATTG AAATAGATTC TTCGGAGCAG TCAGAATTGG
  218581  CTTGGCAAAT CTGTTTAGAA TTTCGAGACA ATGGTTTATT GGCCAAGCCG ACTCACGGGA
  218641  ATAAAATTCG ATTGGCACCT CCATTGATTA TTACATACGA TCAAATAGAT GAGTGTGTGT
  218701  GTATTATTAA TAAATCATTA CAAAAATTTT CTTGTCATGA ATAAGGGAAA TAGCATGGTA
  218761  CAGGATAAAG TAAACACAGA AGGAACAAAG GTTTTTTCTC AACGGCCTGC ATTAACTTCT
  218821  AACGTAATGA TGGTGCGACC TGCTAATTTT GGATTTAATG ATGAAACAGC TGAAAATAAT
  218881  GCATTTCAGA TAAATAATAC CGAGATTTCC ACAGCAGAAA TAGCTGCAAA AGCGGTTCAG
  218941  GAATTTGATC GTTTTGTAAC TATGCTCAAA AAGAATGATG TAAATGTAGA AGTAATTCAG
  219001  GATCCACAAT TTCCTGTAAA TCCAGATGCT GTATTTCCTA ACAATTGGAT AAGCTTTCAT
  219061  CATCCCGATT TTGTGGTTAC TTATCCAATG TTTGCATTAA AACGAAGAAA TGAACGGAGA
  219121  AAAGAAATTA TTGATGATTT AAAATTAGCA TATAGCATAA AGGCGCAATT TGAATTTGAA
  219181  CATTTCGAGA AAGAAAAAAT GTTTCTAGAA GGAACAGGAA GTATTGTTTT TGATCGCACT
  219241  CATAAAATAG CCTATGCTTG TAAATCTATT CGAACAAATG AATATCTATT CAATAAATTT
  219301  TGTGAAGATT TACATTTTAC TCCCATACTT TTTGATGCAG TAGATAAAAA AGGACAGCCA
  219361  ATTTATCATA CAAATGTGAT GATGACTGTT GGAGTAGATT TTGTAATCAT TTGCATGGAA
  219421  AGTATTGCTT CTGTTGTTGA CCGTAAAAAG CTAGAAGCAT TATTTAAAGA AACAGGAAAA
  219481  GCCATAATAC CCATATCCAT TCCGCAAATG GAACAGTTTG CGGGAAATAT GATACAGCTT
  219541  AAAAATAAAA ATGAAGAATC TTTATTGGTT ATGTCTTCTA AAGCATTTAA TTCATTGACC
  219601  CAAGTGCAAC TAATTGAAAT GGAAAATTAT GCTAAAATTA TACATGCTGA TCTGGATGTA
  219661  ATTGAAACTT ATGGAGGAGG AGGAGCGCGT TGTATGATCG CTGAAATTTT TTTAAAACCC
  219721  TTACATGGGA AATAGACAAT TTATACTAAT ATCCAATTAA TGGAAGAAAC AAAAATACTT
  219781  ATAGATTCTC AACCAAAATA TAGTGTGCAA GCCGAATTCA ATAGGGCGCA AGCAGTAATA
  219841  ATGCATGAAC CCTCTAGTGA ATTATATTAT GGTGTATTGC ATCCACATGC GGCTCTTTTT
  219901  GATTCTTATT TTAATGCAGC CAAAGCGGCT AAAGAACACA AGCAATTTCA GCAATTACTA
  219961  AAAAACAGAG GTATTGAAGT TTTTACTGTT AAAGAAGCTT TATTGAAAAA TGTAGTAGAT
  220021  GAGTTAGGTG AACCTATTGA AGGTAAAGAG TTGGAGGAAT TTAGAGATTT TGCCCGTTCA
  220081  TGCGTGCGTT TAAACACACC AAGTTTAACA GGTTTAAGTT ATGATGAAAT TGTAGAACAA
  220141  CATATTTATT TAGACAAGGT GTTTAAAAAA ATGCATCCTG TTGACTTAGT GCGTACTATT
  220201  TTGTTACAAC CTAATTTAAT TTTAAAAAGA ACACTTACAA ATACATTTGT TACAGCGGAT
  220261  TATAATGCAA ATCCAGTAAT GAACTTATAT TTTTCCCGAG ATCAAATTAT TACTACAGGT
  220321  AAAGGAGTTG TATTGACCAA TTTGAATTCG CCTCAGCGAG AAATAGAAAC ACGTATTTTA
  220381  TGTATGTGTT TAAAAAAAAT AGGAATTAAA CCGCTATTAG ACCTTTCTAA AGTAAATAAA
  220441  AGTGCTCATA TCGAAGGGGG AGATTTTTTT ATGTTAAATA ACATAGCCTT AATAGGTGAA
  220501  GGGATGAGAA GTAATCGATT GGCTATTGAA ATTTTAATGA AAGCCGATGT GATTGGGACA
  220561  GAGCAAGTAG CTCTGATAAA GGATAACTAT CACTATCAAC CTCAAATGCA TTTGGATACT
  220621  TATTTTAATA TTATTGATAA GGATTTGGTA GCTATTTCGC ATAATCGTTA TAACGCTGGA
  220681  CCAGGTACTA AACAAGAGTT ATTAGTTGAT ATTTATGTAA AAGGTGCAGC TTCATATCAA
  220741  TTGACGGAAG TATCCATTCC TTTTAAAAAG TATTTAGAAG ATTATTTAAA AGTAGAGGTG
  220801  ATTGTAATTT CTGACGAAGA TCAAAAAAAT TATGGCTTAA ATTTTTTATG TATTAGTCCA
  220861  AGGAATATTA TAGCTGTAAA AGGGCAGTCT GAAGATTATA AAAATAAAAT GGCACTTCAT
  220921  AATGTAGCTG TCGAGTGGGT CGATTTTGAA AATTTAAAAC AAGGTTGGGG TGCGGCACAT
  220981  TGTACCACCC AAGTTATTAA TCGTAAAATA TGATGTATGA GTAATGCTTT TTATACCATT
  221041  CCAGAACCAA GTAATGAATT AGTAAAATCA TATGCTAAAG GATCATTAGA GCGAAAATTA
  221101  TTATTTGAGG CTTACGATGA AATGTATAAA AGGCGAATTG TGGTTCCTCT GTACATTAAT
  221161  GGGGAAGCAA TTTTTACTGA AAATAAAGAG GCAATTAGGC CGCCACACGA TTTTAATCAT
  221221  GTGGTAGGAG ATTATGTTAA AGCTAGTCCT AGTCATGTTA AAAGTGCCAT TGATTCATGT
  221281  TTAAAAGCAA AGGCGGATTG GGAGCAAATG CCTTGGCAGG ATAGAGCGGC AATTTTTTTA
  221341  AAAGCTGCAG CTTTAATTTC GGGACCCTAT CGGTATAAAA TAAATGCCGC TACCATGATT
  221401  GGTCAGTCTA AAAATGTATA TCAAGCAGAA ATTGATAGCG CTTGTGAATT AATCGATTTC
  221461  TTTAATTTTA ATGCTAAGTT TTTAGAAGAA ATATATAGTT CGCAACCCAT TTCTTCTGTT
  221521  GGAATATGGA ATAGAACCGA ATACCGCCCT TTGGAAGGTT TTGTATATGC CATTACCCCA
  221581  TTTAATTTTA CCGCAATTGC GGGAAATTTG CCAGCGGCAC CCGTTTTAAT GGGAAATGTT
  221641  TGTGTTTGGA AGCCTTCGGA AAGCCAAATG TATTCGGCTA ACATTATTAT GGAAGTTTTA
  221701  ATAGAAGCTG GTTTACCAAA AGGAGTAATT AATATGGTAT CTGGTGACCC GGTTATGATA
  221761  TCAGACAGTG TACTTAATCA TAAAGAATTT AGTGGGCTTC ATTTTACAGG TTCTACAAAA
  221821  GTGTTTAAAA CCTTATGGAA GCAAATAGCA CTTAATTTAG ATCATTATAA GACGTATCCA
  221881  AAAATTGTAG GGGAAACAGG AGGGAAGGAT TTTGTCTGGG CGCACCCATC GGCGGATGCA
  221941  GCTATAGTTG GAACAGCTCT TATCCGAGGC GCATTTGAAT ATCAAGGGCA AAAATGTTCA
  222001  GCAGCTTCTA GGGCGTATAT TCCAAAGTCA ATGTGGGCCG AATTGAAAGT TTTTTTAGAA
  222061  GCTGAACTTA AAACGATAAG GGTAGGTTCT CCACGTAAGG TTTCAAATTT TATAAATGCA
  222121  GTAATTCATG AAGCTTCATT TAAAAAATTA GTAGAAATTA TTGAATTTGT AAAAGCCTCA
  222181  AATGATGCAT CCATACTTTT TGGAGGGGGC TATGATAATA ATATTGGCTA CTTTGTTGAT
  222241  CCAACAATTA TAGTTGCTAA AAATCCCAAT TTTAGAACAA TGACGGAAGA GCTATTTGGA
  222301  CCTATTTTAA GTATTTATGT GTATGAAGAC ACACAATGGG AAAAAGTTTT AAAAACAGTA
  222361  GATCAAACCT CGGAATATGC ATTAACAGGA GCCATTTTTG CCCAAGAGCG TTCTGTGATC
  222421  ACAAAAGCAA CAGCTATACT CCGTAATTCG GCAGGTAATT TTTATATTAA TGACAAGCCT
  222481  ACTGGAGCTG TAGTGGGGCA ACAGCCATTT GGTGGAGCCA GAGGCTCAGG AACTAATGAT
  222541  AAGGCAGGTT CTATTTATAA TTTATTACGT TGGGTTTCTC CGCGTACTAT AAAAGAAAAT
  222601  TTTGTACCTC CTACAAATTA TAGCTATCCA TTTTTGGAAG AATAATATTA AGTAAAAGTG
  222661  TTTTATCATG TTTTAAATTA ACTATTATGG TATTTGATAT TAAAGAAATT ATTACCGCAA
  222721  CCATGATTCT ATTTGCGGTT ATAGACATTG TAGGTAGCAT TCCCATTATT ATTGATTTAC
  222781  GTAAAAAAGT AGGGCATATT CAGAGTGGAA AAGCGACTAT AGTTTCAGCA ATATTAATGG
  222841  TCACATTTTT ATTTGTAGGA AAGCAAATGT TGGAACTTAT AGGAATTGAT GTAAATTCCT
  222901  TTGCCGTTGC GGGGTCATTT ATTATTTTTT TTATAGCCTT GGAAATGATT TTAGGTGTTC
  222961  AATTGTACAA AGCCGAAAGT TTACAAACTG CGGCCATAGT CCCTTTGGCT TTTCCTTTAA
  223021  TAGCTGGGGC CGGTACGCTA ACATCAATTT TATCACTCCG ATCAGAGTAC CAACCTGTAA
  223081  ATATTATAAT AGCCATATTG ATTAACTGTT TGGTGGTTTA CATAGTATTA AAATCTTCAG
  223141  TCAAAATTGA AAAAGTACTT GGAAATCAAG GGATAGATGT AGTAAGGAAA ATTTTTGGTG
  223201  TTATTTTATT GGCTATAGCA GTAAAGTTAT TTACAACCAA TATTAAAGGT TTGTTAGCCT
  223261  AAATTATTAT TTTATGAAAT TAATTTTATT TTGTTATGTG TCAATGTTAT TATCATTATC
  223321  GGCATGTAAA AAAGAAGTGC CACAAATAGC AGAAGCTGAT ACAGAATTTA TTTCCAGATC
  223381  ACACCTTTCA AACGAAGAAG AAATTTCTAA AGTGCCAATA CTTAATTTTG GAACATTTCA
  223441  CATGGGCAAT ACCAATGATG CTCGTAAAAC CGAATTTGAT GAAAAAAATG AAGAAAATAA
  223501  AAGAAAAGTT CATAAAATAG CCAACGCACT TGCCAAATTT AAACCAACGG TTATAATAGT
  223561  AGAGAGATTA CCTAAATATG ATAAAAAATT GCTTGCTAGC TATAATGAGT ACATAAAAAA
  223621  TCCTAAGGAG TCTTTTAAAA ATCCTAGCGA AATTGAACTT TTAGCATTCG AAGTTGGGAG
  223681  ACTGAGTAAT ACAAAAAGAA TGTATGGGAT TGATCACCAT ATGGATTATA ATTACATGAT
  223741  AGGTGACGAA ATTAAGAATC AAATAGATGC TACTATGTAT AATCAATTTG ACATAAACCC
  223801  ACTACTGTAT TACCCCAAAA TTAATGTAGA TGAGGATAAA TTAAGTCTGC TTGATAAATT
  223861  AAAATTAACG AATCAAGATG ATTACTTAGA TTTTCTTATT GAAGCAAATG CAGATATACT
  223921  TACTCATGCT GGGACAGATG CTAATTTTGA AGGAGCAGAT GAAGCAGCAA AATATTACAA
  223981  AAGAAATTTA AGAATGTATT CAAATTTAAA TAGAATCAAA TTAGAACCTA CAGATCGCGT
  224041  TTTTATGATT ATGGGGGCAT CTCACACAGC TTTTTTTAGA GATTTTATTA AAAGAAGTCC
  224101  TAAATATAAA ATGGTAGATA CATTTGATTA TTTAAAATGA ATAATTTAGT TATCACTTAA
  224161  AAACCGCATT AGGAAAAACA ACAGGACTCT CAATACCTTC CATACTTACA CTAGAAACAC
  224221  CAAAAAAATA ATTGTCAATA ACAATTCCTT TTAAAGTAAA TTGATCAACA TTCCCAACAT
  224281  AGCGAGAATA ATCCCAAGTT GGGGAAGTAG TGCTACGCCA ATAAATTTTA TAGCCTTTGA
  224341  TATTGCTATC GCTTATTTTT TTCCATTTCA ATTTTACCGA AGATTCTACG ATACCACCTA
  224401  TTTTTACTTC GGTAGGTGGG GGAGAAGCCC AAGCTAATTG CGCTAAGTTT ATAGCATTAA
  224461  CAGCAGTTAA TTTTGCTGCA TAACCAAAAT TTACATGTTC TACAGTATCT CCATAATCAA
  224521  TACCATTTTC GGTACGAATA TCTTGATGTT GTTGGGTGTA ATTTTCATGT GCTTCCATAA
  224581  TTCGAATACC TGCATAACCT AAATCATTAA AAGGTTTGTG ATGACCACCA CGACCAAAAC
  224641  GATCTAAACG ATAAATGAGC ATTGGATTCA TTTCGGGCAT ATAGGTTTGT ACGCTTTTAT
  224701  GTACATAACG TGCTAATTGG CGAGATATCC CATCGACTTC TCCTCCATAA TAACGTCTAC
  224761  GCTTTATTTG ATCCTCGGTA TCAGTAATAT TTGTAGGTTC CGAAAAAATT CGAAATGATC
  224821  TGTTGTCAAT AACTCCATCT ACTCCTTTTA TATTTCCGAT CATATCGTTA TTGAGTACGC
  224881  CTATAATGTC CCAAGCTTGT TCTTTGGCAT ATTTAGCTAA ACCTGCTCCT CCAAATAAGC
  224941  CTTGTTCTTC GCCTGAAAGA CCAACATAAA TAATGCTATT TTCAAAAGTG TATTTTGATA
  225001  ATACTCTAGC TGCTTCAATA GTACCTGCCA TTCCACTAGC ATTGTCATTA GCACCAGGAG
  225061  CATCTGTTGT GAAATCCATA GTGTCGCTTG CGCGAGAATC AATATCACCA CTCATTATTA
  225121  CATATCGGTT TGGATATTTT GAACCTTTTT GAATAGCGAG TACATTTACC ACCCAAGCAT
  225181  CTTTAGGGAC TCTTTTGCTC ATACTTTTTG TTACAAAATC TTTTTGATAA GAAACTTCCA
  225241  AACAATGGTT ACAGTTTTTT GAAATTTGTT CAAATTCAGC CTTAATCCAA CGCCTAGCCG
  225301  CTCCAATGCC TCGAGTTTCA GAAAGGGTGT CGCTAAATGT ATTTCGAGTA CCAAAACCAG
  225361  CGAGTTTACG AATGTCTTTT TCTATTTGTT TGGCAGAAAC ATTTTCTATA ATATCATAAA
  225421  TTTTGGATTC GATTTGTGCG AATGAAAATT TGATTAAAAA TAAAAACGAA ACTAAAAGTA
  225481  GGCCTTTCTT CATAGCAATA TTTTTTTCTA AAATAAATAA AAACTAAGGA TCTATGAGTA
  225541  ACCTTAACAA AGCGCTAACG AATGTATTTT TTAGATGCTT GTATGTATAA AAAAACACCT
  225601  CAACAAATTA AATTTGTTGA GGCGTTTTAA TAGTAATTTA TTCAAAAGAA TAAGCCCACT
  225661  GGTGGGTTAA TCTCTTTTTT CACGAGGTTT ACGATCACGA TTGTCTCTTC CTCTGTTATC
  225721  TCTGCCTTTT CCTTTATCGT CTCTTGGTGG ACGTGCTACA TAACCTTCTG GTTTAGGTAG
  225781  TAACGCCTTT CTTGAAACTT TTTCTTTACG AGTTCTTGAA TCTATACCAA AATATTTAAC
  225841  ATCAAGCTCA TCACCAAGGT TTAATACATC GGTAACGTTT TCAACACGTT CCCATGCAAA
  225901  TTCAGATACG TGCAAAAGAA CTTCGTTACC AGGAGCTTCT TTGTATTCAA CAACGGCACC
  225961  AAAATCAAGT ATTTTAATTA CTTTAACTTC ATACACACTA CCAACTTGAG GTTTGAATAA
  226021  CATGGCTTCA ATTCGTGCTA AAACAGCATC AATACCTTCG GCACCTGTTC CTAAAATTTC
  226081  AACAATTCCT TCCTCCGTAA CAGGGTCTTC GTTAATTACA ATAGTGGTAT CTGTAGTTTT
  226141  TTGTAATTCT TGAATGTTTT TACCTCCAGG ACCAATTAGA GCTCCAATAA ATTCATTAGG
  226201  AATTACACGT GTAACCATTT TAGGGGCATG ATCTTTCACG TCTCCTGCAG GTGTAGCAAT
  226261  GGTATCTGTA AGTTTACTTA AAATATGTAA ACGACCATCA CGAGCTTGCT TTAATGCATT
  226321  TACCAAAATT TCATAGCTTA AGCCTTTAAC TTTGATATCC ATTTGACAAG CGGTAATACC
  226381  ATCTTCTGTA CCTGTAACTT TAAAATCCAT ATCACCTAAA TGATCTTCAT CTCCTAAAAT
  226441  ATCAGATAAT ACAGCATAGC GATCACCATC AGAAATTAAT CCCATTGCAA TACCCGATAC
  226501  TGGTTTTTTA ATTTGTACAC CAGCATCCAT TAGTGCCATT GTACCGGCAC ATACCGTTGC
  226561  CATAGATGAA GAACCATTTG ATTCTAAAAT TTCAGAAACT ACACGAACAG TGTAAGGACA
  226621  ATCTTCGGGT ACCATACCTT TTAATGCACG TTGTGCTAAG TTTCCGTGTC CAACTTCACG
  226681  ACGAGAAGTA CCTCTTAACG GTCTTGCTTC TCCAGTAGAG AATGGAGGGA AATTATAATG
  226741  TAAATAGAAA CGTTCTTCTC CTTCATGCGA AGCGTTATCT ATAATATTTG CATCACGAGA
  226801  AGTTCCTAGG GTAACTGTAG CTAATGCTTG AGTTTCTCCA CGCGTAAAAA TTGCAGAACC
  226861  ATGTGTGGTT GGTAAGTAGT CAACCTCACA CCATATTGGT CGTATATCGG TTGTTTTACG
  226921  TCCATCTAAA CGAATTCCTT CTTCTAGCGT AAGATTACGA ACGGCCTCTT TTTGTGTTTT
  226981  ATTAAAATAT TTAGAAATTA AATCACCTTT TTCAGCTAAT TCTTCTTCAG AATATTGCGC
  227041  TTGTAATTCT TCTTTAATTT CTCCAAAAGC AGCTCCTCTA TCATGTTTAG CAGATGCTTG
  227101  TTTGGCAATC GCATAACATT TATCATAAGC AAAATCATTA ACTACTTTTG CTAATTCTTC
  227161  GTCAGTATCT TCTGGTGTGT ATTCACGCGT TTCTTTTTTA CCAAAAGCTT CGGCTAAACG
  227221  TACTTGCGCA GCACATTGTA CTTTTATGGC TTCATGAGCT ACTTTGATAG CTTCAATCAT
  227281  TTCTTCTTCA GAAATTTCAT CCATTTCACC CTCTACCATC ATTACAGAAT CGGCTGATGC
  227341  ACCAATAACC ATATCAATAT CAGACTCTGC TAACTGAGCA AAAGTTGGAT TTACTATGAA
  227401  TTCGCCATTT ATTCTACTTA CTCTTACTTC AGATATAGGT GCTTCAAAAG GAATATCCGA
  227461  TAATTGAATG GCAGTTGAAG CAGCAAGACC AGCTAAAGCA TCTGGCATTA CTTCTGGATC
  227521  ATGAGACATT AATTGTATCA TGATTTGAGT TTCTGCATGG TAATCTTTTG GGAAAAGTGG
  227581  ACGTAATACA CGGTCAACAA TTCTCATTAC TAAAATTTCT TCGGTACTAG GACGCGCTTC
  227641  TCTTTTAAAG AAACCACCTG GATAACGACC TGCGGCAGCG TATTTTTCTC TGTAATCAAC
  227701  AGTTAAAGGT AAAAAGTCTA CATCAGATTG CTTGTAGTTT GATACTACTG TACAAAGCAA
  227761  CATTGTTTTA CCCATAGTTA CAACAACAGA CCCGTGGGCT TGCTTTGCTA ATTTTCCAGT
  227821  TTCGATAGTA ATTTCTCTAC CGTCACCAAG GTCAATGACC TCCTTAAAAA CTTGTGGAAT
  227881  CATAATTTTT TTTAATCATT TTAGTTTGTC TCGATTTGTT GGTGGCAAAT CATTTGTTGT
  227941  TGTGTTGCTA GGCTTCGTGA GAAGTTCCTT TTAGCAAGGG AGACAATTTA TATAAAGCTT
  228001  TGTTTTTTAA ATTATTAAAA AAGTAAGTTT TGAAAAGGTG TTTTTCAAAA AAAAGCTTAA
  228061  TCTGTAATTT GACGAAAGAT ACGTTTTTCT TTTCATTTGG TGATAAAAAA AAACGGAGCC
  228121  ATTAGCTCCG TTTTTTTTAT ATAAATATCG TTGGCTTATT TTCTTAAACC AAGCTCTTTT
  228181  ACAATTGCAC GGTATCTTAA GATATCCTTT TTGATTAAGT AGTCTAATAA ACTTCTACGC
  228241  TTACCTACTA ATTTTACTAA TGAACGCTCA GTATTATAAT CTTTACGATT TTGTTTTAAG
  228301  TGCTCAGTTA AATGTGTAAT TCTGTGTGTA AACAAAGCAA TTTGTGCTTC TGCAGTTCCA
  228361  CTATCGTTTT TTCCTTTACC GTGTTTAGCA AAGATTTCTT CTTTAACTTC TTTTGTTAAA
  228421  TACATTCCAA TATTATTTAA ATGATTATTA TGCATTTGAA AGATTTTCTT TCAAGGCTGC
  228481  AAATGTACCA TTTTTATTAT TATATTTTGC TTAATATGTA AAATATAATG GATGTTTTTT
  228541  AATACATATT AATTTAGGAC ATTAGAAAGT ACTTTTCTGA GCTTTTTAGG ATTTAGTCTG
  228601  GTGTCAATAA TAGTTCCTTT GGTATCTATT AAAAAGTTTT CGGGAATATT TTTAACTCCG
  228661  TACATATAGC CCACAGGATT TTCCCATCCG TTTAAGTCAC TTAATTGTAT CCAATCTAAT
  228721  TGATCCTTAC GAATGGCATT AAGCCAAGCT TCTTGATTTT GATCTAATGA TACGGCTACA
  228781  ATTTCAAAAC CTTTAGCGTT GAATTCATGG TAAACTTTTC TTAATTCTGG ATTTAATTTT
  228841  TTACAGGGTA AACACCACGA AGCCCAAAAA TCAATTAGTG TATATTTCTT TTTTACATTT
  228901  GAAAAAGTAA TCGATTTTCC ATTGGAGTCA TTTTGTGTAA AATCAGTGAA TTGATCTCCT
  228961  TTTTTAGGGT TTTTACTTAA CTTAATAAAT GTGCCTATTA TTTTTCCGTA TTTTGAATTT
  229021  TTGGTTAGCT CATTAGCTTT GTTATATGAT TTGCTAATAA TACGCTTTTA ATATAAATAT
  229081  TTCGTATATT TAAGGATGCC AAAATCATCT ACTCT
//