Dbfetch

LOCUS       NS_000193               5701 bp    DNA     circular ENV 28-FEB-2013
DEFINITION  Uncultured Termite group 1 bacterium phylotype Rs-D17 plasmid
            pTGRD2 DNA, complete sequence.
ACCESSION   NS_000193
VERSION     NS_000193.1  GI:189485775
DBLINK      Project: 59059
            BioProject: PRJNA59059
KEYWORDS    ENV; RefSeq; isolate genome.
SOURCE      uncultured Termite group 1 bacterium phylotype Rs-D17
  ORGANISM  uncultured Termite group 1 bacterium phylotype Rs-D17
            Bacteria; Elusimicrobia; environmental samples.
REFERENCE   1
  AUTHORS   Hongoh,Y., Sharma,V.K., Prakash,T., Noda,S., Taylor,T.D., Kudo,T.,
            Sakaki,Y., Toyoda,A., Hattori,M. and Ohkuma,M.
  TITLE     Complete genome of the uncultured Termite Group 1 bacteria in a
            single host protist cell
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 105 (14), 5555-5560 (2008)
   PUBMED   18391199
REFERENCE   2  (bases 1 to 5701)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2008) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5701)
  AUTHORS   Toyoda,A., Hongoh,Y., Sharma,V.K., Hattori,M., Ohkuma,M. and
            Sakaki,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-OCT-2007) Contact:Yuichi Hongoh RIKEN, Ecomolecular
            Biorecycling Science Research Team; Hirosawa 2-1, Wako, Saitama
            351-0198, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AP009512.
            [WARNING] On Feb 28, 2013 this sequence was replaced by
            gi:455743332.
            The wood-feeding termite Reticulitermes speratus (Isoptera;
            Rhinotermitidae) was collected in Saitama, Japan. The entire gut
            was removed from a worker termite, and a single cell of the
            cellulolytic protist Trichonympha agilis (Parabasalia;
            Trichonymphida) in the gut was physically isolated by using a
            micromanipulator. In order to collect the intracellular symbionts
            of T. agilis, as-yet-uncultivated bacteria designated phylotype
            Rs-D17 belonging to the candidate division Termite Group 1, the
            host T. agilis cell was ruptured in buffer and bacterial cells
            which leaked out were collected with a glass capillary. These
            collected cells were directly subjected to isothermal whole genome
            amplification. After checking their purity by clone analysis of 16S
            rRNA gene and its adjacent ITS, the complete genome sequence was
            determined using ABI 3730 capillary sequencers and a GS20 system.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5701
                     /organism="uncultured Termite group 1 bacterium phylotype
                     Rs-D17"
                     /mol_type="genomic DNA"
                     /isolation_source="a single cell of termite
                     (Reticulitermes speratus) gut protist"
                     /host="Trichonympha agilis"
                     /db_xref="taxon:471821"
                     /environmental_sample
                     /plasmid="pTGRD2"
                     /note="rRNA phylotype Rs-D17"
     gene            1..1254
                     /locus_tag="TGRD_P2-1"
                     /db_xref="GeneID:6372915"
     CDS             1..1254
                     /locus_tag="TGRD_P2-1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001956715.1"
                     /db_xref="GI:189485776"
                     /db_xref="GeneID:6372915"
                     /translation="MWNEIITELKEKIPTEWLEPIKEESFKDDILTLAVPDTYYAQKY
                     ETDYKPLIQNILKAKTGKAVGLQFQIVASKLLAEPVIKDEKPKTQLMKKTKFNGKPYF
                     ENPAEFVSIAKAASQVKETDIKNAELTSMPNKYGITNVASFSLLDSKFFTYPNDKRKK
                     TKVEMPVRFSNGVVKVYNLYRGQFAINDNGYGQLTTTHAKIFFAIIHIWQKQNSRYAD
                     NKGFYAVVDISMRELAKQLGYQKVSGADYRRLLQRVKELVDFPMILSDGRVAHTFTFL
                     NSAIGRTVHQSGKNKLMLRLTLNPFISKQFYERNVILRNPQCYKIKNPTAFKFLLCYD
                     KRVVKGNNLKLNIYEVANDLELNISKLCHGVSVLKVAFRELNGYELNDSYRLYVELVK
                     EEREWIVIAERISKEKQQPLKALLA"
     gene            2656..4302
                     /locus_tag="TGRD_P2-2"
                     /db_xref="GeneID:6372916"
     CDS             2656..4302
                     /locus_tag="TGRD_P2-2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001956716.1"
                     /db_xref="GI:189485777"
                     /db_xref="GeneID:6372916"
                     /translation="MKLKKALCVYLTIVLFLTGCENLKSQIRGNQNTVASADQPTGDI
                     IKSDNSGIIEKQKEKESDLKKIENNVDNPNGDNGGDNNGDNPNGDNGGDNPNGDNGGD
                     NNGDSSQHKSSSEANGKDLRGWLWDHKGSISGIVLASAVVIGAIGFWGGQPNVCAVNY
                     FYVPQAVQENQAQVQVPAVQENQAQVQVPAVQENQAQVQVPAVQENQAQVQVPAVQEN
                     QAQVQVPAVQENQAQVQVPAVQENQAQVQVPAVQENQAQVQVPAVQENQAQVQVPAVQ
                     GNQNPNLVYFDIHSGRYIPGNQNPNLVYFDIHSGRYIPIVRGNPNPILVVQGNLYQVQ
                     GNESPFPVLLVEENQVQVPAVQELPSQQQLQRIQNRLDQLQGQLRNLESHAIFQFQQI
                     QVEAEALQLHNEQYIQLIGSIVDDPLYPQLNLQFQQICQILRHSHSLQLYDIGFHIFL
                     MREILDHHLHLTARNLPDVYGPPPRWEALRVQEQLERHNQQLNQLYQQIEGRLVIEQS
                     VLGARPDSQQRQQELREFNELAIQLQEHQRRIEALLKWLI"
     gene            4708..5229
                     /locus_tag="TGRD_P2-3"
                     /db_xref="GeneID:6372917"
     CDS             4708..5229
                     /locus_tag="TGRD_P2-3"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001956717.1"
                     /db_xref="GI:189485778"
                     /db_xref="GeneID:6372917"
                     /translation="MTAVKFKKIFAVILMLSVFLSGCQRQVITGVSKNENDVSTSTNT
                     PVPEPTPTPTPAPEPTPTPTPVPEPTPTPTPVPEPTPTPTPVPEPTPTPTPVPEPTPT
                     PTPVPEPTPAFMDCFPKYEAPLSTPAPLDEDDYYDNRVKWALSHVDDDGNWVNGKHSE
                     APKCLLVDYYNKF"
ORIGIN      
        1 gtgtggaatg aaatcattac agaattaaaa gaaaaaatac cgactgaatg gcttgaacca
       61 ataaaagagg aaagctttaa agacgatata ttaacgcttg ctgttcctga tacatattat
      121 gctcaaaagt atgaaaccga ttataaacca ttaattcaaa atatactaaa agcaaaaaca
      181 ggcaaagccg tcggcttgca atttcaaatt gttgcttcta aattactggc agagcctgtt
      241 ataaaagacg aaaagccaaa aacgcaatta atgaaaaaaa cgaagtttaa cggcaagcca
      301 tattttgaaa atcctgcgga gtttgtctca attgcaaaag ccgcaagtca ggtaaaagag
      361 acagatatta aaaatgccga attaacttca atgcctaata aatatggcat aactaatgtt
      421 gcttctttca gtttgcttga tagtaagttt tttacttatc cgaatgataa aaggaaaaaa
      481 acgaaagttg aaatgcctgt aaggtttagt aatggtgttg ttaaggtata taatttgtat
      541 cgagggcaat tcgctattaa cgataatggt tatggtcagt tgacaactac gcacgcaaaa
      601 atattttttg cgattattca tatatggcaa aagcagaata gcagatatgc tgataataag
      661 ggcttttatg cagttgttga tatttcaatg cgggaacttg caaagcagtt gggttatcaa
      721 aaagtaagcg gagctgatta ccgcagatta ttgcaaagag ttaaagagct ggttgatttt
      781 cctatgatac tttcagacgg acgtgttgct catactttta cttttttgaa tagtgctatt
      841 ggtcgtactg ttcatcaaag cggaaagaat aaattaatgc taagacttac tcttaatcct
      901 tttatttcaa aacaatttta cgaaagaaat gtcattttaa gaaatcctca atgctataag
      961 attaaaaatc ctaccgcttt taaattcttg ttatgttatg ataaaagagt agttaaaggt
     1021 aataacttaa aattaaatat atatgaagtt gcgaatgatt tggaattaaa tatatctaag
     1081 ctttgtcacg gagtttctgt gttaaaagtt gcatttcgtg agttaaatgg atacgaactt
     1141 aacgatagtt atcgcttgta tgtagaatta gttaaagagg aaagggaatg gattgtcatt
     1201 gctgaacgta tctcaaaaga aaaacaacaa ccattaaaag cgttattagc ttaactgcag
     1261 aactgacata gaatgcgaag cataagagga gcgaagctcc gtgcttgtag ttgtctttcc
     1321 tctcttaaaa gcctgccttt taaaaaagct caaatctaaa agtaaaaata gtcatattaa
     1381 acattgtcta aaatcttgtc tttaaaaaac aatgaaaaaa atctgttgtc gttgatgttc
     1441 tctggaacac ccttgaggct gttcagtaga agtagcggta ttcccgctta tttattgtct
     1501 tgtctttaaa atctattctg tttactgtta aaacgtaaaa aacgattaaa aatcgtaaaa
     1561 actgcgttaa aggcacgctg gtgcctcaaa taacgcaaaa cagacgttcg ctggcataat
     1621 agccattaaa aacatcttaa aatgtcaaaa tatgccaata ttatgccaaa ataaggcatt
     1681 atcacatagt ctaaagcctt aaataaaaca aaataaaaaa aataaaaaag gctaaatgac
     1741 tgtgataagc cttgaaaagc ttgtaaaagc taaaaaaaac ggatgtaaat ccgtcagacg
     1801 gactgtaaaa aagagctggc taaaactaaa gccagcgata aagcgtgcgt ataaagactt
     1861 gattgtatta gcacgctgtc cacattgttt ttgattgttg tgaaaaaatg tgggaaaaaa
     1921 cttatgtttt aaaatgtaaa agattggtaa aaaaaaatat tggaaagtct ctaaaaggtg
     1981 ataactgatt gtttaatact agtacttgaa aaacgcaata aaatgcgttc cagcctgtct
     2041 ttaaaatcta atctctaaaa taatataagc ctatgattaa atattatagg cgtttcaaat
     2101 tgctccttct tgatatgcaa ttgggacgtt gtctcttttt gctttaatat gcaattggct
     2161 gactgacaac aaaataataa cgatagttta tgaaagcgta aaaagctaag acgttatgat
     2221 aatgcttagt cgctgttgta aatatgtcta aaaatttatt atatatttat aggcttgcac
     2281 gacatttaga taacgtctgt gatgtataaa tagtcaaaag ccgtcttaaa gtagacggca
     2341 aaaataaaca aaaaatgagc gaagcgaaca ccctctatac ttgatataca tatatgctac
     2401 gtggcgacaa aaagagccgt aaaaagttat aaaataataa ttactttctt aatcgttttc
     2461 agctgaaaac gaaacagtat aaacttgata tactatatgc tagttgcaga caaaaaaaaa
     2521 tgaaaaaaag attaagaaaa aaagtgaaaa aaattcagcc ccaaaaatag acccgaataa
     2581 aacttatctg ctttgttata caaacttacc ttgagataca cacaaaaaaa tatctggaca
     2641 gtttaaagaa aaaaaatgaa attgaaaaaa gctttatgcg tatatttaac gattgttctg
     2701 tttttgacag gctgtgaaaa tcttaaaagc cagataagag gcaatcagaa tactgtcgct
     2761 tctgccgacc agccgacagg cgatattata aaaagcgata atagtggaat aattgaaaag
     2821 cagaaagaaa aagagtcaga tttaaaaaaa atagagaata atgtcgataa tccaaatggt
     2881 gataacggtg gcgataataa tggcgataat ccaaatggtg ataacggtgg cgataatcca
     2941 aatggtgata acggtggcga taataatggc gatagtagtc aacacaaatc gtccagcgaa
     3001 gcgaatggaa aagatttaag aggatggtta tgggatcata aaggaagtat ttcaggtata
     3061 gtattagcga gtgcggtagt tataggtgcg ataggatttt ggggtggaca accaaatgtt
     3121 tgcgcagtta attactttta tgttccccaa gcagttcagg aaaatcaagc ccaagttcaa
     3181 gttccagcag ttcaggaaaa tcaagcccaa gttcaagttc cagcagttca ggaaaatcaa
     3241 gctcaagttc aagttccagc agttcaggaa aatcaagctc aagttcaagt tccagcagtt
     3301 caggaaaatc aagctcaagt tcaagttcca gcagttcagg aaaatcaagc tcaagttcaa
     3361 gttccagcag ttcaggaaaa tcaagcccaa gttcaagttc cagcagttca ggaaaatcaa
     3421 gctcaagttc aagttccagc agttcaggaa aatcaagccc aagttcaagt tccagcagtt
     3481 cagggaaatc aaaacccaaa tctagtttat tttgacatcc acagcggcag atatattcca
     3541 ggaaatcaaa acccaaatct agtttatttt gacatccaca gcggcagata tattccaata
     3601 gttcggggaa atccaaaccc aattctagta gttcagggaa atctatacca agttcaggga
     3661 aatgaaagcc catttccagt tctactagtt gaggaaaatc aagttcaagt tccagcagtt
     3721 caggaactac catcacaaca acaacttcaa cgaatacaaa atcgactaga tcaactacaa
     3781 ggacaattac gaaatttaga atctcatgca atttttcaat ttcaacaaat tcaggtagag
     3841 gcagaggcat tgcagctaca caatgaacaa tacattcagc tcattggatc tatagttgat
     3901 gacccacttt atccgcaact aaacttacaa ttccagcaaa tatgtcaaat actgcgacac
     3961 agccattccc tccaattata tgatattgga tttcatatat ttttaatgcg tgaaatactc
     4021 gaccaccacc tacacctaac cgcccgaaac ctacctgatg tttatggacc ccctccacga
     4081 tgggaagcac tgagagtaca ggaacaactt gaacgacaca atcaacaact aaaccaacta
     4141 taccaacaaa tagaaggcag attagttatc gaacagagtg tgctaggagc tcgccccgat
     4201 tcccaacaac gccaacaaga gctaagggaa tttaatgaac tagctattca actgcaagaa
     4261 caccagcgac gtatagaagc attattgaag tggcttatat aaagcgaaaa ataaaaaaga
     4321 atttgattac tgtgaaaacg atatgcgtca tactgctgac gctctaaaac tttgaaaaat
     4381 atttgttcaa atagtatccg tatcagcaag gatacaggca ttataactct tacttgacta
     4441 tataatgccc atccgtacca cctttgaggc aaaaaatgca cccacgttta gaccctgcaa
     4501 aaatatattt agtccagtca aatagtgata attctcttaa tctggaggca gagatattct
     4561 tatgaaaaaa actgataata aagataataa agataaaccc ataggaaatg catttcctat
     4621 taacaatccg tttagaagtt ctagaactgt tcaaaaagct ttaaaaataa ttaataaaaa
     4681 agttgttaaa aaagattaaa tgaggatatg actgcagtga aatttaaaaa aatatttgct
     4741 gtgattttaa tgttgtctgt gttcttgtct ggctgtcaga ggcaggttat aacaggcgtt
     4801 tctaaaaatg aaaatgatgt ttcaacttca acgaatactc ctgttccaga gcctactcct
     4861 actccgactc ctgctccaga gcctactcct actccgactc ctgttccaga gcctactcct
     4921 actccgactc ctgttccaga gcctactcct actccgactc ctgttccaga gcctactcct
     4981 actccgactc ctgttccaga gcctactcct actccgactc ctgttccaga gcctactcct
     5041 gcctttatgg attgtttccc taaatatgaa gccccattgt ctactcctgc tccattggat
     5101 gaggatgatt attatgataa cagggtaaaa tgggctctat cgcacgttga tgatgatggt
     5161 aactgggtta atggtaagca ttccgaagct cctaagtgct tgttagtaga ctattacaat
     5221 aagttttaaa aataaggtaa gctttccgaa gctcctaagc gcttgttatt attaaaggat
     5281 ttgtaatttt cagcgtctac tcctgctcct acttcaccat agagattacg tctcaagaca
     5341 aactcaatta attattaagt tataaattat gaaaaagctt gcataaatgc aggctctttt
     5401 ttttgtgttg acttaaacgt tagtcctttg ttagtatatg tgtttctatg tgctgataca
     5461 cgtgtttcta tgtgctgata cacgtgtttc tatgtgctga tacacgtgtt tctatgtgct
     5521 gatacacgtg tttctatgtg ctgatttttt gaaaaaagtg gctataaata aggattgggc
     5581 ttactctcta tttctaacta ctctattact actatgtctg cctaaagtct ggcagacaat
     5641 tttctttttg aaattttaaa agataaaaaa gacaaaaaac caaagaaata aaggataaaa
     5701 a
//