spacer

EBI Dbfetch

LOCUS       NC_020421               5701 bp    DNA     circular CON 18-DEC-2014
DEFINITION  Uncultured Termite group 1 bacterium phylotype Rs-D17 plasmid
            pTGRD2 DNA, complete sequence.
ACCESSION   NC_020421 NS_000193
VERSION     NC_020421.1  GI:455743332
DBLINK      BioProject: PRJNA59059
KEYWORDS    ENV; RefSeq.
SOURCE      uncultured Termite group 1 bacterium phylotype Rs-D17
  ORGANISM  uncultured Termite group 1 bacterium phylotype Rs-D17
            Bacteria; Elusimicrobia; environmental samples.
REFERENCE   1
  AUTHORS   Hongoh,Y., Sharma,V.K., Prakash,T., Noda,S., Taylor,T.D., Kudo,T.,
            Sakaki,Y., Toyoda,A., Hattori,M. and Ohkuma,M.
  TITLE     Complete genome of the uncultured Termite Group 1 bacteria in a
            single host protist cell
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 105 (14), 5555-5560 (2008)
   PUBMED   18391199
REFERENCE   2  (bases 1 to 5701)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (28-FEB-2013) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5701)
  AUTHORS   Toyoda,A., Hongoh,Y., Sharma,V.K., Hattori,M., Ohkuma,M. and
            Sakaki,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-OCT-2007) Contact:Yuichi Hongoh RIKEN, Ecomolecular
            Biorecycling Science Research Team; Hirosawa 2-1, Wako, Saitama
            351-0198, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP009512.
            On Feb 28, 2013 this sequence version replaced gi:189485775.
            The wood-feeding termite Reticulitermes speratus (Isoptera;
            Rhinotermitidae) was collected in Saitama, Japan. The entire gut
            was removed from a worker termite, and a single cell of the
            cellulolytic protist Trichonympha agilis (Parabasalia;
            Trichonymphida) in the gut was physically isolated by using a
            micromanipulator. In order to collect the intracellular symbionts
            of T. agilis, as-yet-uncultivated bacteria designated phylotype
            Rs-D17 belonging to the candidate division Termite Group 1, the
            host T. agilis cell was ruptured in buffer and bacterial cells
            which leaked out were collected with a glass capillary. These
            collected cells were directly subjected to isothermal whole genome
            amplification. After checking their purity by clone analysis of 16S
            rRNA gene and its adjacent ITS, the complete genome sequence was
            determined using ABI 3730 capillary sequencers and a GS20 system.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5701
                     /organism="uncultured Termite group 1 bacterium phylotype
                     Rs-D17"
                     /mol_type="genomic DNA"
                     /isolation_source="a single cell of termite
                     (Reticulitermes speratus) gut protist"
                     /host="Trichonympha agilis"
                     /db_xref="taxon:471821"
                     /environmental_sample
                     /plasmid="pTGRD2"
                     /note="rRNA phylotype Rs-D17"
     gene            1..1254
                     /locus_tag="TGRD_P2-1"
                     /db_xref="GeneID:6372915"
     CDS             1..1254
                     /locus_tag="TGRD_P2-1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001956715.1"
                     /db_xref="GI:189485776"
                     /db_xref="GeneID:6372915"
                     /translation="MWNEIITELKEKIPTEWLEPIKEESFKDDILTLAVPDTYYAQKY
                     ETDYKPLIQNILKAKTGKAVGLQFQIVASKLLAEPVIKDEKPKTQLMKKTKFNGKPYF
                     ENPAEFVSIAKAASQVKETDIKNAELTSMPNKYGITNVASFSLLDSKFFTYPNDKRKK
                     TKVEMPVRFSNGVVKVYNLYRGQFAINDNGYGQLTTTHAKIFFAIIHIWQKQNSRYAD
                     NKGFYAVVDISMRELAKQLGYQKVSGADYRRLLQRVKELVDFPMILSDGRVAHTFTFL
                     NSAIGRTVHQSGKNKLMLRLTLNPFISKQFYERNVILRNPQCYKIKNPTAFKFLLCYD
                     KRVVKGNNLKLNIYEVANDLELNISKLCHGVSVLKVAFRELNGYELNDSYRLYVELVK
                     EEREWIVIAERISKEKQQPLKALLA"
     gene            2656..4302
                     /locus_tag="TGRD_P2-2"
                     /db_xref="GeneID:6372916"
     CDS             2656..4302
                     /locus_tag="TGRD_P2-2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001956716.1"
                     /db_xref="GI:189485777"
                     /db_xref="GeneID:6372916"
                     /translation="MKLKKALCVYLTIVLFLTGCENLKSQIRGNQNTVASADQPTGDI
                     IKSDNSGIIEKQKEKESDLKKIENNVDNPNGDNGGDNNGDNPNGDNGGDNPNGDNGGD
                     NNGDSSQHKSSSEANGKDLRGWLWDHKGSISGIVLASAVVIGAIGFWGGQPNVCAVNY
                     FYVPQAVQENQAQVQVPAVQENQAQVQVPAVQENQAQVQVPAVQENQAQVQVPAVQEN
                     QAQVQVPAVQENQAQVQVPAVQENQAQVQVPAVQENQAQVQVPAVQENQAQVQVPAVQ
                     GNQNPNLVYFDIHSGRYIPGNQNPNLVYFDIHSGRYIPIVRGNPNPILVVQGNLYQVQ
                     GNESPFPVLLVEENQVQVPAVQELPSQQQLQRIQNRLDQLQGQLRNLESHAIFQFQQI
                     QVEAEALQLHNEQYIQLIGSIVDDPLYPQLNLQFQQICQILRHSHSLQLYDIGFHIFL
                     MREILDHHLHLTARNLPDVYGPPPRWEALRVQEQLERHNQQLNQLYQQIEGRLVIEQS
                     VLGARPDSQQRQQELREFNELAIQLQEHQRRIEALLKWLI"
     gene            4708..5229
                     /locus_tag="TGRD_P2-3"
                     /db_xref="GeneID:6372917"
     CDS             4708..5229
                     /locus_tag="TGRD_P2-3"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_001956717.1"
                     /db_xref="GI:189485778"
                     /db_xref="GeneID:6372917"
                     /translation="MTAVKFKKIFAVILMLSVFLSGCQRQVITGVSKNENDVSTSTNT
                     PVPEPTPTPTPAPEPTPTPTPVPEPTPTPTPVPEPTPTPTPVPEPTPTPTPVPEPTPT
                     PTPVPEPTPAFMDCFPKYEAPLSTPAPLDEDDYYDNRVKWALSHVDDDGNWVNGKHSE
                     APKCLLVDYYNKF"
CONTIG      join(AP009512.1:1..5701)
//



spacer
spacer