Dbfetch

LOCUS       NM_000231               1661 bp    mRNA    linear   PRI 04-MAY-2017
DEFINITION  Homo sapiens sarcoglycan gamma (SGCG), mRNA.
ACCESSION   NM_000231
VERSION     NM_000231.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1661)
  AUTHORS   Spinazzola JM, Smith TC, Liu M, Luna EJ and Barton ER.
  TITLE     Gamma-sarcoglycan is required for the response of archvillin to
            mechanical stimulation in skeletal muscle
  JOURNAL   Hum. Mol. Genet. 24 (9), 2470-2481 (2015)
   PUBMED   25605665
  REMARK    GeneRIF: These results position archvillin as a mechanically
            sensitive component of the dystrophin complex and demonstrate that
            signaling defects caused by loss of gamma-SG occur both at the
            sarcolemma and in the nucleus.
REFERENCE   2  (bases 1 to 1661)
  AUTHORS   El Kerch F, Ratbi I, Sbiti A, Laarabi FZ, Barkat A and Sefiani A.
  TITLE     Carrier frequency of the c.525delT mutation in the SGCG gene and
            estimated prevalence of limb girdle muscular dystrophy type 2C
            among the Moroccan population
  JOURNAL   Genet Test Mol Biomarkers 18 (4), 253-256 (2014)
   PUBMED   24552312
  REMARK    GeneRIF: Molecular epidemiologic methods were used to calculate the
            frequency of heterozygotes for this SGCG mutation in Moroccan
            newborns and to estimate the prevalence of LGMD2C in the Moroccan
            population.
REFERENCE   3  (bases 1 to 1661)
  AUTHORS   DiCapua D and Patwa H.
  TITLE     Puerto Rican founder mutation G787A in the SGCG gene: a case report
            of 2 siblings with LGMD 2C
  JOURNAL   J Clin Neuromuscul Dis 15 (3), 105-107 (2014)
   PUBMED   24534832
  REMARK    GeneRIF: A report of two siblings with severe childhood onset
            limb-girdle muscular dystrophy type 2C supports the theory that the
            mutation G787A in the SGCG gene is a founder mutation.
REFERENCE   4  (bases 1 to 1661)
  AUTHORS   Saxena R, Saleheen D, Been LF, Garavito ML, Braun T, Bjonnes A,
            Young R, Ho WK, Rasheed A, Frossard P, Sim X, Hassanali N, Radha V,
            Chidambaram M, Liju S, Rees SD, Ng DP, Wong TY, Yamauchi T, Hara K,
            Tanaka Y, Hirose H, McCarthy MI, Morris AP, Basit A, Barnett AH,
            Katulanda P, Matthews D, Mohan V, Wander GS, Singh JR, Mehra NK,
            Ralhan S, Kamboh MI, Mulvihill JJ, Maegawa H, Tobe K, Maeda S, Cho
            YS, Tai ES, Kelly MA, Chambers JC, Kooner JS, Kadowaki T, Deloukas
            P, Rader DJ, Danesh J and Sanghera DK.
  CONSRTM   DIAGRAM; MuTHER; AGEN
  TITLE     Genome-wide association study identifies a novel locus contributing
            to type 2 diabetes susceptibility in Sikhs of Punjabi origin from
            India
  JOURNAL   Diabetes 62 (5), 1746-1755 (2013)
   PUBMED   23300278
  REMARK    GeneRIF: Data suggest that an SNP in an intron of SGCG (rs9552911)
            is associated with type 2 diabetes [Genome-Wide Association Study
            in Sikh populations in India & Meta-Analysis]
REFERENCE   5  (bases 1 to 1661)
  AUTHORS   Blandin G, Marchand S, Charton K, Daniele N, Gicquel E, Boucheteil
            JB, Bentaib A, Barrault L, Stockholm D, Bartoli M and Richard I.
  TITLE     A human skeletal muscle interactome centered on proteins involved
            in muscular dystrophies: LGMD interactome
  JOURNAL   Skelet Muscle 3 (1), 3 (2013)
   PUBMED   23414517
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1661)
  AUTHORS   Jung D, Leturcq F, Sunada Y, Duclos F, Tome FM, Moomaw C, Merlini
            L, Azibi K, Chaouch M, Slaughter C, Fardeau M, Kaplan JC and
            Campbell KP.
  TITLE     Absence of gamma-sarcoglycan (35 DAG) in autosomal recessive
            muscular dystrophy linked to chromosome 13q12
  JOURNAL   FEBS Lett. 381 (1-2), 15-20 (1996)
   PUBMED   8641426
REFERENCE   7  (bases 1 to 1661)
  AUTHORS   Noguchi S, McNally EM, Ben Othmane K, Hagiwara Y, Mizuno Y, Yoshida
            M, Yamamoto H, Bonnemann CG, Gussoni E, Denton PH, Kyriakides T,
            Middleton L, Hentati F, Ben Hamida M, Nonaka I, Vance JM, Kunkel LM
            and Ozawa E.
  TITLE     Mutations in the dystrophin-associated protein gamma-sarcoglycan in
            chromosome 13 muscular dystrophy
  JOURNAL   Science 270 (5237), 819-822 (1995)
   PUBMED   7481775
REFERENCE   8  (bases 1 to 1661)
  AUTHORS   Ben Othmane,K., Speer,M.C., Stauffer,J., Blel,S., Middleton,L., Ben
            Hamida,C., Etribi,A., Loeb,D., Hentati,F., Roses,A.D. et al.
  TITLE     Evidence for linkage disequilibrium in chromosome 13-linked
            Duchenne-like muscular dystrophy (LGMD2C)
  JOURNAL   Am. J. Hum. Genet. 57 (3), 732-734 (1995)
   PUBMED   7668303
REFERENCE   9  (bases 1 to 1661)
  AUTHORS   Jorde LB, Watkins WS, Viskochil D, O'Connell P and Ward K.
  TITLE     Linkage disequilibrium in the neurofibromatosis 1 (NF1) region:
            implications for gene mapping
  JOURNAL   Am. J. Hum. Genet. 53 (5), 1038-1050 (1993)
   PUBMED   8105688
REFERENCE   10 (bases 1 to 1661)
  AUTHORS   Pegoraro,E. and Hoffman,E.P.
  TITLE     Limb-Girdle Muscular Dystrophy Overview
  JOURNAL   (in) Pagon RA, Adam MP, Ardinger HH, Wallace SE, Amemiya A, Bean
            LJH, Bird TD, Fong CT, Mefford HC, Smith RJH and Stephens K (Eds.);
            GENEREVIEWS(R);
            (1993)
   PUBMED   20301582
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL356287.16, DA897096.1,
            BC074778.2 and U34976.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Oct 16, 2008 this sequence version replaced NM_000231.1.

            Summary: This gene encodes gamma-sarcoglycan, one of several
            sarcolemmal transmembrane glycoproteins that interact with
            dystrophin. The dystrophin-glycoprotein complex (DGC) spans the
            sarcolemma and is comprised of dystrophin, syntrophin, alpha- and
            beta-dystroglycans and sarcoglycans. The DGC provides a structural
            link between the subsarcolemmal cytoskeleton and the extracellular
            matrix of muscle cells. Defects in the encoded protein can lead to
            early onset autosomal recessive muscular dystrophy, in particular
            limb-girdle muscular dystrophy, type 2C (LGMD2C). [provided by
            RefSeq, Oct 2008].

            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.

            ##Evidence-Data-START##
            Transcript exon combination :: U34976.1, ERR279837.528.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2142680, SAMEA2147596
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-84                AL356287.16        145490-145573
            85-651              DA897096.1         1-567
            652-1059            BC074778.2         539-946
            1060-1661           U34976.1           1029-1630
FEATURES             Location/Qualifiers
     source          1..1661
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="13"
                     /map="13q12.12"
     gene            1..1661
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /note="sarcoglycan gamma"
                     /db_xref="GeneID:6445"
                     /db_xref="HGNC:HGNC:10809"
                     /db_xref="HPRD:07039"
                     /db_xref="MIM:608896"
     exon            1..155
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       1
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:970716548"
     variation       5
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1005695823"
     variation       14
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:551607827"
     variation       19
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1015017073"
     variation       25
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:963430387"
     variation       31
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050064"
     variation       38
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050065"
     STS             41..1123
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /db_xref="UniSTS:489652"
     variation       46
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:566634080"
     variation       54
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:919755726"
     variation       61
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1038134233"
     variation       68
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4770403"
     misc_feature    72..74
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /note="upstream in-frame stop codon"
     variation       72
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1012623683"
     variation       100
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:540247673"
     variation       109
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:912262993"
     variation       112
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:971370821"
     STS             113..1059
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /db_xref="UniSTS:481904"
     variation       116
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1041997854"
     variation       121
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372088302"
     variation       129
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748425791"
     variation       150
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141771521"
     CDS             156..1031
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /note="35kD dystrophin-associated glycoprotein; 35 kDa
                     dystrophin-associated glycoprotein; sarcoglycan, gamma
                     (35kDa dystrophin-associated glycoprotein)"
                     /codon_start=1
                     /product="gamma-sarcoglycan"
                     /protein_id="NP_000222.1"
                     /db_xref="CCDS:CCDS9299.1"
                     /db_xref="GeneID:6445"
                     /db_xref="HGNC:HGNC:10809"
                     /db_xref="HPRD:07039"
                     /db_xref="MIM:608896"
                     /translation="MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLL
                     IILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSS
                     LLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVV
                     GTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKI
                     EALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSV
                     AGVSTTCQEHSHICL"
     misc_feature    243..989
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /note="Sarcoglycan complex subunit protein; Region:
                     Sarcoglycan_1; pfam04790"
                     /db_xref="CDD:282624"
     misc_feature    267..329
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q13326.4);
                     transmembrane region"
     exon            156..350
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       162
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140310896"
     variation       163
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35105771"
     variation       167
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768187079"
     variation       169
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:754055956"
     variation       172
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148041867"
     variation       174
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747860532"
     variation       177
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771657671"
     variation       181
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773575178"
     variation       182
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764748199"
     variation       189
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761027747"
     variation       201
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:546543109"
     variation       202
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020872078"
     variation       207
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:759576122"
     variation       211
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765392154"
     variation       212
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752669226"
     variation       213
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763248287"
     variation       221
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376410504"
     variation       232
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886043151"
     variation       236
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202078221"
     variation       237
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:999585272"
     variation       239
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1031067187"
     variation       241..242
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:762777463"
     variation       249
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76916029"
     variation       251
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780186997"
     variation       253
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753775490"
     variation       254
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778502285"
     variation       255
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747549369"
     variation       256
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:755404457"
     variation       257
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140810408"
     variation       259
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:771255124"
     variation       260
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:760108586"
     variation       265
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770141199"
     variation       266
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775643720"
     variation       267
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1800349"
     variation       273
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764468720"
     variation       275
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1022001256"
     variation       288
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751808758"
     variation       292
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1019389043"
     variation       297
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369936288"
     variation       298
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754949325"
     variation       312
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138880406"
     variation       313
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781760379"
     variation       316
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:886043940"
     variation       321
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373083509"
     variation       327
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752310028"
     variation       330
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:546376689"
     variation       335
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:919571338"
     variation       336
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:886044348"
     variation       345
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886042587"
     exon            351..452
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       352
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:752603127"
     variation       355
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:931778619"
     variation       367
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143009120"
     variation       372
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763619480"
     variation       383
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1800350"
     variation       385
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:886043950"
     variation       388
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886044067"
     variation       390
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148404730"
     variation       391
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375766013"
     variation       392
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201144588"
     variation       408
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867655487"
     variation       411
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:746238964"
     variation       422
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149595403"
     variation       425
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368524463"
     variation       430
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:886044395"
     variation       435
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867039495"
     variation       443
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:957838468"
     variation       446
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749843245"
     variation       449
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769234531"
     exon            453..540
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       457
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886042370"
     variation       458
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:144277094"
     variation       459
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201683351"
     variation       462
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754191351"
     variation       465
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:918581161"
     variation       467
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1800351"
     variation       470
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779550455"
     variation       473
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371622125"
     variation       475
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772017929"
     variation       476
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:777873668"
     variation       479
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:747220624"
     variation       481
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201514102"
     variation       488
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775265377"
     variation       490
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:570169794"
     variation       499
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774245371"
     variation       500
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1800352"
     variation       501
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191040430"
     variation       502
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17314986"
     variation       507
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766126721"
     variation       509..510
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:772566132"
     variation       509
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376184429"
     variation       515
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755373825"
     variation       516
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1013988350"
     variation       526
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:183204936"
     variation       533
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753180283"
     variation       534
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:368149615"
     variation       538
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1000108142"
     variation       539
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777732200"
     variation       540
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:747046381"
     exon            541..660
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       541
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:866412938"
     variation       547
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:544414698"
     variation       551
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756280402"
     variation       553
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778691463"
     variation       554
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747909634"
     variation       560
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771962643"
     variation       562
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:569816696"
     variation       566
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:886044394"
     variation       569
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770596449"
     variation       575
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:776236052"
     variation       578
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759278850"
     variation       583
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369818411"
     variation       587
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775787536"
     variation       590
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35628352"
     variation       591
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373442790"
     variation       593
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144497243"
     variation       594
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374836520"
     variation       595
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767605031"
     variation       596
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750443730"
     variation       605
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369191957"
     variation       607..613
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="ttactgt"
                     /db_xref="dbSNP:886042540"
     variation       610
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201329880"
     variation       611
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1047364666"
     variation       621
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181210672"
     variation       626
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:527236657"
     variation       634
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:527562042"
     variation       637
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746969527"
     variation       640
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770939408"
     variation       652
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776289036"
     variation       656
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:560640452"
     exon            661..733
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       662
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199905729"
     variation       669
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:745417608"
     variation       670
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769313305"
     variation       672
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886042216"
     variation       677
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146679977"
     variation       680
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:786204786"
     variation       681
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768134426"
     variation       684
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375592456"
     variation       688
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1011397929"
     variation       690
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139072866"
     variation       693
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1017891625"
     variation       694
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:114160429"
     variation       713
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766503990"
     variation       714
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886042075"
     variation       718
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753806016"
     variation       719
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367595212"
     variation       723
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751460849"
     exon            734..857
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       736
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:547818652"
     variation       751
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200191311"
     variation       754
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:886043860"
     variation       770
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142409090"
     variation       778
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778119056"
     variation       780
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:563129062"
     variation       783
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:368027244"
     variation       784
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045567625"
     variation       791
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:794727841"
     variation       795
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776984717"
     variation       797
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:528994151"
     variation       798
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770020910"
     variation       800
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:763278303"
     variation       808
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202045534"
     variation       810
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375904616"
     variation       811
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760374955"
     variation       812
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368393587"
     variation       814
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753751942"
     variation       815
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:550268354"
     variation       819
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764741894"
     variation       825
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372188878"
     variation       827
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866525494"
     variation       845
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:875989949"
     variation       855
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:930166092"
     exon            858..1655
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       858
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763780768"
     variation       860
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1800353"
     variation       861
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201788230"
     variation       862
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:571481056"
     variation       863
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:899136360"
     variation       868
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750729655"
     variation       871
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149086397"
     variation       873
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780692038"
     variation       878..879
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:758078849"
     variation       879
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749427753"
     variation       890..891
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:797044783"
     variation       890
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373785384"
     variation       892
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377625551"
     variation       904
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:906499060"
     variation       906
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201535503"
     variation       907
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:886042749"
     variation       908
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748332364"
     variation       933
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:772271813"
     variation       939
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776357413"
     variation       940
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:756205136"
     variation       941
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759316719"
     variation       942
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:104894423"
     variation       947
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377620885"
     variation       948..949
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:780348174"
     variation       953
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775379604"
     variation       955
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762840469"
     variation       956
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763531562"
     variation       958
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143110015"
     variation       961
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761374184"
     variation       963
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767191084"
     variation       976
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750873881"
     variation       977
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756522501"
     variation       979
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780747031"
     variation       980..981
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:747378865"
     variation       980
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754426701"
     variation       986
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754112406"
     variation       987
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147820869"
     variation       988
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748255972"
     variation       997
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1022230625"
     variation       1000
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758609187"
     variation       1001
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778036404"
     variation       1003
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:104894422"
     variation       1010
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370309494"
     variation       1015
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1800354"
     variation       1033
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749232488"
     variation       1036
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:975086956"
     variation       1039
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779893866"
     variation       1040
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746787386"
     variation       1041
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139369964"
     variation       1044
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9510701"
     variation       1046
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:967653643"
     variation       1047
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772968140"
     variation       1048
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:576170697"
     variation       1049
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766863622"
     variation       1051
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754189409"
     variation       1065
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:755504994"
     variation       1066
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765762699"
     variation       1067
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752771653"
     variation       1069
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777795087"
     variation       1073
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747258249"
     variation       1074
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757409780"
     variation       1075
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:940862421"
     variation       1084
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:188804783"
     variation       1085
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193022162"
     STS             1101..1314
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /standard_name="SGC35673"
                     /db_xref="UniSTS:27907"
     variation       1102
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:981431209"
     variation       1108
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948028478"
     variation       1116
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752275191"
     variation       1123
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045031542"
     variation       1132
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:75252896"
     variation       1140
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036298862"
     variation       1144..1158
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="ccagaggaactcaga"
                     /db_xref="dbSNP:149533619"
     variation       1157..1158
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:768400344"
     variation       1163
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:898952977"
     variation       1164
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:906553672"
     variation       complement(1167)
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3751372"
     variation       1176
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150043089"
     variation       1177..1178
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:539058397"
     variation       1182
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771415928"
     STS             1198..1421
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /standard_name="STS-U34976"
                     /db_xref="UniSTS:28147"
     variation       1198
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145339454"
     variation       1199
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:892267023"
     variation       1202
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774709300"
     variation       1216
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115918628"
     variation       1228
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:899735714"
     variation       1252
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:561080982"
     variation       1253
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:531811585"
     variation       1269
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:996787534"
     variation       complement(1285)
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3751371"
     variation       1295
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:955250065"
     variation       1296
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:540325559"
     variation       1311
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:982516817"
     variation       1312
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:571413005"
     variation       1320
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:962213783"
     variation       1322
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373623927"
     variation       complement(1326)
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3829352"
     variation       1327
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115862132"
     variation       1333
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:78718194"
     variation       1338
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:971481983"
     variation       1340
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377364360"
     variation       1341
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554587798"
     variation       1361
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:927982067"
     variation       1362
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:981504595"
     variation       1373
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:569677682"
     variation       1380
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1052492553"
     variation       1381
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:537146298"
     variation       1382
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:946810360"
     variation       1415
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:972356120"
     variation       1416
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:920554812"
     variation       1428
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556520681"
     variation       1432
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:899706364"
     variation       1448
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754059266"
     variation       1456
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:578125920"
     variation       1460
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1029999664"
     variation       1461
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:944417351"
     variation       1472
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757405955"
     variation       1484
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:890758131"
     variation       1503
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:545243799"
     variation       1508
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1004305255"
     variation       1509
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:184625354"
     variation       1512..1513
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="aagt"
                     /db_xref="dbSNP:886050066"
     variation       1522
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:962763243"
     variation       1528
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:572390899"
     variation       1534
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:973817578"
     variation       1536
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7329620"
     variation       1542
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372148320"
     variation       1560
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:969565273"
     variation       1577
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41283956"
     variation       1592
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1055114525"
     variation       1602..1607
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="attaaa"
                     /db_xref="dbSNP:886050067"
     variation       1604
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:928211080"
     variation       1608
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:939336114"
     variation       1614
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1013488242"
     variation       1618
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:988531933"
     variation       1626
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1023059669"
     regulatory      1631..1636
                     /regulatory_class="polyA_signal_sequence"
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
     variation       1643
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147879467"
     variation       1649
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754763205"
     polyA_site      1655
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
ORIGIN
       1  GAAACTCGTG AGAGCCCTTT CTCCAGGGAC AGTTGCTGAA GCTTCATCCT TTGCTCTCAT
      61  TCTGTAAGTC ATAGAAAAGT TTGAAACATT CTGTCTGTGG TAGAGCTCGG GCCAGCTGTA
     121  GTTCATTCGC CAGTGTGCTT TTCTTAATAT CTAAGATGGT GCGTGAGCAG TACACTACAG
     181  CCACAGAAGG CATCTGCATA GAGAGGCCAG AGAATCAGTA TGTCTACAAA ATTGGCATTT
     241  ATGGCTGGAG AAAGCGCTGT CTCTACTTGT TTGTTCTTCT TTTACTCATC ATCCTCGTTG
     301  TGAATTTAGC TCTTACAATT TGGATTCTTA AAGTGATGTG GTTTTCTCCA GCAGGAATGG
     361  GCCACTTGTG TGTAACAAAA GATGGACTGC GCTTGGAAGG GGAATCAGAA TTTTTATTCC
     421  CATTGTATGC CAAAGAAATA CACTCCAGAG TGGACTCATC TCTGCTTCTA CAATCAACCC
     481  AGAATGTGAC TGTAAATGCG CGCAACTCAG AAGGGGAGGT CACAGGCAGG TTAAAAGTCG
     541  GTCCCAAAAT GGTAGAAGTC CAGAATCAAC AGTTTCAGAT CAACTCCAAC GACGGCAAGC
     601  CACTATTTAC TGTAGATGAG AAGGAAGTTG TGGTTGGTAC AGATAAACTT CGAGTAACTG
     661  GGCCTGAAGG GGCTCTTTTT GAACATTCAG TGGAGACACC CCTTGTCAGA GCCGACCCGT
     721  TTCAAGACCT TAGATTAGAA TCCCCCACTC GGAGTCTAAG CATGGATGCC CCAAGGGGTG
     781  TGCATATTCA AGCTCACGCT GGGAAAATTG AGGCGCTTTC TCAAATGGAT ATTCTTTTTC
     841  ATAGTAGTGA TGGAATGCTT GTGCTTGATG CTGAAACTGT GTGCTTACCC AAGCTGGTGC
     901  AGGGGACGTG GGGTCCCTCT GGCAGCTCAC AGAGCCTCTA CGAAATCTGT GTGTGTCCAG
     961  ATGGGAAGCT GTACCTGTCT GTGGCCGGTG TGAGCACCAC GTGCCAGGAG CACAGCCACA
    1021  TCTGCCTCTG AGCTGCCTGC GTCCTCTCGG TGAGCTGTGC AGTGCCGGCC CCAGATCCTC
    1081  ACACCCAGGG AGCAGCTGCA CATCGTGAAA GACTGAGGCA GCGTGGATGG GAAGTAAACG
    1141  CTTCCAGAGG AACTCAGAAA AAATTATGTG CCAGTGAAAG TGTTTGGACA AAAACTACAT
    1201  GATCTCAAAA TGCACGTGGA TGTGAGACAC AAAAGTTGAC AAAATGGAAA AGCAATGTGT
    1261  TTTTCCACTG GATTAATTTT CACCGGAACA ATTGCGAATT CTCTCTGCCT CGCCTCCCCC
    1321  TATCTTGTCC GTGTGGGCAC ACACTGAGTG TTGAGTTGCC GTGTGGAGTT AATGTATGAC
    1381  GCTCCACTGT GGATATCTAA TGCCCTGTTG AGAGTAGCCT TGCTCAGTAC TAAAATGCCC
    1441  CAAAGTTCTA TACAGCATTT CCTTTATAGC ATTCAAACCT CACATCCTCC CTTCAGTTTA
    1501  ATGCAAGTAA GTCAGGTTTC ACAAGAAAAT TTTCAAGTTT TGAAGGGAAT TTGAGGTTGA
    1561  TCTGGTTTTC AAGATGTAGT TAAAGGAATA AATCACTCAA AATTAAACTT TCTGTATATA
    1621  GTCAATAAGC AATAAAAACC TCATTTTTCA GAGTTAAAAA A
//
LOCUS       NM_000231               1661 bp    mRNA    linear   PRI 04-MAY-2017
DEFINITION  Homo sapiens sarcoglycan gamma (SGCG), mRNA.
ACCESSION   NM_000231
VERSION     NM_000231.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1661)
  AUTHORS   Spinazzola JM, Smith TC, Liu M, Luna EJ and Barton ER.
  TITLE     Gamma-sarcoglycan is required for the response of archvillin to
            mechanical stimulation in skeletal muscle
  JOURNAL   Hum. Mol. Genet. 24 (9), 2470-2481 (2015)
   PUBMED   25605665
  REMARK    GeneRIF: These results position archvillin as a mechanically
            sensitive component of the dystrophin complex and demonstrate that
            signaling defects caused by loss of gamma-SG occur both at the
            sarcolemma and in the nucleus.
REFERENCE   2  (bases 1 to 1661)
  AUTHORS   El Kerch F, Ratbi I, Sbiti A, Laarabi FZ, Barkat A and Sefiani A.
  TITLE     Carrier frequency of the c.525delT mutation in the SGCG gene and
            estimated prevalence of limb girdle muscular dystrophy type 2C
            among the Moroccan population
  JOURNAL   Genet Test Mol Biomarkers 18 (4), 253-256 (2014)
   PUBMED   24552312
  REMARK    GeneRIF: Molecular epidemiologic methods were used to calculate the
            frequency of heterozygotes for this SGCG mutation in Moroccan
            newborns and to estimate the prevalence of LGMD2C in the Moroccan
            population.
REFERENCE   3  (bases 1 to 1661)
  AUTHORS   DiCapua D and Patwa H.
  TITLE     Puerto Rican founder mutation G787A in the SGCG gene: a case report
            of 2 siblings with LGMD 2C
  JOURNAL   J Clin Neuromuscul Dis 15 (3), 105-107 (2014)
   PUBMED   24534832
  REMARK    GeneRIF: A report of two siblings with severe childhood onset
            limb-girdle muscular dystrophy type 2C supports the theory that the
            mutation G787A in the SGCG gene is a founder mutation.
REFERENCE   4  (bases 1 to 1661)
  AUTHORS   Saxena R, Saleheen D, Been LF, Garavito ML, Braun T, Bjonnes A,
            Young R, Ho WK, Rasheed A, Frossard P, Sim X, Hassanali N, Radha V,
            Chidambaram M, Liju S, Rees SD, Ng DP, Wong TY, Yamauchi T, Hara K,
            Tanaka Y, Hirose H, McCarthy MI, Morris AP, Basit A, Barnett AH,
            Katulanda P, Matthews D, Mohan V, Wander GS, Singh JR, Mehra NK,
            Ralhan S, Kamboh MI, Mulvihill JJ, Maegawa H, Tobe K, Maeda S, Cho
            YS, Tai ES, Kelly MA, Chambers JC, Kooner JS, Kadowaki T, Deloukas
            P, Rader DJ, Danesh J and Sanghera DK.
  CONSRTM   DIAGRAM; MuTHER; AGEN
  TITLE     Genome-wide association study identifies a novel locus contributing
            to type 2 diabetes susceptibility in Sikhs of Punjabi origin from
            India
  JOURNAL   Diabetes 62 (5), 1746-1755 (2013)
   PUBMED   23300278
  REMARK    GeneRIF: Data suggest that an SNP in an intron of SGCG (rs9552911)
            is associated with type 2 diabetes [Genome-Wide Association Study
            in Sikh populations in India & Meta-Analysis]
REFERENCE   5  (bases 1 to 1661)
  AUTHORS   Blandin G, Marchand S, Charton K, Daniele N, Gicquel E, Boucheteil
            JB, Bentaib A, Barrault L, Stockholm D, Bartoli M and Richard I.
  TITLE     A human skeletal muscle interactome centered on proteins involved
            in muscular dystrophies: LGMD interactome
  JOURNAL   Skelet Muscle 3 (1), 3 (2013)
   PUBMED   23414517
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1661)
  AUTHORS   Jung D, Leturcq F, Sunada Y, Duclos F, Tome FM, Moomaw C, Merlini
            L, Azibi K, Chaouch M, Slaughter C, Fardeau M, Kaplan JC and
            Campbell KP.
  TITLE     Absence of gamma-sarcoglycan (35 DAG) in autosomal recessive
            muscular dystrophy linked to chromosome 13q12
  JOURNAL   FEBS Lett. 381 (1-2), 15-20 (1996)
   PUBMED   8641426
REFERENCE   7  (bases 1 to 1661)
  AUTHORS   Noguchi S, McNally EM, Ben Othmane K, Hagiwara Y, Mizuno Y, Yoshida
            M, Yamamoto H, Bonnemann CG, Gussoni E, Denton PH, Kyriakides T,
            Middleton L, Hentati F, Ben Hamida M, Nonaka I, Vance JM, Kunkel LM
            and Ozawa E.
  TITLE     Mutations in the dystrophin-associated protein gamma-sarcoglycan in
            chromosome 13 muscular dystrophy
  JOURNAL   Science 270 (5237), 819-822 (1995)
   PUBMED   7481775
REFERENCE   8  (bases 1 to 1661)
  AUTHORS   Ben Othmane,K., Speer,M.C., Stauffer,J., Blel,S., Middleton,L., Ben
            Hamida,C., Etribi,A., Loeb,D., Hentati,F., Roses,A.D. et al.
  TITLE     Evidence for linkage disequilibrium in chromosome 13-linked
            Duchenne-like muscular dystrophy (LGMD2C)
  JOURNAL   Am. J. Hum. Genet. 57 (3), 732-734 (1995)
   PUBMED   7668303
REFERENCE   9  (bases 1 to 1661)
  AUTHORS   Jorde LB, Watkins WS, Viskochil D, O'Connell P and Ward K.
  TITLE     Linkage disequilibrium in the neurofibromatosis 1 (NF1) region:
            implications for gene mapping
  JOURNAL   Am. J. Hum. Genet. 53 (5), 1038-1050 (1993)
   PUBMED   8105688
REFERENCE   10 (bases 1 to 1661)
  AUTHORS   Pegoraro,E. and Hoffman,E.P.
  TITLE     Limb-Girdle Muscular Dystrophy Overview
  JOURNAL   (in) Pagon RA, Adam MP, Ardinger HH, Wallace SE, Amemiya A, Bean
            LJH, Bird TD, Fong CT, Mefford HC, Smith RJH and Stephens K (Eds.);
            GENEREVIEWS(R);
            (1993)
   PUBMED   20301582
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL356287.16, DA897096.1,
            BC074778.2 and U34976.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Oct 16, 2008 this sequence version replaced NM_000231.1.

            Summary: This gene encodes gamma-sarcoglycan, one of several
            sarcolemmal transmembrane glycoproteins that interact with
            dystrophin. The dystrophin-glycoprotein complex (DGC) spans the
            sarcolemma and is comprised of dystrophin, syntrophin, alpha- and
            beta-dystroglycans and sarcoglycans. The DGC provides a structural
            link between the subsarcolemmal cytoskeleton and the extracellular
            matrix of muscle cells. Defects in the encoded protein can lead to
            early onset autosomal recessive muscular dystrophy, in particular
            limb-girdle muscular dystrophy, type 2C (LGMD2C). [provided by
            RefSeq, Oct 2008].

            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.

            ##Evidence-Data-START##
            Transcript exon combination :: U34976.1, ERR279837.528.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2142680, SAMEA2147596
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-84                AL356287.16        145490-145573
            85-651              DA897096.1         1-567
            652-1059            BC074778.2         539-946
            1060-1661           U34976.1           1029-1630
FEATURES             Location/Qualifiers
     source          1..1661
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="13"
                     /map="13q12.12"
     gene            1..1661
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /note="sarcoglycan gamma"
                     /db_xref="GeneID:6445"
                     /db_xref="HGNC:HGNC:10809"
                     /db_xref="HPRD:07039"
                     /db_xref="MIM:608896"
     exon            1..155
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       1
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:970716548"
     variation       5
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1005695823"
     variation       14
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:551607827"
     variation       19
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1015017073"
     variation       25
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:963430387"
     variation       31
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050064"
     variation       38
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050065"
     STS             41..1123
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /db_xref="UniSTS:489652"
     variation       46
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:566634080"
     variation       54
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:919755726"
     variation       61
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1038134233"
     variation       68
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4770403"
     misc_feature    72..74
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /note="upstream in-frame stop codon"
     variation       72
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1012623683"
     variation       100
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:540247673"
     variation       109
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:912262993"
     variation       112
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:971370821"
     STS             113..1059
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /db_xref="UniSTS:481904"
     variation       116
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1041997854"
     variation       121
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372088302"
     variation       129
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748425791"
     variation       150
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141771521"
     CDS             156..1031
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /note="35kD dystrophin-associated glycoprotein; 35 kDa
                     dystrophin-associated glycoprotein; sarcoglycan, gamma
                     (35kDa dystrophin-associated glycoprotein)"
                     /codon_start=1
                     /product="gamma-sarcoglycan"
                     /protein_id="NP_000222.1"
                     /db_xref="CCDS:CCDS9299.1"
                     /db_xref="GeneID:6445"
                     /db_xref="HGNC:HGNC:10809"
                     /db_xref="HPRD:07039"
                     /db_xref="MIM:608896"
                     /translation="MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLL
                     IILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSS
                     LLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVV
                     GTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKI
                     EALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSV
                     AGVSTTCQEHSHICL"
     misc_feature    243..989
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /note="Sarcoglycan complex subunit protein; Region:
                     Sarcoglycan_1; pfam04790"
                     /db_xref="CDD:282624"
     misc_feature    267..329
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q13326.4);
                     transmembrane region"
     exon            156..350
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       162
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140310896"
     variation       163
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35105771"
     variation       167
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768187079"
     variation       169
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:754055956"
     variation       172
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148041867"
     variation       174
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747860532"
     variation       177
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771657671"
     variation       181
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773575178"
     variation       182
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764748199"
     variation       189
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761027747"
     variation       201
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:546543109"
     variation       202
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020872078"
     variation       207
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:759576122"
     variation       211
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765392154"
     variation       212
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752669226"
     variation       213
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763248287"
     variation       221
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376410504"
     variation       232
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886043151"
     variation       236
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202078221"
     variation       237
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:999585272"
     variation       239
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1031067187"
     variation       241..242
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:762777463"
     variation       249
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76916029"
     variation       251
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780186997"
     variation       253
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753775490"
     variation       254
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778502285"
     variation       255
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747549369"
     variation       256
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:755404457"
     variation       257
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140810408"
     variation       259
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:771255124"
     variation       260
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:760108586"
     variation       265
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770141199"
     variation       266
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775643720"
     variation       267
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1800349"
     variation       273
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764468720"
     variation       275
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1022001256"
     variation       288
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751808758"
     variation       292
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1019389043"
     variation       297
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369936288"
     variation       298
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754949325"
     variation       312
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138880406"
     variation       313
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781760379"
     variation       316
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:886043940"
     variation       321
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373083509"
     variation       327
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752310028"
     variation       330
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:546376689"
     variation       335
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:919571338"
     variation       336
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:886044348"
     variation       345
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886042587"
     exon            351..452
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       352
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:752603127"
     variation       355
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:931778619"
     variation       367
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143009120"
     variation       372
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763619480"
     variation       383
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1800350"
     variation       385
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:886043950"
     variation       388
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886044067"
     variation       390
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148404730"
     variation       391
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375766013"
     variation       392
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201144588"
     variation       408
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867655487"
     variation       411
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:746238964"
     variation       422
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149595403"
     variation       425
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368524463"
     variation       430
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:886044395"
     variation       435
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867039495"
     variation       443
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:957838468"
     variation       446
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749843245"
     variation       449
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769234531"
     exon            453..540
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       457
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886042370"
     variation       458
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:144277094"
     variation       459
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201683351"
     variation       462
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754191351"
     variation       465
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:918581161"
     variation       467
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1800351"
     variation       470
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779550455"
     variation       473
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371622125"
     variation       475
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772017929"
     variation       476
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:777873668"
     variation       479
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:747220624"
     variation       481
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201514102"
     variation       488
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775265377"
     variation       490
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:570169794"
     variation       499
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774245371"
     variation       500
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1800352"
     variation       501
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191040430"
     variation       502
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17314986"
     variation       507
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766126721"
     variation       509..510
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:772566132"
     variation       509
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376184429"
     variation       515
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755373825"
     variation       516
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1013988350"
     variation       526
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:183204936"
     variation       533
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753180283"
     variation       534
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:368149615"
     variation       538
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1000108142"
     variation       539
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777732200"
     variation       540
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:747046381"
     exon            541..660
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       541
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:866412938"
     variation       547
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:544414698"
     variation       551
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756280402"
     variation       553
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778691463"
     variation       554
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747909634"
     variation       560
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771962643"
     variation       562
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:569816696"
     variation       566
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:886044394"
     variation       569
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770596449"
     variation       575
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:776236052"
     variation       578
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759278850"
     variation       583
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369818411"
     variation       587
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775787536"
     variation       590
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35628352"
     variation       591
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373442790"
     variation       593
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144497243"
     variation       594
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374836520"
     variation       595
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767605031"
     variation       596
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750443730"
     variation       605
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369191957"
     variation       607..613
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="ttactgt"
                     /db_xref="dbSNP:886042540"
     variation       610
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201329880"
     variation       611
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1047364666"
     variation       621
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181210672"
     variation       626
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:527236657"
     variation       634
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:527562042"
     variation       637
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746969527"
     variation       640
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770939408"
     variation       652
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776289036"
     variation       656
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:560640452"
     exon            661..733
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       662
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199905729"
     variation       669
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:745417608"
     variation       670
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769313305"
     variation       672
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886042216"
     variation       677
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146679977"
     variation       680
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:786204786"
     variation       681
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768134426"
     variation       684
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375592456"
     variation       688
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1011397929"
     variation       690
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139072866"
     variation       693
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1017891625"
     variation       694
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:114160429"
     variation       713
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766503990"
     variation       714
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886042075"
     variation       718
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753806016"
     variation       719
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367595212"
     variation       723
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751460849"
     exon            734..857
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       736
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:547818652"
     variation       751
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200191311"
     variation       754
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:886043860"
     variation       770
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142409090"
     variation       778
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778119056"
     variation       780
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:563129062"
     variation       783
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:368027244"
     variation       784
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045567625"
     variation       791
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:794727841"
     variation       795
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776984717"
     variation       797
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:528994151"
     variation       798
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770020910"
     variation       800
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:763278303"
     variation       808
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202045534"
     variation       810
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375904616"
     variation       811
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760374955"
     variation       812
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368393587"
     variation       814
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753751942"
     variation       815
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:550268354"
     variation       819
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764741894"
     variation       825
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372188878"
     variation       827
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866525494"
     variation       845
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:875989949"
     variation       855
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:930166092"
     exon            858..1655
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /inference="alignment:Splign:1.39.8"
     variation       858
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763780768"
     variation       860
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1800353"
     variation       861
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201788230"
     variation       862
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:571481056"
     variation       863
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:899136360"
     variation       868
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750729655"
     variation       871
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149086397"
     variation       873
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780692038"
     variation       878..879
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:758078849"
     variation       879
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749427753"
     variation       890..891
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:797044783"
     variation       890
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373785384"
     variation       892
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377625551"
     variation       904
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:906499060"
     variation       906
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201535503"
     variation       907
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:886042749"
     variation       908
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748332364"
     variation       933
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:772271813"
     variation       939
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776357413"
     variation       940
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:756205136"
     variation       941
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759316719"
     variation       942
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:104894423"
     variation       947
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377620885"
     variation       948..949
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:780348174"
     variation       953
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775379604"
     variation       955
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762840469"
     variation       956
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763531562"
     variation       958
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143110015"
     variation       961
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761374184"
     variation       963
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767191084"
     variation       976
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750873881"
     variation       977
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756522501"
     variation       979
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780747031"
     variation       980..981
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:747378865"
     variation       980
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754426701"
     variation       986
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754112406"
     variation       987
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147820869"
     variation       988
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748255972"
     variation       997
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1022230625"
     variation       1000
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758609187"
     variation       1001
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778036404"
     variation       1003
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:104894422"
     variation       1010
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370309494"
     variation       1015
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1800354"
     variation       1033
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749232488"
     variation       1036
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:975086956"
     variation       1039
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779893866"
     variation       1040
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746787386"
     variation       1041
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139369964"
     variation       1044
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9510701"
     variation       1046
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:967653643"
     variation       1047
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772968140"
     variation       1048
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:576170697"
     variation       1049
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766863622"
     variation       1051
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754189409"
     variation       1065
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:755504994"
     variation       1066
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765762699"
     variation       1067
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752771653"
     variation       1069
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777795087"
     variation       1073
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747258249"
     variation       1074
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757409780"
     variation       1075
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:940862421"
     variation       1084
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:188804783"
     variation       1085
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193022162"
     STS             1101..1314
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /standard_name="SGC35673"
                     /db_xref="UniSTS:27907"
     variation       1102
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:981431209"
     variation       1108
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948028478"
     variation       1116
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752275191"
     variation       1123
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045031542"
     variation       1132
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:75252896"
     variation       1140
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036298862"
     variation       1144..1158
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="ccagaggaactcaga"
                     /db_xref="dbSNP:149533619"
     variation       1157..1158
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:768400344"
     variation       1163
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:898952977"
     variation       1164
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:906553672"
     variation       complement(1167)
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3751372"
     variation       1176
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150043089"
     variation       1177..1178
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:539058397"
     variation       1182
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771415928"
     STS             1198..1421
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /standard_name="STS-U34976"
                     /db_xref="UniSTS:28147"
     variation       1198
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145339454"
     variation       1199
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:892267023"
     variation       1202
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774709300"
     variation       1216
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115918628"
     variation       1228
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:899735714"
     variation       1252
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:561080982"
     variation       1253
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:531811585"
     variation       1269
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:996787534"
     variation       complement(1285)
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3751371"
     variation       1295
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:955250065"
     variation       1296
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:540325559"
     variation       1311
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:982516817"
     variation       1312
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:571413005"
     variation       1320
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:962213783"
     variation       1322
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373623927"
     variation       complement(1326)
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3829352"
     variation       1327
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115862132"
     variation       1333
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:78718194"
     variation       1338
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:971481983"
     variation       1340
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377364360"
     variation       1341
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554587798"
     variation       1361
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:927982067"
     variation       1362
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:981504595"
     variation       1373
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:569677682"
     variation       1380
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1052492553"
     variation       1381
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:537146298"
     variation       1382
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:946810360"
     variation       1415
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:972356120"
     variation       1416
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:920554812"
     variation       1428
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556520681"
     variation       1432
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:899706364"
     variation       1448
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754059266"
     variation       1456
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:578125920"
     variation       1460
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1029999664"
     variation       1461
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:944417351"
     variation       1472
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757405955"
     variation       1484
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:890758131"
     variation       1503
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:545243799"
     variation       1508
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1004305255"
     variation       1509
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:184625354"
     variation       1512..1513
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="aagt"
                     /db_xref="dbSNP:886050066"
     variation       1522
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:962763243"
     variation       1528
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:572390899"
     variation       1534
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:973817578"
     variation       1536
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7329620"
     variation       1542
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372148320"
     variation       1560
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:969565273"
     variation       1577
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41283956"
     variation       1592
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1055114525"
     variation       1602..1607
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace=""
                     /replace="attaaa"
                     /db_xref="dbSNP:886050067"
     variation       1604
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:928211080"
     variation       1608
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:939336114"
     variation       1614
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1013488242"
     variation       1618
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:988531933"
     variation       1626
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1023059669"
     regulatory      1631..1636
                     /regulatory_class="polyA_signal_sequence"
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
     variation       1643
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147879467"
     variation       1649
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754763205"
     polyA_site      1655
                     /gene="SGCG"
                     /gene_synonym="35DAG; A4; DAGA4; DMDA; DMDA1; gamma-SG;
                     LGMD2C; MAM; SCARMD2; SCG3"
ORIGIN
       1  GAAACTCGTG AGAGCCCTTT CTCCAGGGAC AGTTGCTGAA GCTTCATCCT TTGCTCTCAT
      61  TCTGTAAGTC ATAGAAAAGT TTGAAACATT CTGTCTGTGG TAGAGCTCGG GCCAGCTGTA
     121  GTTCATTCGC CAGTGTGCTT TTCTTAATAT CTAAGATGGT GCGTGAGCAG TACACTACAG
     181  CCACAGAAGG CATCTGCATA GAGAGGCCAG AGAATCAGTA TGTCTACAAA ATTGGCATTT
     241  ATGGCTGGAG AAAGCGCTGT CTCTACTTGT TTGTTCTTCT TTTACTCATC ATCCTCGTTG
     301  TGAATTTAGC TCTTACAATT TGGATTCTTA AAGTGATGTG GTTTTCTCCA GCAGGAATGG
     361  GCCACTTGTG TGTAACAAAA GATGGACTGC GCTTGGAAGG GGAATCAGAA TTTTTATTCC
     421  CATTGTATGC CAAAGAAATA CACTCCAGAG TGGACTCATC TCTGCTTCTA CAATCAACCC
     481  AGAATGTGAC TGTAAATGCG CGCAACTCAG AAGGGGAGGT CACAGGCAGG TTAAAAGTCG
     541  GTCCCAAAAT GGTAGAAGTC CAGAATCAAC AGTTTCAGAT CAACTCCAAC GACGGCAAGC
     601  CACTATTTAC TGTAGATGAG AAGGAAGTTG TGGTTGGTAC AGATAAACTT CGAGTAACTG
     661  GGCCTGAAGG GGCTCTTTTT GAACATTCAG TGGAGACACC CCTTGTCAGA GCCGACCCGT
     721  TTCAAGACCT TAGATTAGAA TCCCCCACTC GGAGTCTAAG CATGGATGCC CCAAGGGGTG
     781  TGCATATTCA AGCTCACGCT GGGAAAATTG AGGCGCTTTC TCAAATGGAT ATTCTTTTTC
     841  ATAGTAGTGA TGGAATGCTT GTGCTTGATG CTGAAACTGT GTGCTTACCC AAGCTGGTGC
     901  AGGGGACGTG GGGTCCCTCT GGCAGCTCAC AGAGCCTCTA CGAAATCTGT GTGTGTCCAG
     961  ATGGGAAGCT GTACCTGTCT GTGGCCGGTG TGAGCACCAC GTGCCAGGAG CACAGCCACA
    1021  TCTGCCTCTG AGCTGCCTGC GTCCTCTCGG TGAGCTGTGC AGTGCCGGCC CCAGATCCTC
    1081  ACACCCAGGG AGCAGCTGCA CATCGTGAAA GACTGAGGCA GCGTGGATGG GAAGTAAACG
    1141  CTTCCAGAGG AACTCAGAAA AAATTATGTG CCAGTGAAAG TGTTTGGACA AAAACTACAT
    1201  GATCTCAAAA TGCACGTGGA TGTGAGACAC AAAAGTTGAC AAAATGGAAA AGCAATGTGT
    1261  TTTTCCACTG GATTAATTTT CACCGGAACA ATTGCGAATT CTCTCTGCCT CGCCTCCCCC
    1321  TATCTTGTCC GTGTGGGCAC ACACTGAGTG TTGAGTTGCC GTGTGGAGTT AATGTATGAC
    1381  GCTCCACTGT GGATATCTAA TGCCCTGTTG AGAGTAGCCT TGCTCAGTAC TAAAATGCCC
    1441  CAAAGTTCTA TACAGCATTT CCTTTATAGC ATTCAAACCT CACATCCTCC CTTCAGTTTA
    1501  ATGCAAGTAA GTCAGGTTTC ACAAGAAAAT TTTCAAGTTT TGAAGGGAAT TTGAGGTTGA
    1561  TCTGGTTTTC AAGATGTAGT TAAAGGAATA AATCACTCAA AATTAAACTT TCTGTATATA
    1621  GTCAATAAGC AATAAAAACC TCATTTTTCA GAGTTAAAAA A
//