Dbfetch

LOCUS       NC_004952               3990 bp    DNA     circular CON 18-DEC-2014
DEFINITION  Francisella novicida plasmid pFNL10, complete sequence.
ACCESSION   NC_004952
VERSION     NC_004952.1  GI:32455353
DBLINK      BioProject: PRJNA187724
KEYWORDS    RefSeq.
SOURCE      Francisella tularensis subsp. novicida F6168
  ORGANISM  Francisella tularensis subsp. novicida F6168
            Bacteria; Proteobacteria; Gammaproteobacteria; Thiotrichales;
            Francisellaceae; Francisella.
REFERENCE   1  (bases 1 to 3990)
  AUTHORS   Pomerantsev,A.P., Golovliov,I.R., Ohara,Y., Mokrievich,A.N.,
            Obuchi,M., Norqvist,A., Kuoppa,K. and Pavlov,V.M.
  TITLE     Genetic organization of the Francisella plasmid pFNL10
  JOURNAL   Plasmid 46 (3), 210-222 (2001)
   PUBMED   11735370
REFERENCE   2  (bases 1 to 3990)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JAN-2013) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3990)
  AUTHORS   Pomerantsev,A.P., Golovliov,I.R., Mokrievish,A.N. and Pavlov,V.M.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-1999) Microbiology, State Research Center for
            Applied Microbiology, Obolensk, Moscow Region 142279, Russia
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AF121418.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..3990
                     /organism="Francisella tularensis subsp. novicida F6168"
                     /mol_type="genomic DNA"
                     /strain="F6168"
                     /sub_species="novicida"
                     /db_xref="taxon:1452728"
                     /plasmid="pFNL10"
     regulatory      complement(24..200)
                     /regulatory_class="terminator"
     gene            complement(180..602)
                     /locus_tag="pFNL10_p1"
                     /db_xref="GeneID:4267387"
     CDS             complement(180..602)
                     /locus_tag="pFNL10_p1"
                     /note="orf2"
                     /codon_start=1
                     /transl_table=11
                     /product="RepB protein"
                     /protein_id="NP_862365.1"
                     /db_xref="GI:32455354"
                     /db_xref="GeneID:4267387"
                     /translation="MNIEIFKFSKKHKKINKKLIDLTKVKQVVTTGYSFIVVYQRGRK
                     IELSYESSYWHAKKDLDNSNSDVGITYSYIKKDKRGPCHKDNYLRDSKGRLLKDWGKI
                     EELHEKYPKIGKIWYISREETDKLLKDFTYKNGNLIMV"
     gene            complement(605..1682)
                     /gene="repA"
                     /locus_tag="pFNL10_p2"
                     /db_xref="GeneID:1343173"
     CDS             complement(605..1624)
                     /gene="repA"
                     /locus_tag="pFNL10_p2"
                     /note="orf1"
                     /codon_start=1
                     /transl_table=11
                     /product="RepA protein"
                     /protein_id="NP_862366.1"
                     /db_xref="GI:32455355"
                     /db_xref="GeneID:1343173"
                     /translation="MKEVKNVNAGKEIAMSNTLVAGKYSLTKEEQNLIFLVASMVKRE
                     DKEFHRYKISLSDLEKATGVKHNRVRLKQLMHSIMSKPVWLNKEQTKIANWFAYIEAD
                     PKSSALICEFHWSLMPHMIQLQEYFTKAERQLLFSFKSKYSSRLYLLLKSKLGEQAGY
                     ANIVDCVLYVDDMINDFDLPKSYSNRYSNFKNKFLLPALEEINQLSDIFVTYDDKDHH
                     RKHGRKITNIKFTVSKVAETEEEFKQKLLDTKNKEDYIPIEASERLREVVLSDELDLD
                     LYYVRSIFRHHHLHDIERVCDDTWRNWDNKKIKDRKRVFIANIKKLEKKPEENHKLPF
                     GFEEV"
     misc_feature    complement(932..1600)
                     /gene="repA"
                     /locus_tag="pFNL10_p2"
                     /note="Initiator Replication protein; Region: Rep_3;
                     pfam01051"
                     /db_xref="CDD:279400"
     misc_feature    complement(1647)
                     /gene="repA"
                     /locus_tag="pFNL10_p2"
                     /note="transcription start site"
     regulatory      complement(1654..1659)
                     /regulatory_class="minus_10_signal"
                     /gene="repA"
                     /locus_tag="pFNL10_p2"
     regulatory      complement(1677..1682)
                     /regulatory_class="minus_35_signal"
                     /gene="repA"
                     /locus_tag="pFNL10_p2"
     repeat_region   1711..1795
                     /rpt_type=tandem
     repeat_region   1860..1890
                     /rpt_type=tandem
     gene            1933..2252
                     /gene="phd"
                     /locus_tag="pFNL10_p3"
                     /db_xref="GeneID:1343174"
     regulatory      1933..1938
                     /regulatory_class="minus_35_signal"
                     /gene="phd"
                     /locus_tag="pFNL10_p3"
     regulatory      1956..1961
                     /regulatory_class="minus_10_signal"
                     /gene="phd"
                     /locus_tag="pFNL10_p3"
     misc_feature    1968
                     /gene="phd"
                     /locus_tag="pFNL10_p3"
                     /note="transcription start site"
     CDS             1995..2252
                     /gene="phd"
                     /locus_tag="pFNL10_p3"
                     /note="orf5"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Phd protein"
                     /protein_id="NP_862367.1"
                     /db_xref="GI:32455356"
                     /db_xref="GeneID:1343174"
                     /translation="MQTVNYSTFRNELSDSMDRVTKNHSPMIVTRGSKKEAVVMMSLE
                     DFKAYEETAYLMRSMNNYKRLQNSIDEVESGLAIQKELIEE"
     misc_feature    1995..2246
                     /gene="phd"
                     /locus_tag="pFNL10_p3"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; cl09153"
                     /db_xref="CDD:298842"
     gene            2249..2455
                     /locus_tag="pFNL10_p4"
                     /db_xref="GeneID:4267388"
     CDS             2249..2455
                     /note="orf4"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Doc protein"
                     /protein_id="NP_862368.1"
                     /db_xref="GI:32455357"
                     /translation="MILSWSTNAWEDYLYWQSIDKKKLKRINLLIKDIMRNHFEGLGE
                     PEPLKHNFSGYWSRRIDKEHLNNL"
     misc_feature    2261..>2440
                     /note="ParE toxin of type II toxin-antitoxin system,
                     parDE; Region: ParE_toxin; cl21503"
                     /db_xref="CDD:304394"
     repeat_region   2479..2502
                     /rpt_type=tandem
     regulatory      2519..2570
                     /regulatory_class="terminator"
     gene            2616..2786
                     /locus_tag="pFNL10_p5"
                     /db_xref="GeneID:4267390"
     CDS             2616..2786
                     /locus_tag="pFNL10_p5"
                     /note="orfm"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_862369.1"
                     /db_xref="GI:32455359"
                     /db_xref="GeneID:4267390"
                     /translation="MTECRIKPRAIAHGKIDYHLLLKCFSDGVNINTLMCYSSLVELL
                     SNYWFYQPVTKY"
     misc_feature    3060
                     /note="transcription start site"
     gene            3075..3953
                     /locus_tag="pFNL10_p6"
                     /db_xref="GeneID:4267389"
     CDS             3075..3953
                     /locus_tag="pFNL10_p6"
                     /note="orf3"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_862370.1"
                     /db_xref="GI:32455358"
                     /db_xref="GeneID:4267389"
                     /translation="MKDKAAKNRDFRKTILSVLQRNKDGSFATQANRKSILLQATKDL
                     KKVGFSKVTAENFGNKHCYALRDHWRAQGLATATIKNRLACLRWLGEKMGKELPDNRK
                     LEIENRKYSDNSINKAQEIDFKAISALTDRQALAIQLQREFGLRREESLKFQPSYAIK
                     EHKIELKSSWTKVGRPREIPILNEKQRELLEKVKEVAGKGSLIESEKSYKQAMEHFTT
                     RCQRAGIKNVHGFRHAYAQDRYRQLTGRECPKNGGLTSKQLTPEQKQQDYEARMTISE
                     ELGHGREDVTVNYLGR"
     misc_feature    3120..3362
                     /locus_tag="pFNL10_p6"
                     /note="Phage integrase, N-terminal; Region:
                     Phage_int_SAM_2; pfam12834"
                     /db_xref="CDD:289595"
     misc_feature    order(3471..3473,3510..3515,3723..3725,3729..3731,
                     3759..3761)
                     /locus_tag="pFNL10_p6"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271175"
     misc_feature    <3474..3788
                     /locus_tag="pFNL10_p6"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain; Region: DNA_BRE_C; cl00213"
                     /db_xref="CDD:294145"
CONTIG      join(AF121418.1:1..3990)
ORIGIN
       1  ACATAGTAGA TCGACTCTTC TTAGGGATTT TATATTTTTT GATAAATCAT CTATTTTGCT
      61  AGTTAAATCA TCAAATTTAT CATCTTGTTG TTTGACTAAA TCTAAGAATC TATTCTCTTT
     121  TTTAAAATCG TTCATGCAAA CCGCCTATAG CTTTCTTCTT TTTCTGAAAT TATTTGTCTT
     181  CACACCATAA TTAAATTCCC ATTTTTATAA GTAAAGTCTT TTAAAAGCTT GTCAGTCTCT
     241  TCTCTAGAAA TGTACCAAAT TTTACCTATT TTAGGATACT TTTCATGAAG CTCTTCTATT
     301  TTTCCCCAGT CCTTTAATAG TCTACCTTTA GAGTCTCGTA AATAGTTATC TTTGTGACAG
     361  GGGCCTCTTT TATCTTTTTT AATGTAACTA TATGTTATTC CAACGTCACT ATTACTATTA
     421  TCCAAATCTT TTTTAGCATG CCAGTAAGAA CTTTCATAAC TTAACTCTAT CTTTCGACCT
     481  CTTTGATATA CAACAATAAA GCTATAGCCA GTAGTAACAA CCTGTTTTAC TTTTGTTAAA
     541  TCTATTAACT TCTTATTTAT TTTTTTATGT TTTTTTGAAA ATTTAAATAT TTCTATATTC
     601  ATTCCTACAC TTCCTCAAAT CCAAATGGTA GCTTATGATT CTCTTCTGGT TTCTTTTCTA
     661  ATTTTTTTAT ATTTGCAATA AAAACTCTTT TTCTATCTTT GATTTTTTTA TTGTCCCAAT
     721  TCCTCCAAGT ATCATCACAA ACCCTTTCAA TATCATGTAA ATGATGATGT CTAAATATTG
     781  ATCTGACATA ATACAGATCT AGGTCTAGTT CATCACTTAA CACAACTTCT CTAAGTCTTT
     841  CAGATGCTTC GATTGGTATG TAATCCTCTT TATTTTTAGT ATCTAAAAGC TTTTGCTTAA
     901  ATTCTTCTTC TGTCTCTGCT ACCTTACTAA CTGTAAACTT GATATTTGTA ATCTTACGAC
     961  CATGTTTTCT GTGATGATCC TTGTCATCAT AGGTTACAAA AATATCCGAT AATTGATTAA
    1021  TCTCTTCTAG TGCTGGTAAT AGGAACTTAT TTTTAAAATT TGAATATCTG TTGCTGTAAC
    1081  TTTTAGGTAA ATCAAAATCA TTAATCATAT CATCGACATA CAATACGCAA TCAACTATAT
    1141  TAGCATACCC TGCTTGTTCG CCTAATTTGC TTTTGAGAAG TAAGTATAAT CTGCTTGAAT
    1201  ACTTACTTTT AAATGAAAAT AGTAACTGTC TTTCTGCTTT AGTAAAGTAC TCTTGTAGTT
    1261  GTATCATGTG TGGCATTAAT GACCAATGAA ACTCGCAAAT TAAAGCACTG CTTTTAGGGT
    1321  CTGCTTCAAT ATATGCAAAC CAGTTAGCTA TCTTCGTTTG TTCTTTATTC AGCCATACTG
    1381  GCTTAGACAT TATTGAGTGC ATTAATTGCT TCAATCTCAC TCTGTTATGC TTAACCCCTG
    1441  TAGCTTTTTC AAGATCAGAT AGGCTTATCT TATACCTGTG AAACTCTTTA TCTTCTCTTT
    1501  TAACCATTGA GGCAACTAAG AATATTAAGT TTTGTTCTTC TTTTGTAAGG CTATACTTTC
    1561  CTGCAACAAG AGTATTAGAC ATAGCTATTT CTTTGCCAGC ATTTACATTT TTAACTTCTT
    1621  TCATAGAACT AGAGTCATTA TCTCGATATA CAAATTCTAT AAAACTTCTA TTAGTAAAAC
    1681  AACTACTTCA TAAAAAAAAG TAGTTTTAAC GATACAAAAA GTAGTTTTAA ATTCAAAAAG
    1741  TGATACAAAA AGTAGTTTTA AATTCAAAAA GTGATACAAA AAGTAGTTTT AAATTTTTTA
    1801  AAAAAGTGCT TCAAAGCCTT ATGTAGCAAT ACTTACAGAG GATTAAAAAA AAATCTGACA
    1861  ATATATAAAG AGAATATATA AAGAGAATAT CTTAGGGGAT TTTAAAAAAA TCCCACAGAC
    1921  TCAAAGACTT TTTTGACTTT TTAAATCCTA GAAACTATAC TTTAAGTACT TATTTAAGTA
    1981  CATGGATTTA GATTATGCAA ACCGTTAATT ATTCAACTTT TAGAAATGAA CTATCTGATT
    2041  CAATGGATAG AGTAACAAAA AATCATAGTC CTATGATTGT AACTAGAGGT TCAAAAAAAG
    2101  AAGCAGTTGT TATGATGTCG TTAGAGGATT TTAAAGCTTA TGAAGAAACA GCCTATCTTA
    2161  TGAGAAGCAT GAACAACTAT AAGAGACTAC AAAATTCTAT TGATGAAGTA GAATCTGGTT
    2221  TAGCTATCCA AAAAGAGTTG ATTGAAGAAT GATACTTTCT TGGTCAACTA ATGCTTGGGA
    2281  AGATTATCTA TATTGGCAAA GCATAGATAA GAAAAAGCTA AAACGGATTA ATTTGCTAAT
    2341  CAAAGACATT ATGAGAAATC ACTTTGAGGG ATTAGGAGAG CCTGAACCTT TGAAGCATAA
    2401  TTTCTCTGGT TATTGGTCTA GACGAATAGA CAAAGAACAT CTGAATAATC TATAAAATTG
    2461  AAAATCAAAA TCTAATCATT ATCCAATGCA TTATCCAATG CAGATATCAT TATTAGAATT
    2521  TCTTAGAAAT ATGAAATTCC AGCCAAAGCG AATTTTAGAT TTTTAAGAAA CTACGATGAT
    2581  GTTTACCATT CTGTCAATAT GTACTTTTGT GCATAGTGAC AGAATGTAGG ATAAAACCAA
    2641  GAGCCATTGC ACATGGGAAA ATAGATTATC ATTTGCTATT GAAATGCTTT AGTGATGGCG
    2701  TTAATATTAA TACATTGATG TGCTACTCCA GCCTTGTAGA GTTGCTTTCA AATTACTGGT
    2761  TTTACCAGCC CGTTACAAAA TACTAGCTTA GCTAGCTCGT TTCAAATTAC CGATGATATC
    2821  GGACCGTTCC AACTTACCGA CCAGTTCGGC AGGTATGTAT TTGCGTGCAT TCCTATCCAA
    2881  AAAAACATCA AGCCAAAAGC TTGAAAAAAC TTACAACACA GCTCAACAGA GCTAGATTGT
    2941  AAAACCCTGC TTTGTTAAGC AGAACGCAAA AATTGAATGA CTTATAGTCA TATCGCTTCG
    3001  ACCCTCGTAG ATTAGTAGCC TTGAGCTATT AACTGGTTGA AACACTTACC AAATAAAGAT
    3061  TAAAAGCGAT AAAAATGAAA GATAAAGCAG CTAAAAACAG AGATTTTAGA AAGACTATTT
    3121  TATCAGTGTT ACAACGCAAT AAAGATGGCT CTTTTGCTAC GCAAGCAAAT AGAAAGTCTA
    3181  TTCTGTTGCA GGCAACTAAA GACCTTAAAA AGGTAGGGTT TAGCAAGGTT ACAGCCGAAA
    3241  ACTTCGGTAA TAAGCATTGC TATGCACTTA GAGACCATTG GAGAGCCCAA GGATTAGCTA
    3301  CAGCAACGAT AAAAAATCGT TTAGCTTGTC TAAGGTGGTT AGGCGAGAAA ATGGGCAAAG
    3361  AACTACCCGA TAATCGAAAA TTAGAGATTG AGAACAGGAA GTATAGCGAT AATTCAATCA
    3421  ATAAAGCCCA AGAAATCGAT TTTAAGGCGA TTTCTGCCTT AACTGATAGG CAAGCCCTAG
    3481  CAATACAATT ACAGCGCGAA TTTGGGCTTC GTAGAGAAGA AAGTTTGAAG TTTCAGCCTA
    3541  GTTATGCAAT CAAAGAGCAT AAAATCGAGC TTAAAAGCTC TTGGACAAAG GTTGGAAGAC
    3601  CACGAGAAAT CCCAATTTTG AATGAAAAAC AGAGAGAATT GTTAGAAAAA GTAAAAGAGG
    3661  TAGCAGGTAA AGGCTCTCTA ATTGAGAGCG AAAAGTCTTA TAAGCAAGCA ATGGAACATT
    3721  TCACGACTCG CTGTCAAAGA GCAGGGATTA AGAATGTTCA TGGCTTTAGA CATGCGTATG
    3781  CTCAAGATAG ATATAGGCAA TTAACAGGGC GTGAGTGTCC TAAAAATGGT GGATTAACAT
    3841  CTAAGCAGCT AACACCTGAG CAAAAGCAAC AAGACTATGA AGCTAGAATG ACTATTAGTG
    3901  AAGAGTTAGG TCATGGTAGA GAAGATGTAA CAGTCAACTA CTTAGGCAGA TAAAAAGCAA
    3961  TATAGCTATA GAAGAAAAGA AAGCTATTTT
//