Dbfetch

LOCUS       AC_000014              43804 bp    DNA     linear   VRL 10-SEP-2009
DEFINITION  Fowl adenovirus A, complete genome.
ACCESSION   AC_000014
VERSION     AC_000014.1
DBLINK      BioProject: PRJNA40323
KEYWORDS    RefSeq.
SOURCE      Fowl aviadenovirus A
  ORGANISM  Fowl aviadenovirus A
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Aviadenovirus.
REFERENCE   1  (bases 1 to 43804)
  AUTHORS   Davison,A.J., Benko,M. and Harrach,B.
  TITLE     Genetic content and evolution of adenoviruses
  JOURNAL   J. Gen. Virol. 84 (PT 11), 2895-2908 (2003)
   PUBMED   14573794
REFERENCE   2  (bases 1 to 43804)
  AUTHORS   Chiocca,S., Kurzbauer,R., Schaffner,G., Baker,A., Mautner,V. and
            Cotten,M.
  TITLE     The complete DNA sequence and genomic organization of the avian
            adenovirus CELO
  JOURNAL   J. Virol. 70 (5), 2939-2949 (1996)
   PUBMED   8627769
REFERENCE   3  (bases 1 to 43804)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUL-2003) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, U.K.
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from BK001452.
            On Oct 3, 2005 this sequence version replaced BK001452.1.
            This record represents an alternative annotation for U46933 /
            NC_001720.
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-43804             U46933.1           1-43804
FEATURES             Location/Qualifiers
     source          1..43804
                     /organism="Fowl aviadenovirus A"
                     /mol_type="genomic DNA"
                     /serotype="Fown adenovirus 1"
                     /db_xref="taxon:190061"
     repeat_region   1..54
                     /note="ITR"
                     /rpt_type=inverted
     CDS             519..743
                     /codon_start=1
                     /product="ORF0"
                     /protein_id="AP_000400.1"
                     /translation="MTSEEKLQSSSPETGLAAVVLQSPLEVRVPAVLPPPVRIDIYRY
                     PGFPPTETIWHGLITQTELNQALESIVEQL"
     CDS             794..1330
                     /note="dUTPase"
                     /codon_start=1
                     /product="ORF1"
                     /protein_id="AP_000401.1"
                     /translation="MDPFGSSSVPPCSTSDLPEPKLYFVRLSPHAVPPVRATHGAAGY
                     DLFSAYDIKVPARGRALVPTDLVFQFPPGCYGRIAPRSGLAAKFFIDVGAGVIDPDYR
                     GNVSVVLFNFSESSFNIRRGDRVAQLILERIMVPELSELTQLGETDRGASGFGSTGMG
                     AVDRNQRSVLEWLTPGSR"
     misc_feature    854..1270
                     /note="deoxyuridine 5'-triphosphate nucleotidohydrolase
                     (dut); Region: dut; TIGR00576"
                     /db_xref="CDD:273149"
     misc_feature    order(917..922,950..952,965..970,974..976,1022..1024,
                     1028..1045,1058..1066,1079..1081,1088..1090,1109..1111,
                     1115..1117,1121..1123,1127..1129,1139..1153,1160..1162,
                     1172..1174)
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143638"
     misc_feature    order(1034..1042,1079..1087,1094..1096,1106..1111)
                     /note="active site"
                     /db_xref="CDD:143638"
     CDS             <1334..1480
                     /codon_start=1
                     /product="ORF1A"
                     /protein_id="AP_000402.1"
                     /translation="DPCDEVDFAVRLQADFEGDDDTYGHCLCEGSTSKRPCCTLCNSY
                     CVLL"
     CDS             1483..1668
                     /codon_start=1
                     /product="ORF1B"
                     /protein_id="AP_000403.1"
                     /translation="MIVSVWQLATIAIEFCDKWVGKYYRFRPYHERLLLMQSRQALER
                     SLRRCVSEVGPPPEPLE"
     CDS             1816..1947
                     /note="contains transmembrane domain"
                     /codon_start=1
                     /product="ORF1C"
                     /protein_id="AP_000404.1"
                     /translation="MDQTATHTALILLIVLTVFTGAVVALMLYIAITGLPCSMLCSQ"
     CDS             1999..2829
                     /note="related to parvovirus Rep"
                     /codon_start=1
                     /product="ORF2"
                     /protein_id="AP_000405.1"
                     /translation="MSRESERYWTLVHALIDRGVVSREQWQMVDPAQYQFYHRSKQRG
                     FKVRHILRDVIRHMCWSRTLLDYMSSASTPSPDDVLRNPLYQLLLCNGYNPAVVGTAL
                     IRWAGHQSNRNTVWIRGTPMSGAPYLAQAIAYCSPLVGSVDWRNKSNPFEGCPDSLVF
                     WWDGGYVYDCCVGLVKQVFRGEHVILPPEGLRGPNPCSELFRTPVLMYSQADICMTRL
                     RSGELSAEHAVGLRDCMYLIRLTEDFDCAGGISCADVKQFVAWSREHPGEVRETHELK
                     "
     misc_feature    1999..2826
                     /note="Parvovirus non-structural protein NS1; Region:
                     Parvo_NS1; pfam01057"
                     /db_xref="CDD:279406"
     CDS             complement(join(2892..3527,15081..15086))
                     /codon_start=1
                     /product="ORF14"
                     /protein_id="AP_000406.1"
                     /translation="MATFESCDLVWDSDNDEDEPQHSWHIYIEPLFTRVGITLITDPD
                     FLLFLLKRQMYPFKHSPHCITDEECDLQLRSFCSWIRVIEMRCTDWTIQYICSCETPR
                     SLFCLSLIRVLTAHWAKTVVNFVAQHDHQPQLPLNLILYTYATHCRLCNLNPALEQIY
                     TAVTVARRQGAYTRLEGQTLYVCLPRDIVNYPCIACFYHLLLRLPVAINFHVI"
     CDS             complement(join(3549..4448,15081..15086))
                     /note="related to ORF2 and ORF12"
                     /codon_start=1
                     /product="ORF13"
                     /protein_id="AP_000407.1"
                     /translation="MACTKRRRESQSSLSSEEEQIASCIPDTPSPCLFPSTSPMDQLV
                     ERLFVEGVAHEVQWNFPSKNLIPTYERERVLEALKERFGPGQSLINQLPSEEPDTLKA
                     AFYNVCDNWFHQMMEAEGYEGKVAANAILRWLRGELNTLVLCGGRLSNAKSLFNALCA
                     CFPLAISDSRINSILSLGEIAPHASLYCLPFVDEKPDPLMLHFMEGNAATCRLNKKTF
                     HIPSTPMLIHCADLSLANEFTARNTVVFFLTGDHTKTPPCYHPRKELRDFVANAAACA
                     CLMTLHCKRDNKLCNPCIRTPLQNQ"
     misc_feature    complement(<3963..4337)
                     /note="Parvovirus non-structural protein NS1; Region:
                     Parvo_NS1; cl24009"
                     /db_xref="CDD:305166"
     CDS             complement(join(4462..5385,15081..15086))
                     /note="related to ORF2 and ORF13"
                     /codon_start=1
                     /product="ORF12"
                     /protein_id="AP_000408.1"
                     /translation="MAERFRKLKDSVKRLRNRHTGEDDDDLVTHRLIFDLQRNNIFTY
                     KDWLTRYPQDAELFESVAPALLEEARKLYCSYGLSQTINFNLQGFELSSQRDLRAMLE
                     AEGYNAPVAIYAIYLWMSAMSISRLCHYTNTLYVVGEPSSAADIFTASILRLFQFVLT
                     ANINAFDFGQYARQQDLVKMLYFPCTAHCNTFKDPVANQLLKGRSFTTMTRDGLVDIS
                     EKKCLVRLYQLPHPEHLPTAPDEHIIIRFYEPANGCGFFLGELSRYIHRIHQLQADND
                     NDALRALLCENKGMLCSRSWTSPCNACHSSHDI"
     CDS             complement(5366..6538)
                     /codon_start=1
                     /product="IVa2"
                     /protein_id="AP_000409.1"
                     /translation="MIAPRKRKAWEYEEEEYEASRDFYQRVTSWYDGAVDLAPQLFRE
                     QHFPSYDEFYSLGGVNEKFLEAHEEVKAQEQMDSRYLQHGQLPSINMGKQPIIGVIYG
                     PTGSGKSHLLRALISCNMLDPIPETVIFITPEKNMIPPIEQTSWNLQLVEANFDCRED
                     GTIAPKTSTFRPEFMEMTYEEATAPEHLNIDHPDNIYVKVSKRGPVAIIMDECMDKLC
                     SGSSVSVLFHALPSKLFARSAHCTAFYIFVVLHNMAPRTAIGNVPTLKVNAKMHILSC
                     HIPQFQFARFLYAFAHNISKDLVVLLKAYFSFLQQNQRFSWVMYTPDPVSESFRWCSI
                     DQQYSIIPLNVNIQERFLKTAKSIIKFSETHRKQLERNPKLTDLEKLSPPGTFQET"
     misc_feature    complement(5411..6484)
                     /note="Adenovirus IVa2 protein; Region: Adeno_IVa2;
                     pfam02456"
                     /db_xref="CDD:280594"
     misc_feature    complement(5822..6241)
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     CDS             complement(6501..10268)
                     /codon_start=1
                     /product="pol"
                     /protein_id="AP_000410.1"
                     /translation="MEADAGPPLTDSVLGPDSHVIRTISAKRLEETRKYFKSFRGNPL
                     RTNVYYIEEQPFRFQPTVFPIGLKKFLRTHRFLLSKRARGYDRIDYLHYARDPERSLP
                     DFKPAQVTVINFKGKTARLRTVHISEHPALPPMLIAKNVTGEWVWITSRTPVQQCPTC
                     GRHWVRRHSCNERRSAFYYHAVQGSGSDLWQHVHFSCPAQHPHIRQLYITYDIETYTV
                     FEKKGKRMHPFMLCFMLSGDPQLVSRAERLARQDDRLKALDEGFYWLDSHPGEVARRF
                     RNFRSRLQIEFAQNLVDRYAAANRDYCDQLVKDGKYGSVHKIPYELFEKPTSPLSLPD
                     NFYSVDIVVLGHNICKFDELLLATELVERRDLFPEACKCDRSFMPRVGRLLFNDIIFR
                     MPNPNYVKKDASRVERWSRGIVSHQDARSVFVRFMVRDTLQLTSGAKLSKAAAAYALD
                     LCKGHCPYEAINEFISTGRFHADADGFPVERYWEDPSVIAEQKNLWQKEHPGQQYDIV
                     QACLEYCMQDVRVTQKLAHTLHDSYDAYFQRELGMEGHFNIFVRPTIPSNTHAFWKQL
                     TFSNYVREQRATCPPSVPEPPKKKGRTKKKKQPSPDYVAEVYAPHRPMFKYIRQALRG
                     GRCYPNVLGPYLKPVYVFDICGMYASALTHPMPHGMPLDPKFTAQHVEELNRLLTNES
                     HLSYFDARIKPSILKIEAYPPPPEMLDPLPPICSRRGGRLVWTNEALYDEVVTVIDIL
                     TLHNRGWRVQVLHDEMNIVFPEWKTLCADYVTKNILAKEKADREKNEVIRSISKMLSN
                     ALYGAFATNMDTTRIIFEQDLSEADKKNIYEGTEIVKHVTLLNDDSFNGTEVTLENAP
                     NPFSEESLRQQFRYADDPEQEEPEAEEDGEEEGDDSDRESARKPKNALTEDDPLVAVD
                     LEVEATLATGPYIPEGELSSAHYARANETRFKPMRLLEATPEALTVLHLESLDKQVAN
                     KRYATQIACFVLGWSRAFFSEWCDILYGPDRGVHILRREEPRSLYGDTDSLFVTETGY
                     HRMKSRGAHRIKTESTRLTFDPENPGLYWACDCDIKCKACGSDTYSSETIFLAPKLYG
                     LKNSICVNEQCRTVGPGKIRSKGHRQSELIYDTLLRCWRRHEDVQFGAQSNIPELHTR
                     RTIFKTTLLNKVSRYDPFTIHNEQLTRVLRPWKDLTLYEHGDYLYPYDNEHPNPRTTG
                     DVRPVPIVGHEDPLAPLRWEPYAFLSEEECGQVHDLLFADDSSQEAESLGV"
     misc_feature    complement(7692..9134)
                     /note="DNA polymerase type B, organellar and viral;
                     Region: DNA_pol_B_2; pfam03175"
                     /db_xref="CDD:281206"
     misc_feature    complement(<7767..>8450)
                     /note="DNA polymerase; Provisional; Region: PHA02563"
                     /db_xref="CDD:222879"
     CDS             complement(join(10269..12155,15081..15086))
                     /codon_start=1
                     /product="pTP"
                     /protein_id="AP_000411.1"
                     /translation="MAAYRVFADLTGQSLATVRFCEPVITADYVLVREEPALVHPRSV
                     FLVSRVYDYRLMQLRDLAPRSPNVAAPPYNGLPPPHLLLGYQAMHRALNDYLFDNRVF
                     MQIGYDSPPQRPRRLFWTCLTDCSYAVNVGQYMRFLDLDNFHGTFTQMHNAVLMDRVA
                     ADMGRAHLRGRGIDVGRHGQVLPQLDAEHHSLLSGNGAGGLQEGVLMRTASAADAELL
                     AAIRQLRVALCHYLFCYAYDLFQTEERYRFLPGSDVFLEPNWLSYFAEAFAELDTQQL
                     VRDAERKFRGRRDVEEPTETMARCFMSTLASDAVSLAGTGLSGGAITLCSRRVTDRTG
                     LRPRDRHGRAITASEARRIRPRAVRAFVDRLPRVTRRRRRPPSPAPPPEEIEEAAMEV
                     EEPEEEEEELLDEVIRTALEAIGALQDELSGAARRHELFRFANDFYRMLLTARDAGLM
                     GESFLRKWVLYFFLAEHIASTLYYLYSHFIANREFRRYVDVLTLQVLVVGWDVNAQQV
                     FKRIWSEQSNPATIFETLWERILRDFLMMVERTGQFEGMDDADQQLFLSDIQYRDRSG
                     DIEEVLKQLNLSEELIDSIDISFRIKFKGIVAIATNEEIKANLRRVLRHRREDIEAAA
                     RRGQPL"
     misc_feature    complement(10323..11993)
                     /note="Adenoviral DNA terminal protein; Region:
                     Adeno_terminal; pfam02459"
                     /db_xref="CDD:280597"
     CDS             12193..13329
                     /codon_start=1
                     /product="52K"
                     /protein_id="AP_000412.1"
                     /translation="MHPVLQSVRNASVSAGGPHQQQPQQQQHGVSSVRRPPSPPRYPA
                     QHAYPGAGATPTAGRGDFDGALDPDEGPVACGLAAGAGVDEVRMRERDAARRATVPEI
                     NLFKARRDVVPNGDYERDLMYHSGQAIDIDRQRVLTPEDFKGSEPAFTPAVNHMRAAE
                     LKRAAEQTAFGEELRNTCHQTRIRTALLRPEIGAGIYYLYDFVQTYLEHPDGRVKLNP
                     QLVLVAQHAGNTMLAQRLWAIAEEKNAWLRDLIEMAYMIVNDPYLNTEQQLSAICTTV
                     VELSMKYAKLAAKNGYPSMAQMAKAQEFFYRVMQAVLDLGVQVGVYNNRPARYRQKRM
                     SEIPQMTDAEYMFGLTQALESRPPQGESFADEGPSESDDEDDFI"
     misc_feature    12400..13011
                     /note="Adenoviral protein L1 52/55-kDa; Region: Adeno_52K;
                     pfam03052"
                     /db_xref="CDD:145936"
     CDS             13316..15043
                     /codon_start=1
                     /product="pIIIa"
                     /protein_id="AP_000413.1"
                     /translation="MTSSDTFLALAPYGRQEVADALSSLPDGKDARSLRHAPYANRLI
                     KLQSAMVPPKVDGTSERVAEIVKGLAEQGAIYPDQMGAIHSDLLNRAYTWNSMGVQES
                     IQALVNDVIHGQNRTLQDELARTKEIANASLLTQFFDSLYKTVDRGQRNFEGFKKLLR
                     LFVNNVPNAEVYGSSGSFSVQINLGGSSQNINLTNAFENLKPIWGARWDAVNNPRIGA
                     LLTPNTRALLFFVSSFYDYGAMEPGSYLDNIMRLYKEAIRADVDAEGDAIMELGEAGA
                     NLNLRFNDYKDTLNYLLQNREVVPDTAPLELSAEQEMLLKYLMRQLRQALKDGVPADI
                     SISTMTQYLDPRLYQTNKVFVEKLQNYLLAAQARNPVYYRLLVLDPNWRPPAGLYTGN
                     YVIPDRYDFEDVQSELEYAGPSRDEYFDDSLFAPGPQRRLNSAEEAQLERDIESLTGH
                     IDEELGVQSQAGWLADHRLPVAFDGALSLTERNAYNTPLPPDSHMRSRSSSVASDLGL
                     LNLSGTGGPGFFASLRPSIGSRQPTGTAVGLRPTTPYSGSGCMRGTGLARKVLNPAAS
                     RRGRKLRFY"
     misc_feature    13496..14899
                     /note="Hexon-associated protein (IIIa); Region: Hex_IIIa;
                     pfam02455"
                     /db_xref="CDD:280593"
     CDS             15110..16657
                     /codon_start=1
                     /product="III"
                     /protein_id="AP_000414.1"
                     /translation="MYRSLRPPTSIPPPPPSGPSPYPAMINGYPPDVPVGSPANGDAE
                     LFVPLQRVMPPTGGRNSIRYRNYAPCQNTTKFFYVDNKLSDLDTYNEDANHSNFRTTV
                     IHNQDLDPSTAATETIQLDNRSCWGGELKTAVKTNCPNISSFFQSDTVRVRLMSKRDP
                     GGTDPDAGVNNPPGAEYKWYDLRIPEGNYALNEIIDLLNEGIVQLYLQEGRQNNVLKS
                     DIGVKFDTRYLDLLKDPVTGLVTPGTYVYKGYHPDIILLPGCAVDFTFSRLSLLLGIA
                     KREPYSKGFTITYEDLQGGNVPALLDLSSVQVDDQDEDVIVVADARPLLKDSKGVSYN
                     VITTGVTQPQTAYRSWLLAYHTLDSPARNKTLLTVPDMAGGIGAMYTSMPDTFTAPAG
                     FKEDNTTNLCPVVAMNLFPSFNKVFYQGASAYVQRLENATQSATAAFNRFPENEILKQ
                     APPMNVSSVCDNQPAVVQQGVLPLKNSLSGLQRVLITDDRRRPIPYVYKTIATVQPRV
                     LSSSTLQ"
     misc_feature    15275..16651
                     /note="Adenovirus penton base protein; Region:
                     Adeno_Penton_B; pfam01686"
                     /db_xref="CDD:279951"
     CDS             16679..16897
                     /codon_start=1
                     /product="pVII"
                     /protein_id="AP_000415.1"
                     /translation="MSILISPSDNRGWGANMRYRRRASMRGVGRRRLTLRQLLGLGSR
                     RRRRSRPTTVSNRLVVVSTRRRSSRRRR"
     misc_feature    16679..>16720
                     /note="Adenoviral core protein VII; Region: Adeno_VII;
                     pfam03228"
                     /db_xref="CDD:217438"
     CDS             16965..17495
                     /codon_start=1
                     /product="pX"
                     /protein_id="AP_000416.1"
                     /translation="MPSVLLTGGRTAKGKKRASRRRVKVPKLPKGARRKRASVTPVPT
                     VATATASERAALTNLARRLQRGDYAAWRPADYTSPAVSEAARAAASSGTPATARDLAT
                     GTLARAVPMTGTGGRRRKRTATRRRSLKGGFLPALIPIIAAAIGAIPGIAGTAVGIAN
                     LKEQQRQFNKIYGDKK"
     CDS             17559..18230
                     /codon_start=1
                     /product="pVI"
                     /protein_id="AP_000417.1"
                     /translation="MDYAALSPHLGGWALRDHHIGDSSLRGGAINWGNLGSRITSALN
                     STGRWLYNTGNRFVHSNTFNQIKQGIQDSGVIRNVANLAGETLGALTDIGRLKLQQDL
                     EKLRRKALGEEGPATQAELQALIQALQAQVAAGEPPAAPAAPAPAPPLVPTTRPIPEM
                     VTEVKPPVTSSAPAVPVDVPTTLEMRPPPPKRRRKRARPGQWRARLDSLSGTGVATAT
                     RRMCY"
     misc_feature    17565..18227
                     /note="Minor capsid protein VI; Region: MCPVI; pfam02993"
                     /db_xref="CDD:281051"
     CDS             18289..21117
                     /codon_start=1
                     /product="hexon"
                     /protein_id="AP_000418.1"
                     /translation="MTALTPDLTTATPRLQYFHIAGPGTREYLSEDLQQFISATGSYF
                     DLKNKFRQTVVAPTRNVTTEKAQRLQIRFYPIQTDDTPNSYRVRYSVNVGDSWVLDMG
                     ATYFDIKGVLDRGPSFKPYGGTAYNPLAPREAIFNTWVESTGPQTNVVGQMTNVYTNQ
                     TRNDKTATLQQVNSISGVVPNVNLGPGLSQLASRADVDNIGVVGRFAKVDSAGVKQAY
                     GAYVKPVKDDGSQSLNQTAYWLMDNGGTNYLGALAVEDYTQTLSYPDTVLVTPPTAYQ
                     QVNSGTMRACRPNYIGFRDNFINLLYHDSGVCSGTLNSERSGMNVVVELQDRNTELSY
                     QYMLADMMSRHHYFALWNQAVDQYDHDVRVFNNDGYEEGVPTYAFLPDGHGAGEDNGP
                     DLSNVKIYTNGQQDKGNVVAGTVSTQLNFGTIPSYEIDIAAATRRNFIMSNIADYLPD
                     KYKFSIRGFDPVTDNIDPTTYFYMNRRVPLTNVVDLFTNIGARWSVDQMDNVNPFNHH
                     RNWGLKYRSQLLGNSRYCRFHIQVPQKYFAIKNLLLLPGTYTYEWVLRKDPNMILQSS
                     LGNDLRADGAQIVYTEVNLMANFMPMDHNTSNQLELMLRNATNDQTFADYLGAKNALY
                     NVPAGSTLLTINIPARTWEGMRGWSFTRLKASETPQLGAQYDVGFKYSGSIPYSDGTF
                     YLSHTFRSMSVLFDTSINWPGNDRLLTPNLFEIKRPVATDSEGFTMSQCDMTKDWFLV
                     QMATNYNYVYNGYRFWPDRHYFHYDFLRNFDPMSRQGPNFLDTTLYDLVSSTPVVNDT
                     GSQPSQDNVRNNSGFIAPRSWPVWTAQQGEAWPANWPYPLIGNDAISSNQTVNYKKFL
                     CDNYLWTVPFSSDFMYMGELTDLGQNPMYTNNSHSMVINFELDPMDENTYVYMLYGVF
                     DTVRVNQPERNVLAMAYFRTPFATGNAV"
     misc_feature    18436..19929
                     /note="Hexon, adenovirus major coat protein, N-terminal
                     domain; Region: Adeno_hexon; pfam01065"
                     /db_xref="CDD:279414"
     misc_feature    20104..20826
                     /note="Hexon, adenovirus major coat protein, C-terminal
                     domain; Region: Adeno_hexon_C; pfam03678"
                     /db_xref="CDD:281648"
     CDS             21134..21754
                     /codon_start=1
                     /product="protease"
                     /protein_id="AP_000419.1"
                     /translation="MSGTTETQLRDLLSSMHLRHRFLGVFDKSFPGFLDPHVPASAIV
                     NTGSRASGGMHWIGFAFDPAAGRCYMFDPFGWSDQKLWELYRVKYNAFMRRTGLRQPD
                     RCFTLVRSTEAVQCPCSAACGLFSALFIVSFDRYRSKPMDGNPVIDTVVGVKHENMNS
                     PPYRDILHRNQERTYYWWTKNSAYFRAHQEELRRETALNALPENHV"
     misc_feature    21197..21733
                     /note="Adenovirus endoprotease; Region: Peptidase_C5;
                     pfam00770"
                     /db_xref="CDD:279154"
     CDS             complement(join(21899..23340,23455..23662))
                     /codon_start=1
                     /product="DBP"
                     /protein_id="AP_000420.1"
                     /translation="MAETLHPETISSDEDVADFVDLEEPGPSTVIKSNRGRSRPLPPQ
                     RPTGPKDPENPLEKQKSEDLPRSHPGPRKLQKTLPPSPAVVPDSEEEGEQELFETRDP
                     VTEAEVMERTPKRAHGFRSTKPVKRTAEVMMEEEEEEVEVVAPGRGATRKKVSRREES
                     PSPVRRVTRRRETVVDDEENASDEESPEAPLSDPVVYGAQRAMATVASICEALDLQWQ
                     GASVRPDDSIWTKMGGTYVRKKHPEFRLTFSSYDSFNAQVGRFLAAVIYSRAGLEPKF
                     VPGGAHVWRHGWFPALQEPFPKCMHGVDMVTKPRTVELNPSSEAGKRALAEQNGVIEK
                     NRFGRQVVVLRFDANAVCYKDQEHSGFPHPHAHGSCAMVFSDAAKAVSAMRHDIDWTK
                     ALYPNADKRRAEECVLISTNCNCNYASDRAISGRQFCKMTPYKLNGTDDITRDMVESR
                     PDMKAHKKNPHTMVFTCCNPQAASGGAGRGLKKTEKTCAWRLSAMDLRYAYVFATELF
                     TAVMGSSEPTHVPEFRWNESYAFKTEVLAPVSPIASDDPFA"
     misc_feature    complement(21902..23239)
                     /note="early DNA-binding protein E2A; Provisional; Region:
                     PHA03384"
                     /db_xref="CDD:223068"
     misc_feature    complement(22721..22957)
                     /note="Viral DNA-binding protein, all alpha domain;
                     Region: Viral_DNA_bi; pfam02236"
                     /db_xref="CDD:280410"
     misc_feature    complement(22355..22660)
                     /note="Viral DNA-binding protein, zinc binding domain;
                     Region: Viral_DNA_Zn_bi; pfam03728"
                     /db_xref="CDD:281690"
     misc_feature    complement(22016..22318)
                     /note="Viral DNA-binding protein, zinc binding domain;
                     Region: Viral_DNA_Zn_bi; pfam03728"
                     /db_xref="CDD:281690"
     CDS             23680..26634
                     /codon_start=1
                     /product="100K"
                     /protein_id="AP_000421.1"
                     /translation="MADKITREEKTIATLDLVLRVVVDAGNWDVFSKRLVRYTREQYG
                     IELPEDIGDLPDTSEVSKVLLSHLGEDKAVLSAYRIAELTQPSEMDRAKVTEGGLAVL
                     NASRDESEAQNPSNPEPESIESDAVEDLGVAAESDPSDDEPDPEPEYDHREADHDSDA
                     DSGYYSADGGRPGTPVDEEPQDDSPSSEETASTVIEEAQTSASNDSHDDDTHRDDGSA
                     SEEDLERDALVAPADPFPNLRKCFERQAMMLTGALKDAADTADPPETLSVDSVQRQLE
                     RFVFNPDRRVPAEHLEVRYNFYPPFLTPKAIASYHIFAVTASIPLSCKANRSGSDLLA
                     KAKESTFFKRLPKWRLGIEIDDGLGTEVTAVTELEEAKMVPLKDDVSRLQWAKMRGEH
                     IRFFSYPSLHMPPKISRMLMETLLQPFADENQKAEEALPCLSDEEVLAIVDPTGRLHG
                     EDALKAVEKRRAAVTMAVRYTATLELMERVFREPSMVKKMQEVLHHTFHHGFVALVRE
                     TAKVNLSNYATFHGLTYNNPLNNCIMSKLLEGADKEDYVVDSIYLFLVLTWQTAMGMW
                     QQAIDDMTIQMYTEVFTKNKYRLYSLPNPTAIGKAIVDILMDYDRLTEEMRKALPNFT
                     CQSQITAFRHFLLERSNIPAVAAPFMPSDFVPLAYKQSPPLLWDQVYLLQLAFYLTKH
                     GGYLWEAPEEEANNPSNRTYCPCNLCSPHRMPGHNAALHNEILAIGTFEIRSPDGKTF
                     KLTPELWTNAYLDKFDAEDFHPFTVFHYPENASRFASTLKACVTQSPEILSLIRQIQE
                     SREEFLLTKGKGVYKDPNTGETISRQPRDTARAQHAGDGQALPAPGAYTTGGNRAETA
                     PAGAVRLAPDYQDGQFPIAKVGPHYHGPKNVRREDQGYRGGPGGVRGEREVVLSRRAG
                     GRRFGRRNTRQSGYNERANRYFGRGGGGSVRGQQGEHPTTSPSASEPPAPSRILARGT
                     PPSPERRDRQEE"
     misc_feature    <23944..24378
                     /note="hypothetical protein; Provisional; Region:
                     PHA02664"
                     /db_xref="CDD:177447"
     misc_feature    24391..26142
                     /note="Late 100kD protein; Region: Adeno_100; pfam02438"
                     /db_xref="CDD:280578"
     CDS             join(26324..26630,26836..27119)
                     /codon_start=1
                     /product="33K"
                     /protein_id="AP_000422.1"
                     /translation="MAQRMLDEKTRVTEAGPEVYGESARSSFHEEQEEDVSDGETLGS
                     QDTTNGLTDISEEEEEDLFEGNKENIPPPRRPPRNRRLRAAYSLEEPLLPPSAATDKK
                     TTPHPSSHQKNTGAKAVRLRQDPVPQHIADLRGEILDILLEIESYARRRPDRHVSIRN
                     RTRESITRKLHYEKNEDKLTRMKSDAIKLLALWQTV"
     CDS             26324..26878
                     /codon_start=1
                     /product="22K"
                     /protein_id="AP_000423.1"
                     /translation="MAQRMLDEKTRVTEAGPEVYGESARSSFHEEQEEDVSDGETLGS
                     QDTTNGLTDISEEEEEDLFEGNKENIPPPRRPPRNRRLRAAYSLEEPLLPPSAATDKK
                     SKKVPKRRGKYRSWAKHRVAICQALRDAVFDRKKAGEILKRGHRLFVPATVIGYYARK
                     LSPSFLAPLSSHTAPLLPPKKHRR"
     CDS             27149..27886
                     /codon_start=1
                     /product="pVIII"
                     /protein_id="AP_000424.1"
                     /translation="MNLMNATPTEYVWKYNPVSGIPAGAQQNYGATIDWVLPGGTGFA
                     IATNDIRRQTLNPAVTRAITARFEAESDQQPYASPHETNVIAANVLDSGYPKSGLYPL
                     ELSGNQRVQLAGGLMVGRTEGRMQLAGGLTEGRVQLSGGFHGRPLVRGRSRRPPRWCG
                     AELTGNGLPEQAEVTSDTYKYFLRTQGPSQVVEEPGVFSQRQFMTTFLPSVVPHPFDS
                     TNPGDFPAQYSAIYKGRTAFEDTFWDW"
     misc_feature    27161..27874
                     /note="Adenovirus hexon associated protein, protein VIII;
                     Region: Adeno_PVIII; pfam01310"
                     /db_xref="CDD:279630"
     CDS             complement(<27894..28115)
                     /note="spliced to an unidentified coding region
                     downstream"
                     /codon_start=1
                     /product="U exon"
                     /protein_id="AP_000425.1"
                     /translation="MMSNPRKYWLRLNDQAVVRFDEPLNPGFVFWLRRRYRARVTSEG
                     GERVTVTRREPFNDRELEEIYCETEHRQQK"
     CDS             28114..30495
                     /codon_start=1
                     /product="fiber-1"
                     /protein_id="AP_000426.1"
                     /translation="MNEEVPLKRVSPDETETVPKKPRTDVRDTVRAGTDDTVDLVYPF
                     WWNLGTGGGGGGGGGGGGSGTSLQPNDPLYAASGTINLRMTSPLTLSQRALALKTDST
                     LTLNTQGQLGVSLTPGDGLVLNTNGLSINADPQTLAFNNSGALEVNLDPDGPWSKTAT
                     GIDLRLDPTTLEVDNWELGVKLDPDEAIDSGPDGLCLNLDETLLLATNSTSGKTELGV
                     HLNTSGPITADDQGIDLDVDPNTMQVNTGPSGGMLAVKLKSGGGLTADPDGISVTATV
                     APPSISATAPLTYTSGTIALTTDTQTMQVNSNQLAVKLKTGGGLTADADGISVSVAPT
                     PTISASPPLTYTNGQIGLSIGDQSLQVSSGQLQVKLKSQGGIQQSTQGLGVAVDQTLK
                     IVSNTLEVNTDPSGPLTSGNNGLSLAAVTPLAVSSAGVTLNYQSPLTVTSNSLGLSIA
                     APLQAGAQGLTVNTMEPLSASAQGIQLHYGQGFQVVAGTLQLLTNPPIVVSSRGFTLL
                     YTPAFTVSNNMLGLNVDGTDCVAISSAGLQIRKEAPLYVTSGSTPALALKYSSDFTIT
                     NGALALANSGGGGSSTPEVATYHCGDNLLESYDIFASLPNTNAAKVAAYCRLAAAGGV
                     VSGTIQVTSYAGRWPKVGNSVTDGIKFAIVVSPPMDKDPRSNLSQWLGATVFPAGATT
                     ALFSPNPYGSLNTITTLPSIASDWYVPESNLVTYTKIHFKPTGSQQLQLASGELVVAA
                     AKSPVQTTKYELIYLGFTLKQNSSGTNFFDPNASSDLSFLTPPIPFTYLGYYQ"
     misc_feature    29860..30471
                     /note="C-terminal head domain of the fowl adenovirus type
                     1 long fibre; Region: AdHead_fibreRBD; pfam16812"
                     /db_xref="CDD:293417"
     CDS             30536..31768
                     /codon_start=1
                     /product="fiber-2"
                     /protein_id="AP_000427.1"
                     /translation="MADQKRKLADPDAEAPTGKMARAGPGELDLVYPFWYQVAAPTEI
                     TPPFLDPNGPLYSTDGLLNVRLTAPLVIIRQSNGNAIGVKTDGSITVNADGALQIGIS
                     TAGPLTTTANGIDLNIDPKTLVVDGSSGKNVLGVLLKGQGALQSSAQGIGVAVDESLQ
                     IVDNTLEVKVDAAGPLAVTAAGVGLQYDNTQFKVTNGTLQLYQAPTSSVAAFTSGTIG
                     LSSPTGNFVSSSNNPFNGSYFLQQINTMGMLTTSLYVKVDTTTMGTRPTGAVNENARY
                     FTVWVSSFLTQCNPSNIGQGTLEPSNISMTSFEPARNPISPPVFNMNQNIPYYASRFG
                     VLESYRPIFTGSLNTGSIDVRMQVTPVLATNNTTYNLIAFTFQCASAGLFNPTVNGTV
                     AIGPVVHTCPAARAPVTV"
     misc_feature    31166..31456
                     /note="Avian adenovirus fibre; Region: Av_adeno_fibre;
                     pfam06536"
                     /db_xref="CDD:284054"
     CDS             complement(31812..32429)
                     /codon_start=1
                     /product="ORF22"
                     /protein_id="AP_000428.1"
                     /translation="MNDEQILEMVLQHQQRRQQEAEREEEVGDDMEDDEDDDGLQMPT
                     PLHAYQLLCYDSFELHFGGCACHGLPLHRMGLSACHLAPSDLATYVWARLEDDLNVAG
                     VYFVAMWASPGFSDFSPVFMQRPIGNVCGMLIHVDLHSRLPFLIAVSRLGEAGGSPCL
                     YMRKIDVDLDTQRVHFYTEDWFSEFANLLYYWQMSEWKHLAERMQ"
     CDS             complement(join(32431..32895,33886..33906))
                     /note="contains transmembrane domain"
                     /codon_start=1
                     /product="ORF20A"
                     /protein_id="AP_000429.1"
                     /translation="MALCPLSLITCLILQCCGRYWREFLALLVALSYSSIILCSFLFL
                     QNHLSSLNFVISVFVCSTFLVYLALGSLLYGLYRVDKDLAVPSLHSRSPSPDPLPAPI
                     SRWPGSRGGNWTVSSNPWYFELQETGAAASLASTAPLTAPPPSVVSSDDEEHPYAIIP
                     D"
     CDS             complement(join(32892..33809,33886..33906))
                     /codon_start=1
                     /product="ORF20"
                     /protein_id="AP_000430.1"
                     /translation="MALCPLSESLTVSRACGFHNEVGVIWFSFLLRHDPTCRQEEMER
                     LNEYRINRAVASLRCFDNDLMRRLHSSVTVLVTVRSAKFVCFKRRDYVLMNCIVRIVS
                     ALHLNRAEKTALLHYLSRRLLFITPGMKYDLEPWMLARRKTDFKFFTTGFLIAEKISV
                     KMALRSMSFEVSFSQVPSSVPFVRSPVVLMNACRVTVTATIMVETISRSSAVTQPVCL
                     RSMLRVMVSPELWPIVSQGLCYFPGYRRLSYANVEEWVFHVHGKYGESHPECFGQCKQ
                     CSTRQPLSLFCSAQLAYLRNVFMERRARVAGERPYS"
     misc_feature    complement(34238..36144)
                     /note="nonfunctional ORF19 due to frameshift"
     CDS             37391..38239
                     /codon_start=1
                     /product="ORF8"
                     /protein_id="AP_000431.1"
                     /translation="MARNPFRMFPGDLPYYMGTISFTSVVPVDPSQRNPTTSLREMVT
                     TGLIFNPNLTGEQLREYSFSPLVSMGRKAIFADYEGPQRIIHVTIRGRSAEPKTPSEA
                     LIMMEKAVRGAFAVPDWVAREYSDPLPHGITHVGDLGFPIGSVHALKMALDTLKIHVP
                     RGVGVPGYEGLCGTTTIKAPRQYRLLTTGVFTKKDLKRTLPEPFFSRFFNQTPEVCAI
                     KTGKNPFSTEIWCMTLGGDSPAPERNEPRNPHSLQDWARLGVMETCLRMSRRGLGSRH
                     HPYHSL"
     misc_feature    37688..>38029
                     /note="tRNA-splicing ligase RtcB; Region: RtcB; pfam01139"
                     /db_xref="CDD:279481"
     CDS             complement(38717..39256)
                     /codon_start=1
                     /product="ORF17"
                     /protein_id="AP_000432.1"
                     /translation="MPLYLCFGAAAPVSILWREELFWGFVAAVKRRWHTVYARTNVDI
                     QYPMAYCVGIQSLSPCKCHVTVVVCLTFLDLRMSAINEATKIMRAFFKTFFYHHGKVP
                     RGRWFKLYRNDWCKDPNLTVGNYIVASGALPLMLGWARSTGLRFSTFTYSDEALWSHR
                     RRDRRLARRREKLENKVSG"
     CDS             complement(39286..39705)
                     /codon_start=1
                     /product="ORF16"
                     /protein_id="AP_000433.1"
                     /translation="MYYFHLRVTLMEPNLAVFHDLKLTVINAWESLTVEMLSHYSVDY
                     LFRLEEFAGVYSASIFLPTHKVDWTFLKRAVALLRECIWRRFECTQVPRGVASIYAVR
                     NTWTPSANRVARHFVKRGALVGMQPCLHECTYERDAC"
     CDS             40082..41002
                     /note="probable membrane glycoprotein; member of family
                     containing FAdV-1 ORF9, ORF10 and ORF11 and FAdV-9 ORF11
                     and ORF23"
                     /codon_start=1
                     /product="ORF9"
                     /protein_id="AP_000434.1"
                     /translation="MGNPTLLLLSGLLSLTQAISIGEHENKTRHVIVWRHSSSHQCSD
                     WRTVTEWFPPQKGNPVRPPYTQRVSLDTANNTLTVKPFETNNGCWETTSQGINHPPTT
                     IQYRVWNITTTPTIQTINITKITVREGEDFTLYGPVSETMSIIEWEFIKDVTPQFILQ
                     YYLSINSTIVYASYQGRVTFNPGKNTLTLKGAKTTDSGTYKSTVNLDQVSVHNFRVGV
                     TPIEKKEEATAETPASKPTPIPRVRADARSTALWVGLALCILTVIPALIGWYFRDRLC
                     VPDPIIELEIPGQPHVTIHILKGPDDDCET"
     misc_feature    40466..40729
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:299845"
     CDS             41113..41853
                     /note="probable membrane glycoprotein; member of family
                     containing FAdV-1 ORF9, ORF10 and ORF11 and FAdV-9 ORF11
                     and ORF23"
                     /codon_start=1
                     /product="ORF10"
                     /protein_id="AP_000435.1"
                     /translation="MDPRPLVLLLLLASHISTFRQMYFEGETIHFPMGIYGNETTLYM
                     NDIILEGTRANTTTRTISLTTTKKNAGTNLYTVISETGHNATYLITVQPLGQSIHHAY
                     TWAGNTFTLQGQVFEHGNYTRWVRLENAEPKLIISWALSNRTINKGPAYTANMDFDPG
                     NNTLTLHPVLITDAGIFQCVIDQQTNLTLTINFTVSENPPIVAHLDIHKTISRTIAIC
                     SCLLIAVIAVLCCLRQLNVNGRGNSEMI"
     misc_feature    41428..41685
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:299845"
     CDS             join(41958..42315,42385..42645,42720..42973)
                     /note="related to leukocyte adhesion molecules such as
                     CD48; contains immunoglobulin domain; probable membrane
                     glycoprotein; member of family containing FAdV-1 ORF9,
                     ORF10 and ORF11 and FAdV-9 ORF11 and ORF23"
                     /codon_start=1
                     /product="ORF11"
                     /protein_id="AP_000436.1"
                     /translation="MLLLTVVLLVGVTLAADHPTLYAPKGGSIELGVGAKQKGQYKFE
                     WRFGNLKIVIAEMSSTNQLEIKFPDNGFQNRSEFNPTKHNLTIHNASYEDSGTYSLHQ
                     EENDGTEHTDNFKVIVQDPIPRPEVKGTTMQINGKTFTNISCHLPAGSYGNVSWHWNY
                     TDPIIVGYENQSMLVGPLGVMYSCTASNQVSKNSSAISMDTAEPSERAECAYTGYIAG
                     IIILGVLCILFIYLYANTPEVRQRITDQLEKLLGTFCDVSIEDGIPERTRRNKKRIIL
                     KEPSHRWIWIQSFA"
     misc_feature    42012..42311
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    join(42111..42315,42385..>42401)
                     /note="envelope glycoprotein E; Provisional; Region:
                     PHA03283"
                     /db_xref="CDD:223032"
     CDS             join(43073..43255,43327..43436,43531..43663)
                     /note="C-type lectin"
                     /codon_start=1
                     /product="ORF26"
                     /protein_id="AP_000437.1"
                     /translation="MLPPIGCDRLPEFDVVCPRDWIGFQSKCYYFSESESNWSEAEKF
                     CRQQEAELAVRRSEEEKEFLLRQCGTGTNWLGVTRKSKDGADWVDASYDDYVPWYEIR
                     GGGDCVYLNGDRVTSAYCDTQKLFVCSCQDSYSYWLENK"
     misc_feature    join(43121..43255,43327..43436,43531..43627)
                     /note="C-type lectin-like domain (CTLD) of the type found
                     in natural killer cell receptors (NKRs); Region:
                     CLECT_NK_receptors_like; cd03593"
                     /db_xref="CDD:153063"
     misc_feature    order(43357..43359,43535..43537,43577..43579,43583..43588)
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153063"
     repeat_region   43751..43804
                     /note="ITR"
                     /rpt_type=inverted
ORIGIN
       1  GATGATGTAT AATAACCTCA AAAACTAACG CAGTCATAAC CGGCCATAAC CGCACGGTGT
      61  CACTCGGGTA CAAATTATGA ATTCGATCTT TGGACTTTTC GACGCGCCCA GTGACTGTAC
     121  TTTATTGCGC CAATTCACCA CGCCCGGGAG ATTTCGAAAT TGCTATTTCC GTGCAGTTCC
     181  GCATTCCGAA GTACAATTTA ACCGGTTTTA TGGGTGTTCG GTGTTTTTCT AGCTTAATCA
     241  TTGTTTTTAG ACGACACAGT GGGTATCTGT TTTCGCTTGG ACTTGGCTCC GCTTTGTGAA
     301  AATTCAACTC GATCCAACAT TTTCCTTATT GATGGAAGGC TTTTATTATT TGCACAACAG
     361  ACATCGCGCT ATTTACACAG AACGCAAAGT GCTGTCTTTT TTATTCCTTG TTCCGGGTAC
     421  ATCTTTTATT GCTAGTGCCT CGCCTATTTT TAGTCACGTA TCTTCCTTGT TCTATAGCTA
     481  TATATTCACG CGGTTTTCGG TCTCTCCTCA CTCGGCAGAT GACTTCGGAA GAGAAGCTGC
     541  AGAGTTCGTC TCCGGAGACC GGCCTCGCCG CTGTCGTCCT GCAAAGCCCC CTTGAGGTAC
     601  GTGTGCCTGC CGTTCTTCCT CCTCCAGTGC GAATTGACAT CTACCGCTAC CCAGGCTTTC
     661  CGCCAACGGA GACCATCTGG CACGGTCTCA TCACGCAGAC TGAGTTAAAC CAGGCTTTGG
     721  AGAGCATCGT TGAGCAATTG TAGTAAGTGT CAGTCCCTAT TTTTCTGTTT TTTCTTGTAT
     781  TTCCTCTTAG ACGATGGACC CGTTCGGTTC TTCTTCAGTC CCTCCGTGCT CTACATCAGA
     841  CCTTCCCGAA CCCAAGCTCT ATTTCGTCCG CTTGTCACCC CATGCAGTGC CTCCAGTTAG
     901  GGCTACGCAC GGAGCTGCAG GATACGATTT GTTTAGCGCT TACGACATTA AAGTGCCTGC
     961  TCGCGGTCGG GCGCTAGTTC CCACAGATTT AGTTTTTCAA TTTCCGCCCG GCTGTTACGG
    1021  TCGGATTGCT CCTCGCTCGG GCTTGGCCGC CAAATTTTTC ATTGACGTCG GAGCGGGTGT
    1081  TATCGATCCC GATTACCGCG GGAACGTTAG CGTGGTTTTG TTCAATTTCT CCGAGAGCTC
    1141  GTTCAACATC AGGCGAGGCG ATAGGGTAGC ACAGCTTATT CTGGAGCGTA TTATGGTTCC
    1201  GGAGCTGTCG GAACTGACGC AGCTAGGCGA GACAGACCGC GGGGCGTCGG GTTTCGGGTC
    1261  CACAGGTATG GGTGCTGTAG ACCGCAATCA GCGCTCTGTG TTGGAATGGC TGACCCCTGG
    1321  TTCCCGTTGA TAGGACCCTT GCGACGAAGT CGACTTCGCT GTACGCTTGC AAGCAGATTT
    1381  TGAGGGGGAC GACGACACAT ACGGACATTG TCTGTGCGAA GGCAGCACCA GCAAGAGGCC
    1441  CTGCTGTACG CTCTGTAACA GTTACTGCGT GCTTCTTTAG GTATGATTGT GAGCGTGTGG
    1501  CAGCTCGCGA CCATCGCGAT TGAGTTTTGC GATAAGTGGG TGGGGAAATA CTACAGATTC
    1561  CGACCGTATC ATGAGAGACT TTTGCTTATG CAGAGTCGGC AAGCTTTGGA AAGGAGCTTG
    1621  CGCCGCTGCG TAAGTGAAGT TGGACCTCCG CCAGAGCCTC TAGAATAGCG ATGGAGTCCG
    1681  GCGCACGTGG TGCTTCCTGA CTTTCTGCAC CATTACCGTG GTGTTTCTGG CCTTCTTTCT
    1741  GCAGAAACTT CTCAACTACA TAGATTTCAG AGATAGCGAC TGCACAGAAT GTTTTTTTGT
    1801  GTAGTTGACA GGACTATGGA CCAGACAGCA ACCCATACAG CTTTGATTCT TCTGATCGTC
    1861  TTGACGGTGT TCACGGGCGC GGTGGTAGCT TTGATGTTGT ATATTGCGAT AACTGGACTT
    1921  CCTTGCTCTA TGCTTTGCTC TCAATAAAGA TTTTCAGAAT GGTGATTCTA TGGTATTTTG
    1981  TCTTTTTTCT AGACAGTCAT GTCGCGTGAG TCTGAACGTT ACTGGACTTT GGTGCACGCT
    2041  CTGATTGATC GGGGTGTAGT CAGCCGTGAA CAGTGGCAAA TGGTTGACCC TGCGCAATAC
    2101  CAGTTCTACC ACCGCTCCAA ACAGAGGGGT TTTAAGGTCC GTCACATTCT TCGTGATGTG
    2161  ATTCGCCACA TGTGTTGGTC TCGGACTCTG TTAGATTATA TGTCCTCGGC CTCGACACCT
    2221  AGTCCGGACG ATGTATTACG CAATCCCCTG TATCAGTTGC TGTTATGTAA TGGATATAAC
    2281  CCCGCTGTTG TGGGGACAGC GCTGATCCGG TGGGCGGGCC ATCAGAGCAA CCGTAACACT
    2341  GTTTGGATTC GAGGCACCCC TATGTCCGGA GCTCCGTACT TGGCACAGGC TATCGCGTAC
    2401  TGCTCTCCCC TCGTAGGGAG CGTTGATTGG CGCAACAAGT CTAACCCATT CGAAGGGTGT
    2461  CCAGATAGTC TGGTGTTTTG GTGGGACGGC GGTTATGTTT ATGATTGTTG TGTGGGTCTG
    2521  GTGAAGCAGG TGTTCCGGGG AGAACATGTT ATTTTGCCTC CTGAGGGCTT GCGTGGCCCC
    2581  AACCCGTGCT CTGAACTCTT CAGGACCCCA GTCTTGATGT ACAGCCAGGC GGATATTTGT
    2641  ATGACTAGGC TGAGATCAGG GGAACTAAGT GCAGAGCATG CGGTGGGCCT CAGGGATTGT
    2701  ATGTACCTGA TCCGTTTGAC AGAAGATTTT GACTGCGCGG GTGGTATATC GTGTGCAGAT
    2761  GTCAAACAGT TTGTGGCGTG GAGCCGCGAA CACCCTGGGG AGGTTCGCGA GACCCACGAA
    2821  CTCAAATAAA AATTCGGGAC TTCTGTGTAC GTTCCTTTTC ATGTTTATTA AACACTGTTC
    2881  TTTCGAGTGA GTCATATCAC GTGGAAGTTA ATTGCGACTG GGAGCCGCAG AAGCAGGTGG
    2941  TAAAAGCAAG CTATGCAGGG ATAGTTTACG ATGTCCCTTG GAAGACAGAC ATAGAGTGTT
    3001  TGTCCTTCCA GTCGCGTGTA GGCGCCTTGG CGCCGCGCAA CGGTTACTGC TGTATATATT
    3061  TGTTCGAGGG CAGGGTTCAA GTTGCATAAC CTGCAGTGAG TAGCATATGT GTATAAGATG
    3121  AGATTAAGAG GGAGTTGGGG CTGGTGGTCG TGTTGAGCAA CGAAATTGAC GACCGTTTTG
    3181  GCCCAGTGAG CTGTAAGCAC TCGGATGAGG GATAAACAAA AGAGGGAACG GGGTGTCTCG
    3241  CAGCTGCAGA TGTACTGGAT AGTCCAGTCG GTACATCGCA TCTCAATAAC TCTTATCCAG
    3301  CTGCAGAATG ACCTGAGCTG GAGGTCACAC TCTTCGTCCG TAATGCAGTG GGGCGAGTGC
    3361  TTGAAGGGGT ACATCTGTCT TTTAAGGAGA AAGAGTAGGA AATCGGGATC TGTGATTAGG
    3421  GTAATGCCCA CGCGCGTGAA CAGGGGCTCG ATGTAGATAT GCCAACTGTG TTGGGGCTCG
    3481  TCCTCATCGT TGTCACTATC CCAAACAAGG TCGCACGACT CGAATGTCTG TAAAACATCA
    3541  AAAGTTTATT ACTGATTTTG AAGAGGGGTA CGTATACAGG GGTTACAGAG TTTATTATCG
    3601  CGTTTGCAAT GCAGTGTCAT TAAGCAAGCA CAAGCGGCAG CATTAGCAAC AAAGTCGCGT
    3661  AGCTCTTTGC GCGGGTGGTA GCATGGAGGG GTCTTGGTGT GGTCTCCTGT GAGGAAGAAG
    3721  ACGACCGTGT TCCGCGCCGT GAACTCGTTG GCGAGCGAGA GGTCCGCGCA GTGGATTAGC
    3781  ATGGGGGTCG AGGGGATGTG GAACGTTTTC TTATTCAGCC TGCAGGTGGC AGCATTGCCT
    3841  TCCATAAAGT GCAGCATCAA CGGGTCCGGC TTCTCGTCTA CGAAGGGCAG ACAGTATAGA
    3901  GAGGCGTGGG GTGCGATTTC GCCCAGTGAT AGTATGGAGT TGATTCGGCT GTCGGAGATC
    3961  GCGAGCGGGA AACACGCGCA TAAGGCATTA AAGAGACTCT TGGCGTTGGA AAGTCTTCCT
    4021  CCGCAGAGCA CGAGGGTGTT TAGTTCTCCT CGGAGCCATC GGAGGATGGC GTTAGCTGCC
    4081  ACTTTTCCCT CGTAGCCTTC GGCTTCCATC ATCTGATGGA ACCAGTTGTC GCAGACGTTG
    4141  TAGAACGCAG CCTTGAGGGT GTCGGGCTCT TCGGAGGGTA ACTGGTTAAT GAGGCTCTGT
    4201  CCGGGTCCGA ACCGTTCCTT GAGGGCTTCG AGTACACGCT CTCGTTCGTA GGTGGGTATG
    4261  AGGTTCTTGG ACGGGAAGTT CCACTGGACT TCGTGTGCTA CACCTTCGAC AAACAACCGT
    4321  TCAACCAACT GATCCATGGG GGACGTGGAC GGAAATAAGC AGGGTGAAGG GGTGTCTGGA
    4381  ATGCAGGATG CTATTTGCTC CTCTTCGCTA CTTAAAGACG ACTGAGACTC GCGTCGCCTC
    4441  TTGGTGCACT GTGGGAGAGA ATTATATGTC ATGTGATGAG TGACAAGCAT TGCATGGGGA
    4501  GGTCCACGAG CGGGAACAGA GCATTCCTTT GTTCTCGCAT AGGAGAGCGC GCAAGGCGTC
    4561  GTTGTCATTA TCTGCCTGTA ATTGGTGTAT GCGATGAATG TAGCGGGAGA GCTCTCCCAG
    4621  AAAGAACCCG CAGCCGTTGG CGGGTTCGTA GAACCTAATA ATGATATGTT CGTCGGGAGC
    4681  AGTGGGCAGA TGTTCGGGAT GGGGGAGCTG ATATAAGCGG ACGAGGCATT TTTTCTCACT
    4741  GATGTCCACG AGACCGTCGC GGGTCATTGT GGTGAATGAC CTGCCTTTCA GCAGCTGGTT
    4801  AGCAACGGGA TCTTTGAACG TGTTACAATG AGCTGTGCAG GGGAAATAAA GCATCTTGAC
    4861  TAAATCTTGC TGTCTGGCGT ACTGGCCAAA GTCGAACGCG TTAATGTTGG CAGTGAGGAC
    4921  AAATTGGAAT AATCTGAGGA TGGATGCAGT GAATATATCT GCGGCAGAGG AAGGTTCTCC
    4981  TACGACATAG AGCGTGTTAG TATAATGGCA CAGGCGACTA ATGCTCATGG CAGACATCCA
    5041  CAGATAAATG GCGTAGATGG CTACCGGAGC ATTGTAACCT TCGGCTTCTA GCATGGCTCG
    5101  GAGATCTCTT TGTGAGGACA GCTCGAAGCC TTGCAGATTG AAATTGATCG TTTGACTGAG
    5161  CCCGTAGCTG CAGTATAATT TGCGCGCTTC TTCCAGAAGC GCGGGGGCGA CCGATTCGAA
    5221  TAGTTCAGCA TCTTGGGGAT ACCGAGTGAG CCAATCTTTG TAGGTAAAGA TGTTGTTTCG
    5281  CTGGAGATCG AATATTAGCC TGTGTGTGAC TAAATCGTCG TCGTCTTCTC CCGTGTGGCG
    5341  GTTCCTGAGT CTCTTAACGC TATCCTTAAG TTTCCTGAAA CGTTCCTGGG GGAGAAAGTT
    5401  TTTCGAGATC GGTTAGTTTG GGGTTTCTCT CTAACTGCTT TCTATGTGTT TCGCTAAATT
    5461  TGATGATAGA TTTGGCTGTT TTCAGGAATC TCTCCTGAAT GTTAACATTG AGAGGGATGA
    5521  TCGAGTACTG CTGATCTATA CTGCACCACC TAAAGGACTC GGATACTGGG TCCGGAGTGT
    5581  ACATGACCCA GCTGAACCGC TGGTTCTGCT GCAGGAAGGA AAAGTAAGCT TTGAGAAGGA
    5641  CAACGAGGTC CTTCGAGATG TTGTGTGCGA ACGCATAGAG GAACCTAGCG AACTGGAATT
    5701  GGGGAATATG ACAGGATAGG ATGTGCATTT TCGCGTTCAC TTTGAGGGTG GGAACGTTTC
    5761  CTATCGCGGT GCGCGGTGCC ATGTTGTGCA AGACTACGAA AATGTAGAAG GCTGTACAGT
    5821  GGGCAGAGCG AGCAAAGAGC TTAGAAGGAA GGGCGTGAAA GAGGACAGAG ACGCTGGAGC
    5881  CTGAACAGAG CTTATCCATG CACTCGTCCA TGATAATGGC GACGGGTCCC CGCTTGGAGA
    5941  CTTTCACGTA AATGTTGTCT GGATGGTCGA TGTTGAGATG TTCGGGTGCG GTGGCCTCCT
    6001  CGTAAGTCAT CTCCATAAAT TCGGGACGGA ACGTGCTTGT CTTAGGGGCG ATGGTGCCGT
    6061  CTTCCCTGCA GTCGAAATTG GCCTCGACCA GCTGCAGGTT CCAGGACGTC TGTTCGATGG
    6121  GTGGAATCAT GTTCTTTTCC GGAGTGATGA AGATGACCGT TTCGGGGATC GGGTCCAACA
    6181  TGTTGCACGA GATGAGCGCC CGCAGCAGAT GCGACTTGCC GGATCCGGTG GGTCCGTAGA
    6241  TGACCCCGAT GATGGGCTGC TTGCCCATGT TGATGGACGG CAGCTGTCCG TGTTGGAGGT
    6301  AGCGACTGTC CATCTGTTCC TGGGCTTTAA CTTCTTCGTG GGCTTCGAGA AACTTCTCAT
    6361  TAACGCCCCC TAGGCTGTAG AACTCGTCGT AGGAGGGGAA GTGTTGCTCG CGGAAGAGCT
    6421  GCGGTGCTAG GTCGACAGCT CCGTCGTACC AGCTGGTGAC GCGCTGGTAG AAGTCCCGCG
    6481  AGGCTTCGTA CTCTTCTTCC TCATACTCCC AGGCTTTCCG CTTCCTGGGA GCTATCATCT
    6541  GCGAAGAGTA GGTCGTGAAC TTGCCCGCAT TCCTCTTCGG ATAGGAACGC GTAGGGTTCC
    6601  CATCGTAGGG GTGCGAGGGG GTCTTCGTGC CCGACGATTG GGACGGGTCG TACGTCTCCT
    6661  GTCGTGCGGG GATTTGGGTG CTCATTGTCG TAGGGGTACA GGTAGTCCCC GTGCTCGTAT
    6721  AGGGTGAGGT CCTTCCACGG ACGCAGCACT CGCGTGAGCT GCTCGTTGTG AATGGTGAAA
    6781  GGGTCGTAGC GACTGACCTT GTTCAGAAGC GTGGTTTTAA AGATGGTTCT CCGCGTGTGT
    6841  AGCTCTGGGA TGTTGCTCTG CGCTCCGAAT TGCACGTCCT CGTGTCTACG CCAACAGCGC
    6901  AGCAGCGTGT CGTAGATGAG TTCGGACTGC CTGTGTCCCT TCGATCTGAT TTTCCCGGGT
    6961  CCTACCGTGC GGCACTGTTC GTTGACGCAG ATTGAGTTTT TCAGTCCGTA CAGTTTTGGC
    7021  GCTAGGAAGA TGGTTTCCGA GCTGTACGTG TCACTTCCGC AGGCTTTGCA CTTGATGTCG
    7081  CAATCGCAGG CCCAGTAGAG GCCGGGATTT TCTGGATCGA AAGTCAGTCG AGTGGATTCT
    7141  GTTTTGATTC GGTGCGCGCC GCGGCTTTTC ATGCGATGAT AGCCTGTTTC TGTGACGAAC
    7201  AGGCTGTCGG TATCGCCATA GAGGCTGCGC GGCTCCTCCC TTCGCAGGAT GTGCACTCCT
    7261  CTGTCCGGTC CGTACAGGAT GTCACACCAC TCGCTGAAGA AGGCCCTCGA CCAGCCCAGC
    7321  ACGAAGCAGG CGATTTGCGT GGCGTATCTT TTGTTTGCCA CCTGCTTGTC CAGGCTTTCC
    7381  AGATGGAGCA CGGTTAGGGC TTCTGGTGTG GCTTCGAGGA GACGCATAGG TTTAAACCGG
    7441  GTCTCGTTAG CGCGAGCGTA GTGGGCGGAG CTTAGCTCCC CCTCGGGTAT ATAAGGGCCC
    7501  GTCGCGAGGG TCGCCTCGAC TTCCAGGTCT ACGGCGACGA GAGGATCGTC TTCGGTAAGT
    7561  GCGTTTTTCG GCTTACGGGC ACTCTCGCGA TCGCTGTCGT CTCCTTCTTC TTCCCCATCC
    7621  TCTTCTGCTT CGGGCTCTTC CTGTTCGGGG TCGTCTGCGT AGCGGAACTG TTGTCGTAGA
    7681  CTCTCCTCAC TGAAGGGGTT AGGCGCGTTT TCGAGGGTGA CTTCCGTTCC GTTGAACGAG
    7741  TCGTCATTGA GCAGCGTGAC GTGTTTGACG ATTTCAGTGC CTTCGTAGAT GTTTTTCTTA
    7801  TCTGCTTCCG AGAGGTCCTG TTCAAAGATG ATGCGCGTGG TGTCCATGTT GGTGGCAAAC
    7861  GCACCGTACA GCGCGTTGCT CAGCATTTTG GAGATGGATC GAATCACTTC GTTCTTCTCG
    7921  CGATCGGCTT TTTCTTTGGC GAGGATGTTT TTCGTGACGT AGTCGGCACA TAGCGTTTTC
    7981  CATTCCGGAA AAACAATGTT CATCTCGTCA TGGAGGACCT GGACTCGCCA TCCCCGGTTG
    8041  TGCAGCGTGA GGATATCTAT GACGGTGACC ACCTCGTCGT AGAGAGCCTC GTTGGTCCAG
    8101  ACCAGTCTGC CTCCCCTCCG GGAGCAGATG GGAGGGAGTG GGTCTAACAT TTCGGGCGGG
    8161  GGAGGGTAGG CTTCTATTTT CAGGATGGAA GGCTTGATAC GCGCATCGAA GTAGCTCAGA
    8221  TGCGATTCGT TGGTCAGCAG CCGGTTGAGC TCCTCCACGT GCTGCGCGGT AAATTTTGGA
    8281  TCTAGGGGCA TTCCGTGGGG CATGGGGTGG GTGAGGGCGG AAGCGTACAT GCCGCAGATG
    8341  TCAAAGACGT AGACGGGTTT CAGGTAAGGT CCGAGCACGT TGGGGTAGCA TCGTCCGCCG
    8401  CGGAGCGCTT GGCGTATGTA TTTGAACATG GGGCGGTGGG GGGCGTAGAC TTCGGCCACG
    8461  TAGTCGGGGG AGGGTTGTTT TTTCTTTTTG GTTCGACCTT TCTTTTTGGG GGGTTCGGGG
    8521  ACGGAGGGAG GGCATGTCGC ACGCTGTTCG CGGACGTAAT TGGAAAAGGT AAGTTGCTTC
    8581  CAAAAGGCAT GAGTGTTGCT GGGGATGGTG GGCCGCACGA AGATGTTAAA ATGGCCTTCC
    8641  ATCCCTAGTT CTCGTTGGAA ATAGGCGTCG TAGCTGTCGT GTAACGTGTG GGCCAGCTTT
    8701  TGGGTGACGC GGACGTCCTG CATGCAGTAT TCGAGGCACG CTTGGACGAT GTCGTACTGC
    8761  TGGCCCGGGT GTTCTTTCTG CCATAGATTC TTCTGTTCAG CGATGACGGA TGGGTCTTCC
    8821  CAGTACCTTT CGACAGGAAA GCCGTCGGCG TCCGCGTGAA AGCGCCCCGT GGAAATGAAT
    8881  TCGTTGATGG CCTCGTATGG GCAATGTCCC TTGCAGAGGT CTAGCGCGTA GGCTGCCGCG
    8941  GCTTTGGAGA GTTTGGCCCC GCTGGTGAGC TGTAGAGTGT CTCGCACCAT GAACCGCACA
    9001  AATACCGAGC GCGCATCCTG ATGGGACACG ATCCCGCGAG ACCAGCGTTC TACGCGGGAG
    9061  GCGTCTTTCT TCACGTAGTT GGGGTTTGGC ATGCGGAAAA TGATATCATT GAACAGAAGG
    9121  CGACCGACGC GAGGCATGAA GGATCGATCA CATTTGCACG CTTCCGGGAA TAGGTCCCTG
    9181  CGCTCGACGA GTTCCGTGGC TAAGAGGAGT TCATCGAACT TACATATGTT GTGACCTAGC
    9241  ACTACGATGT CTACGGAATA AAAGTTATCC GGGAGGGAGA GGGGGGAGGT GGGTTTCTCG
    9301  AAGAGCTCGT ACGGTATTTT GTGAACGGAG CCGTACTTTC CGTCCTTGAC TAGCTGGTCG
    9361  CAATAATCTC GGTTGGCAGC CGCGTAGCGG TCGACTAGAT TTTGGGCAAA TTCTATTTGC
    9421  AGACGGGACC TGAAGTTGCG AAACCTTCTG GCAACCTCGC CCGGATGGCT GTCTAGCCAA
    9481  TAGAAGCCTT CGTCGAGGGC TTTGAGACGG TCGTCCTGCC GTGCTAAGCG TTCGGCGCGG
    9541  GAGACCAGCT GGGGGTCTCC GCTGAGCATG AAGCACAACA TAAACGGATG CATGCGCTTG
    9601  CCTTTCTTTT CGAACACGGT ATACGTCTCG ATATCGTAGG TGATGTACAA CTGACGTATG
    9661  TGGGGGTGTT GGGCTGGACA GGAGAAGTGG ACGTGCTGCC ACAAATCGCT GCCCGATCCC
    9721  TGGACGGCGT GGTAGTAGAA GGCAGAGCGG CGTTCGTTGC ACGAGTGTCG TCTGACCCAG
    9781  TGTCGGCCGC AGGTGGGACA CTGTTGAACC GGAGTGCGGC TGGTGATCCA GACCCATTCT
    9841  CCGGTGACGT TTTTGGCGAT GAGCATGGGG GGAAGGGCGG GATGTTCGGA GATGTGCACG
    9901  GTCCGCAGGC GCGCTGTTTT GCCTTTAAAG TTGATGACGG TGACCTGGGC GGGCTTAAAG
    9961  TCGGGGAGGG AGCGTTCGGG GTCTCGGGCA TAGTGCAGAT AGTCTATTCG GTCGTAGCCT
   10021  CTGGCTCTCT TAGACAGCAG GAAGCGGTGG GTGCGTAGGA ATTTCTTGAG ACCTATGGGG
   10081  AATACAGTGG GTTGGAAGCG GAAGGGCTGT TCCTCGATGT AATAGACGTT TGTGCGTAGG
   10141  GGGTTGCCCC GGAAGCTCTT GAAGTACTTT CGGGTCTCTT CCAGCCGTTT AGCGGAAATG
   10201  GTTCGGATGA CGTGCGAATC GGGGCCCAGC ACGCTGTCCG TGAGGGGAGG CCCCGCGTCT
   10261  GCTTCCATTT ACAGAGGCTG ACCTCGTCGC GCCGCCGCTT CGATGTCTTC GCGGCGGTGG
   10321  CGGAGCACGC GTCTGAGGTT GGCTTTGATC TCCTCGTTGG TAGCGATGGC TACGATGCCT
   10381  TTAAATTTGA TGCGGAAACT GATGTCGATG CTATCGATCA GCTCTTCGCT GAGGTTGAGC
   10441  TGCTTCAGCA CTTCTTCGAT GTCACCGGAG CGGTCTCTGT ATTGAATATC AGAGAGAAAC
   10501  AGTTGTTGGT CCGCATCGTC CATGCCTTCG AATTGACCCG TCCGTTCGAC CATCATAAGA
   10561  AAATCGCGTA ATATACGTTC CCACAGGGTT TCGAATATGG TGGCGGGGTT GGATTGCTCG
   10621  CTCCATATGC GTTTAAAAAC CTGCTGCGCG TTGACGTCCC ATCCCACGAC GAGTACTTGT
   10681  AAGGTCAGGA CGTCGACGTA CCGGCGGAAC TCGCGGTTGG CGATGAAGTG GCTGTACAGG
   10741  TAGTAGAGTG TAGAGGCGAT ATGTTCGGCT AAGAAGAAGT ACAGCACCCA CTTGCGCAGG
   10801  AACGACTCTC CCATGAGTCC CGCGTCGCGC GCGGTCAGGA GCATGCGGTA GAAGTCGTTG
   10861  GCAAACCTGA AGAGTTCGTG TCTCCGGGCG GCCCCGCTGA GCTCGTCTTG CAGTGCCCCG
   10921  ATGGCTTCGA GCGCTGTGCG AATCACCTCG TCTAACAGCT CTTCTTCCTC CTCTTCTGGT
   10981  TCTTCTACTT CCATGGCGGC TTCTTCTATT TCTTCGGGAG GGGGCGCGGG GGAGGGGGGT
   11041  CTCCGTCGCC GCCGCGTGAC GCGGGGCAGG CGGTCTACGA AGGCCCGCAC GGCACGGGGC
   11101  CTAATGCGGC GCGCTTCGGA CGCGGTGATG GCTCTGCCGT GGCGGTCTCT AGGGCGCAGG
   11161  CCGGTGCGGT CGGTTACCCG CCGGCTGCAG AGGGTGATGG CGCCTCCTGA CAGACCCGTT
   11221  CCTGCTAAGG AAACGGCGTC GCTCGCTAGA GTGCTCATGA AACATCTCGC CATTGTTTCC
   11281  GTAGGTTCCT CTACGTCCCG TCTTCCTCGA AACTTGCGCT CGGCATCCCG CACCAGTTGC
   11341  TGGGTGTCTA GCTCCGCGAA GGCTTCCGCG AAGTAGGAGA GCCAGTTTGG TTCAAGGAAC
   11401  ACATCGGATC CAGGTAAGAA CCGATATCTT TCTTCCGTTT GAAATAGATC ATATGCGTAG
   11461  CAGAATAGAT AGTGGCAGAG GGCGACTCTT AGTTGGCGGA TGGCGGCGAG CAGTTCGGCG
   11521  TCGGCGGCAG AGGCCGTTCG CATGAGGACG CCTTCTTGCA AGCCACCCGC TCCGTTGCCC
   11581  GACAGTAGGC TGTGGTGTTC GGCGTCGAGC TGCGGCAACA CTTGTCCGTG ACGGCCTACG
   11641  TCGATTCCCC TACCTCGCAG ATGCGCCCGG CCCATGTCCG CGGCCACGCG GTCCATGAGT
   11701  ACGGCGTTGT GCATCTGCGT GAACGTACCG TGAAAGTTGT CGAGATCGAG AAATCGCATG
   11761  TACTGCCCTA CATTGACGGC GTAGGAGCAG TCGGTCAGAC AGGTCCAAAA GAGGCGTCTG
   11821  GGTCTTTGGG GTGGGCTATC GTAACCTATC TGCATAAAAA CGCGGTTGTC GAAAAGGTAA
   11881  TCGTTGAGCG CGCGGTGCAT AGCTTGGTAC CCGAGGAGAA GGTGCGGCGG CGGCAATCCG
   11941  TTGTAGGGCG GCGCGGCGAC GTTCGGCGAT CGCGGCGCGA GGTCTCGGAG TTGCATTAAA
   12001  CGGTAGTCGT ACACCCGGCT GACGAGAAAC ACGCTTCGGG GGTGGACCAG GGCTGGTTCT
   12061  TCCCGAACGA GGACATAGTC AGCGGTGATG ACGGGTTCGC AGAAGCGGAC GGTGGCTAGA
   12121  CTCTGTCCGG TGAGATCCGC GAAGACTCTG TAAGCCTGAA ATTGAGCCCC TGACGTTTTT
   12181  AGACCGCTCG TAATGCACCC CGTCCTGCAA AGCGTTCGAA ACGCGAGCGT GAGCGCCGGA
   12241  GGACCCCATC AACAGCAACC GCAGCAGCAA CAGCACGGTG TGTCGTCGGT CCGTCGTCCT
   12301  CCTTCACCAC CCCGATATCC CGCACAACAT GCCTATCCCG GCGCGGGCGC GACACCCACG
   12361  GCAGGACGAG GCGATTTCGA CGGCGCGCTT GATCCCGATG AAGGACCGGT CGCGTGCGGG
   12421  CTGGCGGCCG GGGCCGGTGT GGACGAAGTT AGAATGAGGG AGCGGGACGC CGCGCGGCGA
   12481  GCCACGGTGC CCGAGATCAA TCTTTTTAAG GCTCGACGTG ACGTGGTGCC CAATGGGGAT
   12541  TACGAGAGGG ATCTGATGTA CCACTCGGGA CAGGCAATCG ATATCGATCG GCAACGTGTG
   12601  CTCACTCCGG AAGACTTTAA GGGGTCCGAG CCGGCTTTCA CGCCGGCTGT CAACCATATG
   12661  CGCGCGGCCG AGTTGAAGAG GGCGGCTGAG CAGACGGCAT TTGGGGAGGA ATTGAGGAAT
   12721  ACCTGCCATC AGACCCGCAT CCGCACGGCT CTGTTAAGGC CCGAGATCGG AGCGGGAATC
   12781  TACTATCTGT ACGATTTCGT CCAGACTTAT CTGGAGCATC CGGACGGTCG GGTGAAGCTC
   12841  AATCCTCAGC TGGTGTTGGT GGCTCAGCAC GCGGGCAATA CTATGCTGGC GCAGCGCTTG
   12901  TGGGCCATCG CAGAGGAGAA GAATGCGTGG TTGAGAGATT TGATAGAGAT GGCGTACATG
   12961  ATCGTGAACG ATCCGTACCT CAATACGGAG CAGCAGCTGT CGGCCATCTG CACGACGGTG
   13021  GTCGAGTTGA GCATGAAATA CGCCAAGTTG GCCGCCAAGA ACGGTTACCC GTCCATGGCG
   13081  CAGATGGCTA AGGCGCAGGA ATTTTTCTAC CGGGTCATGC AAGCGGTGCT CGATTTAGGT
   13141  GTCCAAGTGG GGGTGTATAA CAACCGACCA GCTCGGTACC GTCAGAAGCG CATGAGCGAG
   13201  ATTCCGCAGA TGACTGACGC CGAGTACATG TTCGGTTTGA CCCAGGCGCT GGAGAGCAGG
   13261  CCTCCGCAGG GCGAATCTTT TGCCGACGAG GGGCCGTCAG AATCGGACGA CGAGGATGAC
   13321  TTCATCTGAT ACGTTTCTGG CTCTTGCGCC CTACGGGCGT CAGGAGGTGG CGGACGCCCT
   13381  CAGTTCGCTC CCAGATGGCA AGGACGCGCG GTCGCTACGT CATGCACCCT ACGCAAATCG
   13441  CCTCATCAAA CTCCAGAGCG CCATGGTGCC TCCAAAAGTG GACGGTACTT CCGAGCGGGT
   13501  GGCCGAAATC GTGAAAGGGC TAGCCGAGCA AGGCGCCATC TACCCCGATC AGATGGGCGC
   13561  GATCCACTCA GATTTGCTTA ATCGAGCTTA CACGTGGAAT TCCATGGGGG TGCAGGAGAG
   13621  CATCCAGGCG CTGGTCAACG ACGTGATCCA CGGACAGAAC CGGACATTGC AAGACGAGCT
   13681  TGCGCGGACG AAAGAAATAG CGAATGCTTC GCTCTTGACC CAATTTTTCG ATTCCCTGTA
   13741  CAAAACGGTG GATCGTGGGC AGCGAAATTT TGAGGGCTTT AAGAAACTTT TGCGTCTTTT
   13801  CGTGAATAAC GTGCCGAATG CCGAAGTGTA CGGGTCTTCG GGGTCCTTTA GCGTGCAGAT
   13861  AAATCTTGGC GGATCTAGTC AAAACATCAA TCTGACCAAT GCGTTTGAGA ATTTGAAGCC
   13921  GATATGGGGC GCACGGTGGG ACGCGGTGAA TAATCCTCGC ATCGGGGCGC TTCTGACACC
   13981  CAACACTCGA GCGTTGTTGT TTTTCGTGAG CTCTTTTTAC GACTACGGGG CTATGGAGCC
   14041  CGGTAGTTAC TTGGACAATA TCATGAGGCT GTACAAGGAG GCTATCAGAG CCGATGTGGA
   14101  CGCGGAGGGT GATGCCATTA TGGAGCTCGG GGAGGCGGGC GCAAATCTCA ACTTGCGGTT
   14161  CAACGATTAC AAGGACACAC TAAACTACCT CCTGCAAAAT CGAGAGGTTG TACCCGACAC
   14221  GGCTCCGCTG GAGCTGAGCG CGGAGCAGGA AATGCTCTTG AAGTACCTGA TGAGGCAACT
   14281  ACGACAGGCT CTTAAGGACG GGGTCCCGGC GGACATTTCT ATCAGTACCA TGACTCAGTA
   14341  CCTAGATCCT AGGCTGTATC AGACGAACAA GGTGTTCGTG GAGAAATTGC AAAACTACCT
   14401  GTTGGCGGCT CAGGCGCGCA ATCCTGTGTA TTACCGACTG TTGGTGCTGG ACCCCAACTG
   14461  GCGGCCTCCG GCAGGCCTAT ATACGGGTAA TTACGTGATA CCCGACCGCT ACGACTTTGA
   14521  GGACGTGCAG AGCGAGCTTG AATACGCGGG TCCCTCCAGA GACGAGTATT TCGATGATTC
   14581  TTTGTTCGCA CCAGGTCCTC AGCGCCGCTT AAATTCGGCC GAGGAGGCTC AATTGGAGCG
   14641  TGACATCGAA TCTTTGACCG GCCACATTGA CGAAGAGCTG GGCGTCCAAT CTCAGGCTGG
   14701  CTGGCTCGCC GATCACCGCC TGCCTGTCGC GTTCGATGGC GCTCTCAGCC TTACCGAACG
   14761  CAACGCCTAC AACACGCCGT TGCCCCCCGA TTCCCACATG CGTAGCCGTT CTAGCTCCGT
   14821  CGCTAGCGAT CTTGGGCTAT TGAACCTATC TGGGACGGGG GGACCGGGCT TTTTCGCTAG
   14881  TCTGCGGCCT TCCATCGGCA GCCGTCAACC GACCGGCACG GCCGTGGGCC TCCGCCCGAC
   14941  GACACCGTAC AGCGGTTCGG GGTGTATGAG GGGCACCGGT CTGGCGCGCA AAGTTTTAAA
   15001  CCCGGCCGCG TCGCGCCGGG GGCGCAAGCT ACGGTTCTAC TGAACCCTAG ACTCTGACGA
   15061  AGAAACTTAA AAACGCTTAC CGCCATTTCG CCGCGCAGAA GTTGGAAGGA TGTACCGGAG
   15121  CCTGCGACCG CCGACGTCGA TTCCTCCTCC GCCTCCCTCT GGTCCCTCGC CTTATCCGGC
   15181  GATGATCAAC GGATATCCCC CGGATGTGCC GGTGGGGTCA CCTGCCAACG GAGATGCGGA
   15241  GCTGTTCGTG CCGCTCCAGA GGGTGATGCC GCCTACGGGT GGACGGAACA GCATTAGATA
   15301  CCGGAATTAT GCGCCGTGCC AAAACACCAC CAAGTTTTTT TACGTAGACA ATAAGCTGAG
   15361  CGACTTAGAC ACCTACAACG AGGACGCGAA TCACAGCAAT TTTAGGACGA CAGTCATTCA
   15421  TAATCAGGAC TTAGACCCGT CAACGGCCGC CACAGAGACC ATTCAGCTCG ACAATAGGTC
   15481  GTGTTGGGGC GGAGAGCTAA AAACAGCGGT GAAAACCAAT TGCCCGAACA TCAGCTCGTT
   15541  TTTCCAAAGT GATACAGTGC GCGTGCGTCT GATGAGCAAG CGCGATCCGG GGGGTACCGA
   15601  CCCAGACGCG GGGGTGAACA ACCCACCCGG GGCCGAGTAC AAGTGGTATG ATCTGAGGAT
   15661  TCCCGAAGGT AACTACGCGT TGAACGAGAT CATTGACCTT TTGAACGAAG GCATCGTCCA
   15721  GCTGTACCTG CAGGAGGGGC GCCAAAACAA TGTGCTCAAG AGCGATATCG GGGTTAAGTT
   15781  CGATACGCGG TATCTGGATT TGCTGAAGGA CCCCGTGACG GGGCTGGTGA CGCCCGGCAC
   15841  CTACGTTTAC AAAGGATACC ATCCCGACAT CATCCTCCTC CCCGGCTGCG CGGTCGACTT
   15901  TACGTTCAGC AGGCTTAGTC TTCTGCTCGG TATCGCGAAG CGCGAGCCCT ACTCGAAGGG
   15961  GTTTACGATT ACTTACGAAG ATCTTCAAGG AGGGAACGTG CCCGCGCTGC TCGATCTGTC
   16021  CTCCGTGCAG GTAGACGATC AAGACGAGGA CGTGATCGTG GTGGCAGACG CAAGGCCTCT
   16081  TTTAAAAGAC TCCAAGGGCG TTTCCTATAA CGTGATCACC ACTGGCGTGA CTCAACCGCA
   16141  AACCGCTTAT CGGTCTTGGC TCCTTGCCTA CCACACCCTG GACTCCCCCG CGCGCAATAA
   16201  AACGTTATTG ACTGTTCCGG ATATGGCAGG TGGTATCGGC GCTATGTACA CATCGATGCC
   16261  GGACACGTTT ACCGCACCTG CCGGATTTAA GGAAGACAAT ACGACCAACC TTTGTCCTGT
   16321  GGTGGCCATG AACCTGTTCC CGAGTTTCAA TAAGGTATTT TACCAGGGCG CGTCCGCCTA
   16381  CGTGCAGCGC TTAGAAAATG CCACGCAATC CGCAACGGCC GCTTTCAACC GGTTTCCCGA
   16441  AAACGAAATT CTAAAGCAGG CCCCACCCAT GAATGTTTCC TCGGTGTGTG ATAACCAACC
   16501  CGCCGTCGTT CAGCAGGGTG TGCTACCGCT GAAGAATTCT CTGTCTGGCC TACAGCGCGT
   16561  GTTGATCACC GACGACCGGC GCCGTCCCAT TCCATACGTG TACAAAACCA TCGCCACCGT
   16621  GCAACCGCGC GTTTTGAGCA GTTCAACCCT GCAGTGAGGA GCGGAAGGAT TTTCAAACAT
   16681  GTCCATTCTG ATTTCACCCA GTGATAACAG AGGTTGGGGA GCAAACATGC GTTACCGCCG
   16741  TAGAGCATCC ATGCGCGGGG TCGGTCGCCG TCGTCTCACC CTGAGGCAGC TATTGGGTCT
   16801  GGGGTCTCGC CGGAGACGGC GATCCAGGCC CACGACCGTC AGTAACCGTT TGGTGGTTGT
   16861  GAGCACCCGC CGCCGCTCTT CCCGAAGACG CCGATGAAGC AAGCAGCTGA TGAGATGTTC
   16921  TTCTGACTAT GTGTGCCGTC GCTATACACA GGAGCGACGT CGTTATGCCT TCCGTTCTTT
   16981  TGACCGGCGG GCGGACCGCC AAGGGCAAGA AGAGAGCCTC TCGTCGTCGA GTGAAAGTGC
   17041  CTAAGTTGCC TAAGGGAGCG CGCCGAAAGC GTGCGTCGGT GACGCCGGTC CCTACCGTAG
   17101  CTACCGCGAC CGCTTCCGAG CGCGCGGCTC TGACGAACCT AGCCAGACGG CTCCAGCGCG
   17161  GCGACTACGC CGCTTGGAGG CCCGCCGACT ACACGTCACC GGCCGTTTCC GAGGCGGCTC
   17221  GCGCAGCCGC CTCGTCCGGC ACCCCCGCGA CCGCGAGGGA TCTCGCGACG GGAACCCTCG
   17281  CTCGCGCCGT GCCCATGACG GGTACCGGCG GAAGGCGGCG CAAGCGCACC GCTACCCGCC
   17341  GCCGATCTCT GAAGGGGGGC TTCCTGCCGG CTCTGATACC TATCATTGCG GCCGCTATCG
   17401  GCGCCATTCC GGGCATCGCA GGCACCGCCG TGGGCATCGC CAATCTGAAG GAGCAGCAGA
   17461  GACAGTTTAA TAAGATTTAC GGGGACAAAA AGTGATGCTG ACTGGACGCA CTAAAAGGCC
   17521  CTTTCAATAA ACGCGTTTTT GTAGAACCGG CTCGCGTCAT GGACTACGCT GCGCTATCAC
   17581  CGCATCTCGG TGGGTGGGCC CTGAGAGACC ACCACATCGG CGACTCTAGC TTGAGAGGGG
   17641  GAGCCATCAA CTGGGGCAAC CTCGGGTCGC GCATAACCAG CGCGCTGAAC TCCACCGGTC
   17701  GCTGGCTGTA TAACACCGGC AACCGCTTCG TGCATTCGAA CACTTTCAAC CAGATTAAAC
   17761  AAGGCATACA AGACAGCGGG GTCATACGCA ACGTGGCTAA TTTGGCCGGA GAGACGCTGG
   17821  GGGCCCTGAC CGACATCGGC CGGTTGAAGT TGCAACAGGA TCTGGAGAAG CTGCGGCGTA
   17881  AAGCTTTGGG GGAGGAAGGT CCAGCGACCC AGGCCGAACT GCAGGCTCTC ATTCAGGCCC
   17941  TGCAGGCGCA AGTGGCTGCC GGAGAGCCGC CCGCCGCACC CGCGGCGCCG GCGCCGGCCC
   18001  CGCCGCTCGT GCCCACCACT CGTCCTATTC CCGAAATGGT AACGGAGGTT AAGCCTCCCG
   18061  TTACGTCTTC GGCGCCAGCC GTCCCCGTAG ACGTGCCGAC CACGCTGGAA ATGCGACCTC
   18121  CGCCGCCCAA GCGCAGGCGC AAGAGGGCAC GACCGGGACA ATGGAGGGCA CGCTTGGACA
   18181  GCCTCTCGGG TACCGGAGTA GCGACCGCCA CTAGACGTAT GTGTTACTAA AATTCCGTCG
   18241  TTCCGCTATG TCTAATTTTT AGCTCACCGG TTGTCTCCCG AAGGCGTCAT GACTGCGCTT
   18301  ACTCCCGACC TGACCACGGC GACGCCGCGG CTGCAGTACT TTCATATCGC GGGCCCTGGC
   18361  ACCCGAGAGT ATCTATCCGA GGATCTCCAG CAGTTTATCT CGGCCACGGG GAGCTACTTT
   18421  GACTTGAAAA ACAAATTCAG GCAGACGGTC GTAGCTCCCA CTCGCAATGT CACCACCGAA
   18481  AAGGCACAAC GTCTGCAGAT CAGATTCTAC CCGATCCAGA CGGATGACAC GCCAAACAGC
   18541  TATCGCGTGC GCTACAGCGT CAACGTTGGG GACAGCTGGG TGTTGGACAT GGGGGCGACC
   18601  TACTTCGACA TAAAGGGTGT GCTGGACCGC GGACCTTCCT TCAAGCCGTA CGGCGGAACG
   18661  GCTTATAATC CCCTTGCGCC AAGAGAAGCT ATTTTCAACA CCTGGGTGGA GAGCACTGGT
   18721  CCTCAGACCA ATGTGGTGGG ACAGATGACC AACGTGTACA CAAATCAGAC CAGGAACGAC
   18781  AAGACGGCCA CGCTTCAGCA GGTCAATAGC ATCTCCGGGG TGGTTCCCAA CGTCAACCTG
   18841  GGACCCGGCC TCAGTCAACT AGCATCCCGG GCCGACGTGG ATAATATTGG CGTGGTGGGA
   18901  CGTTTCGCCA AGGTAGACTC AGCGGGCGTG AAGCAGGCGT ACGGAGCCTA TGTCAAGCCC
   18961  GTGAAGGACG ACGGGTCTCA GTCTCTGAAC CAGACCGCGT ACTGGCTGAT GGACAACGGA
   19021  GGTACCAACT ATCTGGGTGC CCTGGCTGTG GAAGACTACA CTCAGACCCT GAGTTACCCC
   19081  GATACCGTGC TCGTGACCCC TCCCACCGCT TACCAGCAAG TCAACTCCGG CACCATGCGG
   19141  GCATGCAGGC CCAACTACAT CGGCTTCCGA GACAACTTTA TCAACCTACT GTACCACGAC
   19201  TCGGGCGTCT GCAGCGGAAC GCTCAACTCC GAGCGCTCCG GCATGAACGT GGTCGTGGAA
   19261  CTCCAGGACA GAAACACAGA ACTGAGTTAC CAGTACATGC TGGCGGACAT GATGTCCCGT
   19321  CATCACTACT TCGCGCTGTG GAACCAGGCC GTCGACCAGT ACGACCACGA CGTGCGCGTC
   19381  TTCAACAACG ACGGCTACGA AGAGGGCGTG CCTACTTACG CCTTCCTGCC CGACGGGCAC
   19441  GGGGCGGGCG AAGACAACGG TCCCGACCTC AGCAATGTCA AAATTTACAC CAACGGACAG
   19501  CAAGATAAGG GCAACGTGGT GGCCGGAACG GTTTCCACAC AGCTCAATTT CGGTACCATT
   19561  CCCTCCTACG AGATCGACAT TGCTGCTGCC ACCAGGCGCA ACTTCATCAT GAGCAACATT
   19621  GCCGACTACC TGCCCGACAA ATACAAGTTT AGCATTCGCG GTTTCGACCC TGTTACAGAC
   19681  AACATCGACC CTACCACCTA CTTTTACATG AATCGCAGGG TTCCCTTGAC CAACGTGGTA
   19741  GACCTGTTTA CCAACATTGG TGCCAGATGG TCCGTGGACC AGATGGACAA CGTCAATCCC
   19801  TTCAACCACC ACCGTAACTG GGGGTTGAAG TACAGGTCTC AGCTGCTCGG AAACAGCAGA
   19861  TACTGCCGTT TCCATATTCA GGTGCCGCAG AAATACTTTG CCATCAAGAA TCTGCTCCTG
   19921  TTGCCCGGCA CCTACACTTA CGAGTGGGTC CTCAGAAAGG ATCCCAACAT GATTCTGCAG
   19981  TCCAGCCTTG GCAACGACTT GCGCGCGGAC GGCGCGCAGA TCGTGTATAC CGAGGTGAAC
   20041  CTTATGGCCA ATTTCATGCC CATGGACCAC AATACCAGCA ACCAGCTGGA GCTGATGTTG
   20101  CGCAACGCTA CCAACGACCA GACCTTCGCG GACTACTTGG GCGCCAAGAA CGCTCTCTAC
   20161  AACGTTCCGG CCGGCTCCAC GCTGCTGACC ATCAATATTC CCGCCAGAAC ATGGGAGGGT
   20221  ATGCGGGGCT GGTCTTTTAC CCGCCTCAAG GCCTCGGAGA CGCCCCAGCT GGGCGCTCAG
   20281  TACGACGTCG GTTTCAAGTA TTCAGGCTCC ATTCCCTATT CGGATGGCAC CTTTTACCTG
   20341  TCCCACACGT TCCGCAGTAT GAGCGTGTTG TTTGATACCT CTATCAACTG GCCTGGCAAC
   20401  GACCGTCTGC TCACACCTAA CCTGTTCGAG ATCAAGAGGC CAGTGGCCAC CGACAGCGAA
   20461  GGCTTCACTA TGTCGCAGTG CGACATGACC AAGGACTGGT TCCTCGTGCA GATGGCCACC
   20521  AACTACAACT ACGTGTACAA CGGTTATAGG TTCTGGCCTG ACAGACACTA CTTCCACTAT
   20581  GACTTCCTAC GCAACTTCGA CCCCATGTCG CGTCAGGGCC CCAACTTCCT GGACACCACG
   20641  CTGTACGACC TGGTGTCCAG CACTCCCGTT GTTAACGACA CCGGCTCACA GCCGTCTCAG
   20701  GACAACGTGC GTAACAACTC CGGCTTTATC GCCCCTCGCA GCTGGCCCGT ATGGACCGCA
   20761  CAGCAGGGCG AAGCCTGGCC CGCTAACTGG CCGTACCCGC TGATCGGGAA CGACGCCATC
   20821  AGTTCCAACC AAACCGTCAA CTACAAGAAG TTCCTGTGCG ATAACTACCT CTGGACCGTG
   20881  CCGTTCAGCT CGGACTTTAT GTATATGGGA GAGCTGACCG ATCTGGGTCA GAACCCCATG
   20941  TACACAAACA ACTCCCATAG CATGGTTATC AACTTTGAGT TGGACCCCAT GGATGAGAAT
   21001  ACTTACGTGT ACATGCTGTA CGGGGTATTT GATACCGTTC GCGTGAACCA GCCCGAGCGT
   21061  AACGTGCTAG CCATGGCTTA CTTCCGTACG CCTTTCGCCA CAGGCAACGC TGTGTAAAAA
   21121  AAAGACGGCT GGGATGTCGG GAACCACCGA GACCCAACTG CGGGACCTGC TGTCCTCTAT
   21181  GCACCTGCGG CACCGCTTCC TGGGTGTTTT TGACAAAAGT TTCCCAGGAT TTCTCGATCC
   21241  GCACGTGCCC GCCTCAGCTA TCGTCAACAC CGGCTCCCGG GCCTCCGGAG GTATGCACTG
   21301  GATCGGGTTC GCGTTCGACC CTGCCGCAGG ACGATGTTAC ATGTTTGACC CTTTCGGGTG
   21361  GTCAGACCAG AAGCTGTGGG AGTTATACAG AGTCAAGTAC AACGCTTTCA TGCGTCGGAC
   21421  CGGCTTACGG CAGCCCGATC GCTGTTTTAC CCTGGTCCGT TCTACCGAGG CCGTGCAGTG
   21481  CCCCTGCTCG GCCGCTTGTG GGCTTTTTAG TGCCCTTTTT ATCGTCTCTT TCGACCGTTA
   21541  CCGGTCGAAG CCCATGGATG GCAATCCCGT GATCGACACC GTAGTCGGTG TGAAGCACGA
   21601  AAATATGAAT TCTCCGCCCT ACCGCGACAT CCTGCACCGT AACCAAGAGC GCACCTATTA
   21661  CTGGTGGACC AAGAATAGCG CCTATTTTCG TGCTCATCAA GAGGAACTCC GACGAGAAAC
   21721  GGCCCTTAAC GCCCTACCTG AAAATCACGT TTAATGACCG ACTGTAAATA AAGAACGACG
   21781  CACACACGTA CTGTACATAT TTGTGAATAG AGCAACCGTT TATTAGATAA ACGTCAATAA
   21841  ATGCCGACCG ATAGACCGAC AAGGCTCTTC ACTGGCTTTA TTTAAAGAAA CAAAAGGATT
   21901  AAGCGAACGG GTCGTCACTG GCGATGGGCG AGACTGGCGC CAACACCTCC GTTTTAAAGG
   21961  CGTACGACTC GTTCCAACGG AACTCAGGCA CATGTGTGGG CTCTGAAGAA CCCATCACGG
   22021  CAGTAAACAG CTCCGTAGCA AAGACGTACG CGTAGCGCAG ATCCATGGCC GACAGACGCC
   22081  AGGCGCAGGT TTTTTCGGTC TTCTTCAGAC CGCGGCCTGC TCCGCCCGAC GCCGCCTGCG
   22141  GGTTGCAGCA GGTGAACACC ATGGTATGCG GGTTTTTCTT GTGAGCCTTC ATATCGGGCC
   22201  TGCTCTCGAC CATGTCGCGA GTAATGTCGT CTGTGCCGTT GAGCTTATAA GGAGTCATTT
   22261  TACAGAACTG TCTCCCTGAA ATGGCTCGAT CGGAGGCGTA GTTGCAGTTG CAATTGGTTG
   22321  AGATGAGGAC ACATTCCTCT GCCCGGCGCT TGTCCGCGTT GGGGTAAAGC GCCTTCGTCC
   22381  AGTCTATGTC GTGACGCATC GCGCTGACCG CCTTGGCGGC GTCGGAAAAG ACCATGGCGC
   22441  AACTGCCGTG CGCGTGGGGA TGAGGGAAGC CGCTGTGCTC CTGATCCTTG TAGCACACCG
   22501  CGTTCGCGTC GAACCTGAGC ACCACCACCT GTCGTCCAAA CCGGTTCTTC TCGATTACGC
   22561  CGTTCTGTTC GGCCAGAGCC CTCTTTCCCG CCTCGCTAGA CGGGTTCAAC TCCACGGTAC
   22621  GAGGTTTCGT CACCATGTCC ACACCGTGCA TGCATTTCGG GAAGGGCTCC TGGAGCGCTG
   22681  GGAACCAGCC ATGGCGCCAA ACGTGCGCCC CTCCGGGCAC GAACTTGGGC TCCAGACCCG
   22741  CGCGGCTGTA GATAACGGCT GCCAGGAACC GCCCTACCTG AGCGTTGAAA GAGTCGTAGC
   22801  TAGAAAAGGT CAGGCGAAAT TCGGGATGCT TTTTGCGAAC GTATGTACCC CCCATTTTGG
   22861  TCCAAATGGA GTCGTCGGGG CGCACGCTGG CTCCCTGCCA CTGTAGGTCG AGAGCTTCGC
   22921  AGATGCTGGC GACGGTGGCC ATGGCGCGTT GCGCGCCGTA GACCACGGGG TCTGACAGAG
   22981  GGGCCTCCGG GGATTCCTCG TCGCTGGCGT TTTCTTCGTC ATCGACAACG GTTTCCCGCC
   23041  GGCGGGTAAC TCGCCTTACG GGGGATGGGG ACTCCTCGCG GCGGCTGACC TTCTTGCGAG
   23101  TCGCGCCTCG GCCCGGGGCG ACCACTTCCA CTTCTTCCTC CTCCTCTTCC ATCATGACTT
   23161  CTGCCGTTCT CTTGACAGGC TTGGTGCTGC GAAAGCCATG AGCTCTTTTC GGGGTTCTTT
   23221  CCATGACTTC TGCTTCGGTG ACGGGATCTC GCGTTTCAAA AAGTTCTTGC TCTCCCTCCT
   23281  CTTCAGAGTC AGGGACTACT GCCGGAGAGG GTGGAAGCGT CTTTTGAAGC TTCCTGGGAC
   23341  CTATAGGGTA AAGTTAACGC CCATCGTCAG CGAGACCACG CCTCGCTGGC CGATGGGATC
   23401  ACGAGACACG ATAAAAGACC GCGACCAAAA CACTCTTGGG GCTAGTATCC CTACCCGGGT
   23461  GCGAGCGTGG CAGATCTTCG CTCTTCTGCT TCTCCAGTGG ATTCTCGGGG TCTTTCGGCC
   23521  CCGTCGGTCT CTGGGGTGGG AGAGGCCTGC TCCTCCCTCT GTTTGACTTG ATTACCGTCG
   23581  ACGGCCCGGG CTCTTCGAGG TCCACGAAGT CCGCCACGTC TTCGTCGCTG CTGATCGTCT
   23641  CTGGGTGAAG CGTTTCTGCC ATCGTGGCTG TCATCGAAAA TGGCAGACAA GATTACCCGA
   23701  GAGGAAAAAA CCATAGCGAC GCTGGACCTC GTGTTACGCG TGGTCGTCGA TGCTGGTAAC
   23761  TGGGACGTGT TCTCGAAACG TTTGGTTCGC TACACACGCG AACAGTACGG AATCGAGCTG
   23821  CCCGAAGATA TCGGGGACTT ACCGGACACA TCTGAGGTCT CGAAAGTGCT GTTGAGTCAT
   23881  TTGGGGGAAG ACAAGGCGGT ACTGTCCGCG TACCGAATCG CGGAACTGAC GCAACCTTCC
   23941  GAAATGGACC GCGCTAAGGT CACAGAGGGA GGCCTGGCCG TACTTAACGC GAGTCGCGAT
   24001  GAAAGCGAAG CTCAGAACCC CTCGAACCCC GAACCCGAGA GCATCGAGAG CGACGCCGTA
   24061  GAGGATCTCG GCGTTGCAGC AGAGAGCGAC CCTAGCGATG ACGAACCCGA CCCAGAACCC
   24121  GAGTATGACC ATCGAGAGGC GGATCATGAC TCTGATGCGG ATAGCGGATA CTATTCGGCA
   24181  GATGGGGGAC GACCTGGAAC ACCAGTGGAC GAGGAGCCCC AGGACGATTC TCCCTCTTCC
   24241  GAGGAGACCG CATCCACTGT CATCGAAGAA GCGCAGACTA GCGCTAGCAA CGATTCTCAT
   24301  GACGACGACA CTCACCGCGA CGACGGCAGT GCTTCTGAAG AGGATCTCGA GCGGGACGCC
   24361  CTCGTGGCCC CGGCCGATCC TTTTCCCAAC TTGCGGAAGT GTTTCGAGCG CCAAGCCATG
   24421  ATGCTGACCG GGGCGTTAAA AGACGCCGCG GACACGGCTG ATCCGCCAGA AACGCTCTCC
   24481  GTCGACAGCG TGCAAAGGCA GCTCGAACGC TTCGTCTTTA ACCCCGACCG CCGCGTGCCC
   24541  GCCGAACACT TGGAGGTACG CTACAATTTC TACCCTCCTT TCCTCACCCC CAAGGCCATC
   24601  GCGAGCTATC ACATCTTTGC CGTCACCGCT TCCATCCCTC TAAGCTGCAA AGCCAACCGC
   24661  AGCGGCAGCG ACCTTCTAGC CAAAGCAAAA GAGAGCACTT TCTTCAAACG CTTACCTAAA
   24721  TGGCGTCTCG GGATAGAGAT CGACGACGGG TTGGGAACGG AAGTCACGGC GGTAACAGAG
   24781  CTGGAAGAGG CAAAAATGGT TCCGTTAAAG GACGACGTGT CTCGTCTGCA GTGGGCAAAA
   24841  ATGCGCGGCG AGCACATTCG CTTCTTCAGC TACCCGTCGC TGCACATGCC TCCCAAAATT
   24901  TCCCGCATGC TGATGGAAAC GCTGTTGCAA CCGTTCGCGG ACGAAAACCA AAAGGCGGAA
   24961  GAGGCACTTC CCTGTCTGTC GGACGAGGAA GTGCTGGCCA TCGTGGACCC GACAGGGCGC
   25021  CTCCACGGCG AGGACGCGCT CAAGGCCGTG GAAAAGCGGA GGGCCGCGGT CACTATGGCG
   25081  GTACGCTACA CCGCGACCCT CGAACTCATG GAACGCGTGT TCCGCGAACC GTCTATGGTC
   25141  AAAAAGATGC AGGAGGTCCT CCACCATACC TTCCACCACG GCTTCGTCGC CCTGGTACGC
   25201  GAAACCGCAA AAGTCAACCT GAGCAACTAT GCGACCTTCC ATGGGCTTAC CTACAACAAC
   25261  CCCCTGAACA ACTGCATCAT GTCCAAGCTC CTAGAAGGAG CAGACAAGGA GGACTATGTG
   25321  GTGGACTCGA TCTACCTTTT CTTGGTCCTG ACGTGGCAAA CGGCTATGGG TATGTGGCAG
   25381  CAGGCCATAG ACGATATGAC TATCCAGATG TACACCGAGG TCTTTACCAA GAATAAGTAC
   25441  AGGCTGTACT CGCTGCCCAA CCCGACCGCC ATCGGCAAGG CCATCGTGGA CATCCTCATG
   25501  GACTACGACC GGCTCACCGA GGAAATGCGG AAAGCGCTGC CCAACTTCAC CTGTCAGAGC
   25561  CAGATTACTG CCTTCCGCCA TTTTCTACTG GAACGGTCCA ACATCCCAGC GGTCGCCGCG
   25621  CCTTTCATGC CAAGCGACTT TGTGCCTCTG GCTTACAAGC AGAGCCCTCC CCTCCTCTGG
   25681  GACCAGGTCT ATCTGCTGCA GCTGGCCTTC TATCTCACTA AGCACGGAGG CTACCTGTGG
   25741  GAAGCCCCGG AGGAAGAGGC CAACAACCCG TCCAACCGGA CTTACTGTCC TTGCAATCTC
   25801  TGCAGTCCGC ACCGGATGCC AGGTCACAAT GCGGCATTGC ACAACGAGAT TCTGGCTATC
   25861  GGAACGTTCG AGATCCGCAG TCCGGACGGG AAGACCTTCA AGCTCACGCC TGAGCTGTGG
   25921  ACCAACGCAT ACCTCGACAA ATTTGACGCC GAGGACTTCC ACCCGTTCAC GGTGTTCCAC
   25981  TATCCCGAGA ACGCATCGCG GTTCGCATCC ACTCTAAAAG CATGCGTCAC GCAGAGCCCC
   26041  GAAATCTTGA GCCTGATTCG CCAGATTCAG GAATCGAGGG AGGAGTTTCT GCTCACCAAG
   26101  GGCAAGGGGG TGTACAAAGA CCCGAACACC GGAGAAACCA TCTCCAGACA GCCCCGGGAC
   26161  ACTGCCCGCG CGCAGCACGC TGGAGACGGT CAAGCTCTAC CAGCCCCTGG AGCCTATACC
   26221  ACCGGAGGAA ATAGAGCGGA GACAGCGCCT GCTGGAGCTG TACGGCTTGC CCCGGACTAC
   26281  CAAGACGGGC AGTTTCCTAT CGCGAAAGTC GGCCCGCACT ACCATGGCCC AAAGAATGTT
   26341  AGACGAGAAG ACCAGGGTTA CAGAGGCGGG CCCGGAGGTG TACGGGGAGA GCGCGAGGTC
   26401  GTCCTTTCAC GAAGAGCAGG AGGAAGACGT TTCGGACGGA GAAACACTAG GCAGTCAGGA
   26461  TACAACGAAC GGGCTAACCG ATATTTCGGA AGAGGAGGAG GAGGATCTGT TCGAGGGCAA
   26521  CAAGGAGAAC ATCCCACCAC CTCGCCGTCC GCCTCGGAAC CGCCGGCTCC GAGCCGCATA
   26581  CTCGCTCGAG GAACCCCTCC TTCCCCCGAG CGCCGCGACC GACAAGAAGA GTAAGAAAGT
   26641  CCCAAAAAGG CGAGGTAAAT ATCGCAGCTG GGCTAAGCAC CGCGTGGCGA TATGCCAGGC
   26701  ACTTCGCGAT GCGGTCTTTG ACCGCAAAAA GGCGGGCGAA ATCCTCAAGC GGGGTCACCG
   26761  GCTCTTCGTG CCCGCTACTG TCATAGGCTA CTATGCTCGC AAACTCTCTC CCTCATTTCT
   26821  CGCTCCTCTC TCCAGCCACA CCGCACCCCT CCTCCCACCA AAAAAACACC GGCGCTAAGG
   26881  CTGTGCGTCT GCGCCAAGAT CCGGTGCCGC AGCACATCGC GGACCTCAGA GGGGAAATAC
   26941  TCGACATCCT GTTGGAAATC GAGTCGTACG CCCGCCGCCG TCCCGACCGC CACGTGTCCA
   27001  TTCGCAACAG AACGCGCGAA AGCATCACCC GAAAACTGCA TTACGAGAAA AATGAAGATA
   27061  AGCTTACCCG TATGAAGAGC GATGCTATCA AGTTGCTCGC TCTCTGGCAG ACCGTTTAAC
   27121  TCGTGTTCCT TTATAGCCCT TCGGAACCAT GAACCTGATG AACGCCACAC CCACCGAATA
   27181  CGTATGGAAG TACAACCCAG TCTCCGGCAT TCCCGCCGGC GCGCAACAGA ATTACGGCGC
   27241  CACTATAGAC TGGGTGTTGC CAGGAGGAAC CGGTTTCGCA ATAGCAACCA ACGACATTCG
   27301  AAGACAAACC CTTAACCCGG CCGTGACCCG TGCAATTACC GCGCGTTTTG AAGCTGAGTC
   27361  AGACCAGCAA CCGTACGCTA GCCCTCACGA GACCAATGTT ATCGCGGCCA ATGTCCTCGA
   27421  CTCGGGTTAT CCCAAATCCG GTCTCTACCC ATTAGAGCTC AGCGGCAATC AGCGCGTACA
   27481  GCTGGCAGGC GGCCTAATGG TAGGTCGCAC TGAGGGCAGG ATGCAATTAG CGGGCGGTTT
   27541  AACAGAAGGA AGAGTGCAAC TTTCTGGAGG TTTCCACGGA CGGCCGTTGG TTAGAGGGCG
   27601  GAGCAGAAGA CCGCCCAGAT GGTGCGGCGC CGAACTGACT GGGAACGGAC TGCCCGAGCA
   27661  AGCCGAAGTC ACTTCTGACA CTTACAAGTA CTTCCTGAGA ACACAGGGTC CCAGCCAAGT
   27721  GGTTGAAGAG CCCGGCGTCT TTTCGCAAAG ACAATTTATG ACTACCTTCC TCCCCTCCGT
   27781  TGTCCCTCAT CCCTTCGACA GCACCAACCC CGGCGATTTC CCCGCGCAGT ACAGTGCCAT
   27841  CTACAAAGGC CGCACGGCCT TCGAAGACAC CTTTTGGGAC TGGTGAAGCG CACCTTTTGT
   27901  TGGCGATGCT CCGTTTCGCA ATAAATTTCT TCCAATTCTC TGTCGTTAAA CGGCTCCCGT
   27961  CTGGTCACTG TCACGCGCTC GCCGCCCTCG CTCGTCACCC GCGCGCGGTA CCGTCGCCTC
   28021  AGCCAGAATA CAAAACCGGG GTTCAGGGGT TCGTCGAACC GTACCACAGC CTGGTCGTTT
   28081  AATCTCAACC AATATTTTCT AGGGTTCGAC ATCATGAACG AGGAGGTTCC CCTAAAGCGT
   28141  GTCAGCCCTG ACGAAACCGA GACGGTTCCC AAAAAACCGC GAACCGACGT TCGCGACACC
   28201  GTCAGGGCCG GCACTGACGA CACGGTAGAT CTCGTGTACC CTTTTTGGTG GAATCTCGGA
   28261  ACGGGAGGGG GCGGAGGAGG AGGAGGCGGG GGCGGCGGCA GTGGAACCTC TCTCCAGCCC
   28321  AATGACCCGC TTTACGCCGC CAGCGGGACC ATCAACCTAC GCATGACATC CCCGCTAACG
   28381  TTGTCACAAC GAGCCTTGGC TCTCAAAACG GACAGCACCC TCACCCTCAA CACGCAAGGC
   28441  CAGCTGGGCG TCAGCCTCAC CCCCGGAGAC GGGCTCGTCC TCAACACCAA CGGGCTCAGC
   28501  ATCAACGCAG ACCCGCAAAC CCTCGCATTC AACAACAGCG GGGCGCTCGA AGTCAACCTA
   28561  GACCCCGACG GACCCTGGTC TAAAACCGCC ACGGGGATCG ATCTGCGTCT AGATCCGACG
   28621  ACGCTCGAAG TAGACAATTG GGAACTAGGA GTCAAGCTCG ATCCCGACGA AGCCATCGAT
   28681  TCCGGGCCCG ACGGTCTCTG CCTCAACCTG GACGAGACTC TGCTGCTCGC CACCAACAGC
   28741  ACATCCGGCA AAACGGAGCT CGGGGTACAC CTCAACACCA GCGGTCCCAT TACTGCGGAC
   28801  GACCAGGGCA TCGACCTGGA CGTCGATCCC AACACCATGC AGGTGAACAC AGGACCTTCC
   28861  GGAGGCATGC TGGCCGTCAA ACTCAAATCT GGCGGCGGGC TCACCGCTGA CCCCGACGGT
   28921  ATCTCGGTCA CGGCCACCGT CGCGCCTCCG TCCATCAGTG CGACAGCTCC TCTCACCTAC
   28981  ACCAGCGGCA CCATTGCACT CACTACGGAT ACGCAAACGA TGCAAGTCAA CAGCAACCAA
   29041  CTGGCCGTGA AGCTCAAAAC GGGAGGCGGT CTGACGGCTG ACGCGGACGG AATCTCCGTT
   29101  TCGGTTGCAC CGACCCCGAC GATCAGCGCT TCTCCCCCGC TAACCTACAC CAACGGGCAA
   29161  ATAGGGCTCT CTATCGGAGA CCAAAGCCTC CAAGTCAGCT CTGGACAGCT CCAAGTCAAA
   29221  CTGAAAAGCC AGGGCGGTAT TCAACAGAGC ACGCAGGGGC TGGGAGTGGC GGTTGATCAA
   29281  ACCCTTAAGA TTGTGTCTAA CACGCTCGAG GTCAACACGG ACCCGAGCGG ACCCCTCACC
   29341  AGCGGCAACA ACGGTCTCAG CTTAGCGGCC GTCACACCCC TAGCAGTGTC TTCCGCCGGC
   29401  GTCACCCTGA ACTATCAGTC CCCTCTTACA GTCACGAGTA ACTCTCTCGG GCTCTCCATA
   29461  GCCGCGCCAC TCCAGGCGGG TGCGCAAGGC TTGACGGTAA ACACGATGGA ACCCTTGAGC
   29521  GCCTCGGCGC AGGGCATCCA GCTGCACTAC GGACAGGGAT TTCAGGTCGT CGCGGGCACG
   29581  CTGCAGCTGC TCACTAATCC CCCCATCGTT GTCTCATCCC GCGGGTTCAC CTTACTCTAC
   29641  ACTCCCGCCT TCACGGTGAG CAACAATATG TTGGGGTTGA ATGTAGACGG CACTGACTGC
   29701  GTGGCTATCA GTTCAGCCGG CCTACAGATC CGTAAGGAAG CCCCGCTGTA CGTGACCTCG
   29761  GGAAGCACTC CAGCATTAGC CCTTAAGTAC AGCTCCGACT TTACCATTAC CAATGGTGCG
   29821  CTCGCGTTAG CGAACAGCGG CGGAGGAGGA AGTTCCACAC CCGAGGTGGC CACCTATCAC
   29881  TGCGGGGATA ACCTACTCGA GTCCTACGAC ATCTTCGCCT CTCTACCCAA CACCAACGCG
   29941  GCTAAGGTGG CGGCTTACTG CCGTTTAGCT GCTGCAGGTG GCGTGGTCAG CGGGACCATT
   30001  CAAGTGACAA GCTATGCCGG ACGATGGCCT AAAGTGGGCA ACAGCGTTAC GGACGGCATC
   30061  AAATTTGCCA TCGTCGTGTC TCCCCCCATG GACAAAGACC CACGATCGAA CCTCAGTCAG
   30121  TGGCTGGGTG CCACCGTATT CCCTGCGGGC GCGACTACTG CTCTCTTCTC ACCCAACCCG
   30181  TACGGCTCCC TCAACACCAT CACCACACTG CCATCCATCG CCTCGGACTG GTACGTGCCC
   30241  GAGTCCAACC TGGTCACGTA TACCAAGATC CATTTTAAAC CAACGGGGTC GCAGCAGCTG
   30301  CAGCTCGCGA GCGGAGAACT CGTTGTTGCA GCGGCGAAAT CGCCCGTGCA GACGACGAAA
   30361  TACGAATTGA TCTATCTGGG ATTTACGCTT AAGCAGAACT CCTCGGGTAC CAACTTCTTC
   30421  GATCCCAATG CCTCCTCCGA TCTATCCTTT CTGACACCAC CGATTCCGTT TACTTATCTG
   30481  GGGTACTATC AATGAACTTG TTAACTCCTG CAGCAGCAGC AGCAGCAGCA GCAGCATGGC
   30541  TGACCAGAAA AGGAAGCTGG CGGATCCGGA TGCCGAGGCT CCGACGGGCA AGATGGCCCG
   30601  CGCGGGTCCG GGAGAACTGG ACCTCGTCTA CCCTTTCTGG TACCAAGTAG CCGCTCCCAC
   30661  GGAAATCACA CCTCCGTTCT TGGACCCGAA CGGTCCCCTG TACTCCACGG ACGGCTTGTT
   30721  GAACGTCAGG CTCACGGCAC CCCTCGTTAT CATCCGTCAA TCTAACGGCA ACGCGATCGG
   30781  GGTCAAGACC GACGGAAGCA TTACCGTCAA TGCGGACGGC GCGCTGCAGA TCGGAATCAG
   30841  CACGGCCGGA CCTCTCACCA CTACCGCCAA CGGCATCGAT CTTAATATCG ATCCCAAAAC
   30901  CCTGGTCGTT GACGGTAGCA GCGGCAAGAA CGTCTTGGGA GTGCTTCTGA AAGGACAGGG
   30961  GGCGCTACAG AGCAGCGCGC AAGGCATAGG CGTTGCCGTC GACGAGTCTC TACAAATCGT
   31021  CGATAACACC TTGGAAGTGA AGGTAGATGC TGCAGGTCCG CTCGCCGTCA CAGCAGCCGG
   31081  CGTAGGGTTG CAGTACGACA ACACCCAATT TAAAGTCACG AATGGGACTT TGCAACTGTA
   31141  CCAAGCGCCC ACTAGCAGCG TGGCCGCATT TACATCCGGG ACGATCGGCT TGTCCTCCCC
   31201  TACGGGCAAT TTTGTGAGCT CTAGCAACAA CCCGTTTAAC GGGAGCTACT TCCTGCAGCA
   31261  GATCAATACC ATGGGCATGC TGACTACCTC GCTCTACGTC AAAGTCGACA CAACCACCAT
   31321  GGGTACGCGT CCCACGGGCG CGGTAAACGA GAACGCGCGA TACTTTACCG TCTGGGTGAG
   31381  CTCCTTCCTC ACGCAGTGCA ACCCCTCGAA CATCGGTCAA GGGACCCTAG AGCCAAGCAA
   31441  CATCAGTATG ACCTCTTTTG AACCCGCCAG AAACCCCATC TCACCTCCCG TGTTCAATAT
   31501  GAACCAAAAC ATACCCTACT ACGCTTCCCG ATTCGGGGTA CTGGAGTCTT ACCGGCCTAT
   31561  CTTCACCGGC TCGCTCAACA CGGGAAGTAT CGACGTACGG ATGCAAGTGA CGCCCGTCCT
   31621  CGCCACCAAC AACACGACCT ACAATCTCAT CGCCTTTACC TTCCAATGCG CCAGTGCCGG
   31681  ACTGTTCAAT CCCACCGTGA ACGGCACCGT GGCCATCGGA CCGGTGGTGC ATACCTGTCC
   31741  CGCTGCCCGC GCCCCCGTTA CGGTCTGAAC AATAAAGACA AGGTGAACCA TTTATACAGT
   31801  CTCACGTCTC TTTATTGCAT ACGCTCCGCT AAATGTTTCC ATTCGCTCAT TTGCCAGTAA
   31861  TACAGCAGAT TCGCAAACTC ACTGAACCAA TCTTCTGTAT AAAAATGTAC GCGCTGCGTG
   31921  TCCAAATCAA CATCAATTTT CCTCATATAC AGACAGGGGC TGCCACCCGC CTCCCCCAAG
   31981  CGCGACACCG CAATTAGGAA TGGTAGCCTG CTGTGCAGGT CCACGTGAAT TAACATCCCG
   32041  CACACGTTCC CGATCGGTCG CTGCATAAAT ACTGGAGAGA AATCGCTAAA CCCCGGTGAC
   32101  GCCCACATAG CCACGAAGTA CACCCCTGCC ACATTCAAGT CATCCTCCAA CCTGGCCCAA
   32161  ACATAAGTGG CCAAATCGGA AGGAGCCAGG TGGCAAGCCG ATAACCCCAT ACGATGCAAA
   32221  GGTAACCCGT GGCAAGCGCA TCCCCCGAAA TGAAGTTCGA AAGAATCGTA ACACAGTAGC
   32281  TGATAGGCAT GAAGCGGCGT CGGCATCTGA AGACCGTCAT CATCTTCGTC GTCTTCCATG
   32341  TCATCCCCAA CTTCCTCCTC GCGCTCCGCT TCCTGTTGGC GGCGCTGCTG GTGCTGCAGC
   32401  ACCATCTCCA GGATCTGCTC GTCGTTCATC TTAATCCGGA ATTATCGCGT ACGGATGTTC
   32461  CTCGTCGTCC GAACTGACAA CAGAAGGCGG AGGAGCTGTC AGTGGTGCTG TAGAGGCTAA
   32521  CGATGCTGCA GCACCGGTCT CTTGCAATTC GAAATACCAA GGGTTGCTAC TGACGGTCCA
   32581  GTTCCCGCCC CGTGAACCAG GCCAGCGGGA AATCGGTGCA GGTAGGGGAT CCGGTGAAGG
   32641  AGACCGGGAA TGGAGGGAAG GAACTGCGAG ATCCTTATCC ACTCGATACA AACCGTATAA
   32701  CAGGGAGCCC AACGCCAGGT ACACCAGGAA CGTACTACAA ACGAACACGC TGATTACAAA
   32761  GTTTAACGAA GACAGATGGT TCTGTAGGAA CAGGAAGCTG CACAGGATGA TGCTGCTGTA
   32821  GGACAGGGCG ACCAGGAGGG CCAAGAACTC GCGCCAATAG CGTCCACAAC ACTGCAAAAT
   32881  CAAACACGTA ATTAGCTATA CGGACGTTCA CCAGCGACTC TCGCGCGTCG TTCCATAAAC
   32941  ACATTGCGCA GATAAGCCAA CTGAGCAGAA CAGAACAGAG AGAGAGGTTG CCGCGTCGAA
   33001  CACTGTTTGC ACTGTCCGAA ACACTCGGGA TGAGACTCCC CGTACTTCCC GTGCACATGA
   33061  AATACCCACT CTTCGACGTT AGCGTAGGAC AACCGACGGT AACCGGGGAA GTAACACAGT
   33121  CCCTGCGACA CGATCGGCCA CAGTTCCGGC GACACCATCA CGCGGAGCAT GCTTCTCAGG
   33181  CAGACGGGTT GGGTCACGGC GCTGCTGCGA GAAATAGTTT CCACCATGAT GGTGGCCGTC
   33241  ACGGTCACGC GACACGCATT CATGAGAACA ACCGGAGACC GCACAAAAGG AACAGACGAA
   33301  GGCACTTGCG AAAAGGACAC CTCAAAGCTC ATCGAGCGGA GAGCCATCTT TACGGATATC
   33361  TTCTCCGCAA TCAGAAAGCC TGTGGTGAAA AACTTAAAAT CTGTCTTCCT GCGAGCAAGC
   33421  ATCCACGGTT CCAAGTCGTA CTTCATCCCA GGTGTAATAA AAAGCAACCT ACGTGAGAGG
   33481  TAGTGCAGCA GGGCGGTCTT CTCTGCCCGG TTCAGGTGAA GGGCACTCAC AATCCGGACT
   33541  ATGCAATTCA TGAGTACGTA GTCTCGCCGT TTGAAACACA CAAACTTTGC GCTGCGTACC
   33601  GTCACTAGCA CCGTGACAGA ACTATGCAAT CGCCTCATCA GATCATTATC GAAACACCGC
   33661  AAGCTAGCCA CGGCTCTATT TATGCGGTAC TCGTTCAGTC TCTCCATTTC CTCCTGTCGA
   33721  CAAGTTGGAT CGTGACGTAG GAGAAAACTA AACCATATTA CTCCTACTTC GTTATGAAAG
   33781  CCACAAGCTC TGCTGACGGT TAAAGACTCC TTAAGAAAGA AAAGGTAGTA CAGTCAAGCT
   33841  GACCCATACA GGTGAACCCG CCCCAAGTCA CGTAAGTCAA CTCACCGAAA GAGGACACAG
   33901  AGCCATATCC GCTGCTTCAA AGCTTTATTG ACGGGTCTAA AGGCGTAAAG AAAAGAAGAA
   33961  TTTACCGTTC TGCATCTCAA ACCCCACCAC CACGCGAAAA AGTCCGAACG ATGCTGCAGC
   34021  ACCGTTCACG CAAAAGTCCC GGACGCGCAC AAATAAACCC TTAATCCCGA TAACGGTGCT
   34081  GCAGCACCGT CACGCTGCTG CAGCATCGTC AGACGTTTAT GACATGCAGC CGATTCCGTG
   34141  CGGATTTATG GTCCCATAAC GGTTCCAGGT CCTTTCGTTG CTGCAGCACC GTTTCACGTA
   34201  AAGAAGCTGT ACAGGTCAAA CTGGTCCGGA TTACTGATTA TTCGGGGGAG AGCCACGTGA
   34261  CGTAGACTCG AACGACGTCC ACTTCCGATA CAAACCACAT CTCTCTGGAC ACAGGCTTGT
   34321  CCGCCTTGAG CCAAACCATG TGATTCTTCC GGTCCGTTCT GACGTCAATG CCGACACGCC
   34381  TCTTGGTGTT TGAACAGGCA TCCCAGTACG TAGCCAGGAC CACTCGGTGA CGTCGAGGTT
   34441  GAGGTTTAAA GGTCACTACG GCCTGTAACC CGGTACTCCA GGGCCCTAAA CTAACATATT
   34501  CTCCGGCCCT GCCCACTACA TTCGGGTGAT CAAATATGAC ATAATCCTTA AACAATTTGG
   34561  GGAACTTCAA ACAGCCACAT TTGGGCGGGA CAGGAAGATG GTGCGCAGAA ACATTGATAT
   34621  GAGAGCGCCA TCTAGGGACA TCAAAGCGGT GCCCGCCTGG ATGGCAATCG TACTTCTTAG
   34681  TTCCGGTAAA GTAATAGGTG TGAGTCCGGA AACACGTAAA CTCCGTCACT TCCTGTGTCG
   34741  TCATTGCCCT CGCCCCTAGT GACGTCAGAG TGCCACGCCC CTTGTACAGT CTAATAAATT
   34801  TTAATACACC CCCGCCCCTA GCATATAAAA CAATGGGAGC CTCGCCCACA TTCCTATCCC
   34861  TAATAAAATA CCATCTGACC GAATACCCGT GTTCCATCCC TATTGTTTTA GTATAATAAG
   34921  GGTCATAAGT CCACAACTCC GCGGCATTGC CCTCTGTCAC CACCAACAGC AAATAGGAAG
   34981  ATGCCATGTC ATCCTCTCGT AAAAGCATCC TCCAATCAGC TACCTCTTCC GTGTAGTACT
   35041  GAGTTGGCTG ACTGTAATCA CGCCCCGTGA CGTAGGCTGA CCACGCGGAA GGAACACTTC
   35101  CGTGCATGCT CAGTAGCTGG TCAGCCTGGT GAGTATCCAG GGCCTTCATA AAGGTCAAAG
   35161  GCGCCATAAT GTGATAACAC AGTCCATCCG ATCGGAGGAA ATCAAAGGGA ATATGTACAT
   35221  CTTCACAATG GCGCCTCCCA GAATAAGACC ATGCACAGAT TTGACCTTTC CACCAAGCAC
   35281  GTGACTCGCA AGCCTCATGT TTTTGACCAG TCAGATCGCT CCGTATATAC TCGTCTCCTA
   35341  TTGGTCGATC AAAACCGTAC GAACCAATAC TAGACGCAAT CACCACTACG TAATCCGCGT
   35401  CATCCCTAGA GATAACACTA TCCGCATCCC TATTGGCTGA CCAATGACCA CCGGAAGACA
   35461  GCAAAAGGTT TAACCCTTTT GTGTGTAAGT CCATCCTATA ACCCTGGAAA CTTTCCAATG
   35521  GGGGATCTAG CGCCACTATG CGGCCAACCT TTTTTGACCC TCTGTCCGGA CTAGAAGTTG
   35581  GCGGGACAAA GCCGCGCATA CAGTGCCCCC TAGCGACATC CCTATGCAAT GAATTCGATG
   35641  GTCCTTGAAC TCCGTAAAAA AATGAGCAGT GGTCCTGACT GCGTAATAGG CCGGCCCCCT
   35701  CACATCCTGC CCCCACAAAA GGGCGTCTAC CTTCTTACAA ATATCTCTCA GCTGATTGGT
   35761  CCAGTCCAAC AGAATGACCG GGGACTCTGG CGTCATAATG GTATGCATAC GCAAAATCTT
   35821  TCTCATCATT TCACTGGTCC ATTTATATGT GCCGTCATAG CGCGCCCTAT TAATAAGCGG
   35881  ACACACATCG GGATACATGT CCTGAACCAG AATAATGAGC TCCCCGCTAT CTTTACCATC
   35941  CAATACCCCG AGCCGCCGCA TTTGACTGAC AACCCAGGGG CCGTCCGAAA AAGTCAAAAA
   36001  AGTCTCATTC CACCATACAA TTAACTTGGG CCACGAAGGA AAATCCGGCG AATAGGTGCC
   36061  CATCAAGCGC CTGACGTCAG CCTTAGGATA TGGCGGATCC CATCTGGAAT CCGACCCATT
   36121  AAAGCACGAA GATAGGGCAG ACATCGGCCA ATGGCCAGGA GAATGGGTAG AATTAATAAG
   36181  GACTCCGCCT CCATTTCCGA GCTTTTAAAA AAAAGAGAAA ATGGAAATCA GCCAAGAGAC
   36241  CACCACCCCG TGATTGGATG ATTGGTCATC AGAAGATCGA TAAGGGAATT TATTTTCTGG
   36301  GAGCCCCCCC CCCCCCTACT CCTATTTAAA AAATAACCCT TTCCTCACCA AGCTCAGAAG
   36361  ACAGAGGAGG AGAGTAGAGC GCCGCTCAGA GGTCATCCGC CGAGAGAAAA TCCCGCGCAG
   36421  AGAACAGAGC TCTCAGGTAG GGGTCTGGAG CTCTCTGGAA AAATCGCGGG CTCTTATACA
   36481  CTTACTCTCC GCCCATTCGA AAGCCGCGCC TGACTAGAGT ACACACTATA AATTCCATTC
   36541  CGGTGACTTA CTACTAGGCG CTGGCCACTT ATCAAAAGAA ACAGTTCTAA GAATAGGACA
   36601  AAGTCCAACC GCAATAAAAC ACCCTTGTCA AACATGATAA GAGTGTTCTC GAGAAGGTAC
   36661  TGGAAAAGCA AACAGTCCAA CTCCCAAGTT AAATATTACG CAAAGAGGCG TAACGAGAAA
   36721  AGACTAGAAA GTGTAAACAC ACCTCTCCTA GTTATATATA AACCCAGCGG GGCAGTCCCT
   36781  AGAAGAACAC TACCTCAATC CAGTTACACA TTAACCCGGG AACCTATTAT TGATTAACTA
   36841  GACAGTACTT CCTCATTTTC TACTGGAACT TTCCACTGCC CTCCGGGGAT TTTCCATTGG
   36901  CAATCATTAA CTTGACTTTG TACTTTATGT TTACTCTCCA TAGCAACGCA CCTTATATGG
   36961  AAAATATGCT CCTCCCCGGA CCGCCCATCG TACCACCTGA GCAGGTAGGC TGTACCTTTT
   37021  CCTATTGGCC CATTATGAGC TCACCTGGTT AATCATATAC CCGCTCCGCC TATATAGGTA
   37081  GCATACCGGG ACAGGTTCCC TCACAGTCTA TTGCAGACTG CCGAAGAGAG AGGAGCTCCG
   37141  CATAGGACTG GGACCAGAAC CCCGAGACTC TGCCGGTAAT ATTTTAATTT CATTTAATCG
   37201  AATCAAATAA ATCAAAAATC AACTCAAACC CATGATTCTC AATGGAAATT TCTTGTGATT
   37261  TTCTTTCGCG CGCGACCACC CCCTATGGCA CCCCCCTGTA CACCCCCCTG TACACCCCCC
   37321  TGTACAAGGG AACCTACCCC CCTGTACAGC GACCACCCCC CATGGACACC CCCCTGTACA
   37381  TTCTACAGGT ATGGCCCGCA ACCCATTCCG CATGTTCCCT GGGGACCTTC CATACTACAT
   37441  GGGGACCATT TCCTTTACTT CGGTGGTCCC TGTGGACCCT AGCCAGCGGA ATCCCACCAC
   37501  TAGCCTTAGA GAAATGGTGA CCACCGGCCT GATTTTTAAC CCTAACCTGA CCGGCGAGCA
   37561  ACTGCGGGAA TACTCATTCA GCCCCCTAGT GTCCATGGGG AGAAAGGCAA TCTTCGCAGA
   37621  CTACGAGGGT CCCCAGCGCA TTATCCACGT TACCATTAGG GGGCGCTCCG CGGAACCCAA
   37681  GACCCCCAGT GAGGCCCTCA TTATGATGGA GAAGGCGGTC CGTGGCGCGT TCGCGGTTCC
   37741  TGATTGGGTG GCCAGGGAAT ACTCGGATCC CCTCCCCCAC GGCATAACCC ACGTGGGGGA
   37801  CCTGGGCTTC CCCATTGGTT CCGTGCATGC CCTGAAGATG GCGCTAGACA CACTGAAGAT
   37861  CCATGTCCCT CGCGGAGTGG GGGTCCCTGG CTATGAGGGT CTCTGTGGGA CCACCACCAT
   37921  CAAAGCCCCC CGACAATATC GGCTCCTGAC CACTGGAGTT TTCACCAAAA AAGATCTGAA
   37981  AAGAACACTT CCAGAACCAT TCTTCAGCCG ATTTTTTAAC CAAACTCCCG AAGTTTGTGC
   38041  CATCAAGACT GGCAAAAATC CGTTTTCTAC AGAAATTTGG TGTATGACTC TCGGCGGGGA
   38101  TAGCCCCGCC CCCGAGAGAA ATGAACCCAG AAATCCCCAT TCTCTCCAAG ATTGGGCAAG
   38161  ACTGGGTGTC ATGGAAACCT GCCTACGTAT GAGTAGGCGG GGACTCGGGT CTCGGCACCA
   38221  CCCCTACCAT TCTCTGTAAC CAATCCCTGA ATAAAGATTT GCATAACAGA ACTTTGACTC
   38281  CTCCTTTTAT GTGGGTGGGG TAATGGGCGG CACTTGGGGG TAATGGCGGT TCCTATTGGA
   38341  TGGGTAACAC CGACTCCGCC CTACAAAGTT AATGATTGAT TTTTCGGACT TAGAAAAATT
   38401  TCGACTGTCA CCTGGATGTT TTTCCCCACT TAACCTCTAG GGGGAGATAG ATCGCGTCCA
   38461  AGGGGAGGAG CTCAATACCG GACCGCCTAT TAGGTGTGGC TTCGGGCTCC GCCTAGTGGG
   38521  AGGAGACAGG AAAACCACGC CTAGTGACGC TGGGTCAAAG TCCAAGGGGA GTGGTTTATG
   38581  CGCACCGCCT TGGGGCGTGG TTTGGGCGGC GCAAGGTAAC CCTTGGACTG GGAGGAGACT
   38641  TCTGTCCCTT GGGCGTGTCA AACAGGTAAA CCCCACCCGC GCGATTAATG ATTAATTTTT
   38701  CGGACTTAGA AAATTTTCAA CCTGATACTT TATTTTCAAG CTTTTCCCGC CGACGGGCAA
   38761  GCCTCCTATC TCTCCGTCTA TGACTCCACA GAGCCTCATC TGAATATGTA AATGTGCTGA
   38821  ACCGCAACCC CGTAGACCGC GCCCACCCCA GCATCAAAGG TAACGCCCCC GATGCCACAA
   38881  TGTAATTACC CACTGTTAAA TTAGGATCCT TACACCAATC ATTTCTGTAC AATTTAAACC
   38941  ACCGCCCACG CGGGACTTTC CCGTGGTGGT AGAAAAAGGT TTTGAAAAAC GCGCGCATTA
   39001  TTTTCGTGGC TTCATTAATA GCGGACATGC GCAGATCCAG AAAGGTCAGA CACACCACCA
   39061  CGGTCACATG ACATTTGCAT GGAGACAGGG ATTGGATACC GACACAATAC GCCATCGGAT
   39121  ACTGAATGTC CACATTGGTC CGTGCATATA CAGTGTGCCA CCTCCTCTTG ACCGCAGCCA
   39181  CGAATCCCCA GAAGAGTTCT TCCCGCCACA AAATCGAAAC CGGGGCGGCG GCCCCAAAGC
   39241  ACAAATACAA AGGCATCCTC CTGAGGCTCT AGAAAAAACA ACTCATTAAC AGGCATCCCG
   39301  CTCATAGGTA CATTCGTGTA AACAGGGCTG CATGCCAACC AATGCCCCGC GTTTTACAAA
   39361  GTGACGGGCC ACCCTATTGG CGGAGGGGGT CCACGTATTG CGCACCGCGT AAATAGAAGC
   39421  CACCCCTCGC GGAACCTGTG TACATTCAAA TCTCCTCCAA ATACATTCGC GCAGTAAAGC
   39481  CACCGCCCTT TTCAAGAAAG TCCAATCAAC CTTATGCGTG GGCAAAAAAA TAGAAGCTGA
   39541  ATATACCCCC GCAAACTCCT CCAATCGGAA CAGGTAATCT ACACTATAGT GGGACAGCAT
   39601  CTCAACAGTT AAACTTTCCC AGGCATTTAT CACCGTCAAT TTCAGATCAT GGAATACGGC
   39661  CAAGTTAGGC TCCATCAAGG TCACGCGGAG GTGGAAGTAA TACATCCCGA AATACCCTGT
   39721  TAAAAAAAAT AGAAAAATGA ACTAACCGAC AATAAGATCG GCAGTACCCA GTTTCGATCT
   39781  GGGGACCTCC GGAGTGCAAG TCCGACGCTC TTACGGCTGA GCTACACTGT CGATCTTGAT
   39841  CCGCTAGGGT ACGCAGTCCG GAGAAGAAAT ATACTAAGTG AGACCCGGTC CTATATATAC
   39901  AGGTTGGTTC AAAGGAACCT TTGTACCCAT TAAAACAGGT GCGTGACTGT AGAAGCCACA
   39961  CCCCTACCTG TACCGATAAG GCACACCCTG AGCAAACAAA CCATAAAGGT ATACTTCCTT
   40021  ATTCAGACAG GTATAAATGG AACCTCCGCA CAACAGTCCG GTACCATTTT CCATCGCGAA
   40081  AATGGGCAAC CCTACTCTGC TCCTTCTTTC AGGTCTCCTT TCTCTGACCC AGGCCATTTC
   40141  CATCGGAGAA CACGAAAACA AAACCCGGCA TGTGATTGTA TGGCGGCACT CCTCCTCCCA
   40201  CCAATGCTCT GATTGGAGAA CAGTCACGGA ATGGTTCCCG CCCCAAAAAG GCAACCCGGT
   40261  GAGACCACCC TACACCCAGC GGGTTTCCCT GGATACGGCA AACAATACCC TCACGGTAAA
   40321  ACCCTTCGAG ACAAACAACG GGTGTTGGGA AACTACGTCA CAAGGCATTA ACCATCCACC
   40381  AACCACCATT CAGTACCGGG TATGGAACAT CACCACCACG CCCACCATAC AGACAATCAA
   40441  CATTACCAAA ATAACTGTTC GGGAGGGGGA GGACTTTACC TTATACGGAC CTGTGTCCGA
   40501  AACCATGAGT ATTATCGAAT GGGAATTCAT CAAGGATGTC ACGCCCCAGT TCATCCTCCA
   40561  ATACTATCTC TCCATTAACT CTACTATTGT GTACGCAAGC TACCAAGGGA GAGTTACCTT
   40621  TAACCCCGGT AAAAACACAC TAACCTTAAA AGGCGCGAAG ACCACCGACA GCGGCACCTA
   40681  CAAGTCCACG GTGAACCTCG ACCAGGTATC CGTCCACAAC TTCCGAGTAG GAGTCACGCC
   40741  CATCGAGAAA AAAGAAGAAG CTACCGCAGA GACACCTGCC AGCAAGCCCA CGCCCATACC
   40801  ACGTGTCCGA GCGGATGCTC GAAGTACTGC CCTATGGGTT GGACTTGCCC TTTGCATCCT
   40861  GACTGTTATA CCCGCCCTTA TTGGGTGGTA CTTCAGAGAT AGGCTCTGTG TTCCCGATCC
   40921  AATCATTGAA CTGGAAATCC CCGGACAACC CCATGTAACA ATACACATAT TGAAAGGTCC
   40981  CGATGATGAT TGCGAAACTT AATGATTGAC AAACGTAATA AAAAAGCTGT GACGCACATA
   41041  AGTACGTGTC TGTGTCATTC ATCCATACCT ATATATGGTG ATAGCCCCTT CCTCAATACA
   41101  CACCGAGCCG CGATGGACCC CAGACCACTT GTTCTGCTCC TCCTCCTAGC GTCCCATATA
   41161  AGTACATTCC GGCAAATGTA CTTTGAAGGG GAAACCATCC ATTTCCCTAT GGGCATATAT
   41221  GGAAATGAGA CCACCCTCTA TATGAATGAC ATCATCCTGG AAGGAACACG CGCCAATACG
   41281  ACCACCCGTA CAATCAGCCT CACGACCACC AAGAAGAATG CGGGAACTAA CCTGTACACT
   41341  GTGATCTCCG AAACGGGACA CAACGCCACC TATCTGATAA CTGTACAACC GCTGGGACAA
   41401  TCGATACACC ACGCCTACAC TTGGGCTGGA AATACTTTTA CCTTACAAGG ACAGGTATTT
   41461  GAACACGGTA ATTATACACG ATGGGTGCGG CTGGAGAATG CGGAACCGAA ACTCATTATC
   41521  AGCTGGGCAT TGTCCAACAG AACAATAAAC AAAGGACCGG CCTATACTGC AAACATGGAC
   41581  TTTGATCCCG GAAACAACAC CCTCACTCTC CACCCTGTGC TGATAACAGA TGCCGGGATT
   41641  TTCCAATGCG TCATTGATCA GCAAACAAAC CTAACCCTCA CCATAAACTT TACAGTCTCC
   41701  GAGAATCCAC CAATCGTAGC ACACCTGGAT ATCCATAAAA CTATTTCTAG AACAATTGCC
   41761  ATTTGTAGCT GTTTGCTTAT CGCGGTAATT GCGGTCTTGT GTTGCCTACG TCAGCTCAAT
   41821  GTAAACGGGC GGGGAAATTC CGAAATGATA TAAAACAATA AAGCAGTGTG CGTCATGGAA
   41881  ACTTTTCTCA GGTGCTTCCT CATTCACACA GGTATATATA GGGAATGGAA AATTAGACAG
   41941  ATACCCACAC CGGAACAATG CTACTTCTCA CAGTAGTTCT GTTGGTGGGG GTCACCCTCG
   42001  CTGCGGACCA TCCTACTCTA TACGCTCCGA AAGGGGGCAG TATAGAATTG GGTGTGGGGG
   42061  CTAAACAGAA AGGGCAATAC AAATTTGAAT GGCGGTTTGG AAATCTAAAA ATTGTGATAG
   42121  CCGAAATGTC ATCCACTAAC CAATTAGAAA TCAAATTTCC CGATAACGGT TTCCAAAATC
   42181  GATCCGAGTT TAACCCCACC AAACATAACT TAACCATTCA TAATGCCAGC TACGAGGACA
   42241  GCGGAACCTA CTCACTCCAC CAGGAAGAAA ATGATGGCAC GGAACACACG GACAACTTCA
   42301  AAGTGATTGT TCAAGGTATG TCATTATATA CATATTTACA ATATGCATTA ATATCACCTA
   42361  TCTAATAGAG CATTAATTAT CCAGACCCGA TTCCACGCCC TGAAGTCAAG GGAACCACTA
   42421  TGCAAATCAA CGGGAAAACT TTCACCAATA TATCCTGCCA TCTACCGGCC GGTTCCTACG
   42481  GCAATGTCTC CTGGCATTGG AATTATACCG ACCCAATCAT AGTCGGGTAC GAAAATCAGA
   42541  GCATGCTCGT TGGACCTTTA GGGGTAATGT ATTCATGTAC GGCATCCAAT CAAGTCTCAA
   42601  AAAACTCCAG TGCAATAAGT ATGGACACCG CCGAACCATC AGAGAGTAAG TAGCGCCCTC
   42661  TATAGACATT ATATAGAATA TAACTGAACA CATTAAGAAA CCTCTGTAAT TATTTATAGG
   42721  AGCGGAGTGC GCATATACAG GATACATTGC GGGCATTATA ATCTTAGGAG TGCTTTGCAT
   42781  ATTGTTCATT TACCTATATG CAAATACCCC TGAAGTGCGG CAGAGAATAA CCGACCAATT
   42841  AGAAAAGCTT CTCGGAACAT TCTGTGACGT CAGTATAGAA GACGGAATAC CGGAACGCAC
   42901  CAGAAGAAAC AAAAAAAGAA TCATCTTAAA GGAGCCCTCC CATAGGTGGA TCTGGATTCA
   42961  GTCATTTGCA TAATATGCTG TGTCATAACC GCCACCATCA CCATAGCAAT CATTGGGCGT
   43021  AAGTATTGTG ACGTAAGAAA AGGCATGTCT AAAAAAACGG TCACTCACCA TAATGCTGCC
   43081  CCCGATAGGT TGCGACCGCC TTCCGGAGTT TGACGTAGTA TGCCCGCGAG ACTGGATCGG
   43141  ATTTCAAAGC AAGTGCTACT ACTTTTCGGA GTCAGAGTCC AATTGGAGTG AAGCCGAAAA
   43201  ATTTTGTAGA CAGCAAGAGG CGGAGCTAGC AGTTCGGCGT TCCGAGGAGG AAAAGGTAAA
   43261  AAGTTAAATT CCAGGAAACT CCTAATTCCC CGAAAAATTA CAAAAATTAA CGGAGACCCT
   43321  TTACAGGAGT TCCTTCTGCG CCAATGCGGA ACAGGAACTA ACTGGCTGGG CGTAACCAGG
   43381  AAGTCGAAGG ACGGAGCTGA TTGGGTGGAT GCATCGTACG ATGATTACGT ACCATGGTGA
   43441  GTCATGTTAT ACGTCACATC CGGGATGTGA CGTATGCGGA AGTTGATCCG GGAGTGAAAA
   43501  CCCGGAAGTA ACCTGTTAAT TTGCATACAG GTATGAAATT CGGGGAGGCG GAGACTGCGT
   43561  GTATTTAAAT GGAGACCGAG TGACGTCAGC CTACTGTGAT ACCCAGAAGC TATTTGTCTG
   43621  TTCCTGTCAA GATTCGTATT CGTATTGGTT AGAAAACAAA TAAATCAATA AACTAATTTA
   43681  TGATATCATT CATATTTATG GGTGTGGTTT TATTATGCGT CATAAAACTA TTTTGCGTAT
   43741  AGCGACACGC TGCGGTTATG GCCGGTTATG ACTGCGTTAG TTTTTGAGGT TATTATACAT
   43801  CATC
//