spacer

EBI Dbfetch

LOCUS       AC_000014              43804 bp    DNA     linear   VRL 10-SEP-2009
DEFINITION  Fowl adenovirus A, complete genome.
ACCESSION   AC_000014
VERSION     AC_000014.1  GI:56160738
DBLINK      BioProject: PRJNA40323
KEYWORDS    RefSeq.
SOURCE      Fowl aviadenovirus A
  ORGANISM  Fowl aviadenovirus A
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Aviadenovirus.
REFERENCE   1  (bases 1 to 43804)
  AUTHORS   Davison,A.J., Benko,M. and Harrach,B.
  TITLE     Genetic content and evolution of adenoviruses
  JOURNAL   J. Gen. Virol. 84 (PT 11), 2895-2908 (2003)
   PUBMED   14573794
REFERENCE   2  (bases 1 to 43804)
  AUTHORS   Chiocca,S., Kurzbauer,R., Schaffner,G., Baker,A., Mautner,V. and
            Cotten,M.
  TITLE     The complete DNA sequence and genomic organization of the avian
            adenovirus CELO
  JOURNAL   J. Virol. 70 (5), 2939-2949 (1996)
   PUBMED   8627769
REFERENCE   3  (bases 1 to 43804)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUL-2003) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, U.K.
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from BK001452.
            On Oct 3, 2005 this sequence version replaced gi:33694876.
            This record represents an alternative annotation for U46933 /
            NC_001720.
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-43804             U46933.1           1-43804
FEATURES             Location/Qualifiers
     source          1..43804
                     /organism="Fowl aviadenovirus A"
                     /mol_type="genomic DNA"
                     /serotype="Fown adenovirus 1"
                     /db_xref="taxon:190061"
     repeat_region   1..54
                     /note="ITR"
                     /rpt_type=inverted
     CDS             519..743
                     /codon_start=1
                     /product="ORF0"
                     /protein_id="AP_000400.1"
                     /db_xref="GI:56160769"
                     /translation="MTSEEKLQSSSPETGLAAVVLQSPLEVRVPAVLPPPVRIDIYRY
                     PGFPPTETIWHGLITQTELNQALESIVEQL"
     CDS             794..1330
                     /note="dUTPase"
                     /codon_start=1
                     /product="ORF1"
                     /protein_id="AP_000401.1"
                     /db_xref="GI:56160739"
                     /translation="MDPFGSSSVPPCSTSDLPEPKLYFVRLSPHAVPPVRATHGAAGY
                     DLFSAYDIKVPARGRALVPTDLVFQFPPGCYGRIAPRSGLAAKFFIDVGAGVIDPDYR
                     GNVSVVLFNFSESSFNIRRGDRVAQLILERIMVPELSELTQLGETDRGASGFGSTGMG
                     AVDRNQRSVLEWLTPGSR"
     CDS             <1334..1480
                     /codon_start=1
                     /product="ORF1A"
                     /protein_id="AP_000402.1"
                     /db_xref="GI:56160770"
                     /translation="DPCDEVDFAVRLQADFEGDDDTYGHCLCEGSTSKRPCCTLCNSY
                     CVLL"
     CDS             1483..1668
                     /codon_start=1
                     /product="ORF1B"
                     /protein_id="AP_000403.1"
                     /db_xref="GI:56160772"
                     /translation="MIVSVWQLATIAIEFCDKWVGKYYRFRPYHERLLLMQSRQALER
                     SLRRCVSEVGPPPEPLE"
     CDS             1816..1947
                     /note="contains transmembrane domain"
                     /codon_start=1
                     /product="ORF1C"
                     /protein_id="AP_000404.1"
                     /db_xref="GI:56160771"
                     /translation="MDQTATHTALILLIVLTVFTGAVVALMLYIAITGLPCSMLCSQ"
     CDS             1999..2829
                     /note="related to parvovirus Rep"
                     /codon_start=1
                     /product="ORF2"
                     /protein_id="AP_000405.1"
                     /db_xref="GI:56160740"
                     /translation="MSRESERYWTLVHALIDRGVVSREQWQMVDPAQYQFYHRSKQRG
                     FKVRHILRDVIRHMCWSRTLLDYMSSASTPSPDDVLRNPLYQLLLCNGYNPAVVGTAL
                     IRWAGHQSNRNTVWIRGTPMSGAPYLAQAIAYCSPLVGSVDWRNKSNPFEGCPDSLVF
                     WWDGGYVYDCCVGLVKQVFRGEHVILPPEGLRGPNPCSELFRTPVLMYSQADICMTRL
                     RSGELSAEHAVGLRDCMYLIRLTEDFDCAGGISCADVKQFVAWSREHPGEVRETHELK
                     "
     CDS             complement(join(2892..3527,15081..15086))
                     /codon_start=1
                     /product="ORF14"
                     /protein_id="AP_000406.1"
                     /db_xref="GI:56160761"
                     /translation="MATFESCDLVWDSDNDEDEPQHSWHIYIEPLFTRVGITLITDPD
                     FLLFLLKRQMYPFKHSPHCITDEECDLQLRSFCSWIRVIEMRCTDWTIQYICSCETPR
                     SLFCLSLIRVLTAHWAKTVVNFVAQHDHQPQLPLNLILYTYATHCRLCNLNPALEQIY
                     TAVTVARRQGAYTRLEGQTLYVCLPRDIVNYPCIACFYHLLLRLPVAINFHVI"
     CDS             complement(join(3549..4448,15081..15086))
                     /note="related to ORF2 and ORF12"
                     /codon_start=1
                     /product="ORF13"
                     /protein_id="AP_000407.1"
                     /db_xref="GI:56160762"
                     /translation="MACTKRRRESQSSLSSEEEQIASCIPDTPSPCLFPSTSPMDQLV
                     ERLFVEGVAHEVQWNFPSKNLIPTYERERVLEALKERFGPGQSLINQLPSEEPDTLKA
                     AFYNVCDNWFHQMMEAEGYEGKVAANAILRWLRGELNTLVLCGGRLSNAKSLFNALCA
                     CFPLAISDSRINSILSLGEIAPHASLYCLPFVDEKPDPLMLHFMEGNAATCRLNKKTF
                     HIPSTPMLIHCADLSLANEFTARNTVVFFLTGDHTKTPPCYHPRKELRDFVANAAACA
                     CLMTLHCKRDNKLCNPCIRTPLQNQ"
     CDS             complement(join(4462..5385,15081..15086))
                     /note="related to ORF2 and ORF13"
                     /codon_start=1
                     /product="ORF12"
                     /protein_id="AP_000408.1"
                     /db_xref="GI:56160763"
                     /translation="MAERFRKLKDSVKRLRNRHTGEDDDDLVTHRLIFDLQRNNIFTY
                     KDWLTRYPQDAELFESVAPALLEEARKLYCSYGLSQTINFNLQGFELSSQRDLRAMLE
                     AEGYNAPVAIYAIYLWMSAMSISRLCHYTNTLYVVGEPSSAADIFTASILRLFQFVLT
                     ANINAFDFGQYARQQDLVKMLYFPCTAHCNTFKDPVANQLLKGRSFTTMTRDGLVDIS
                     EKKCLVRLYQLPHPEHLPTAPDEHIIIRFYEPANGCGFFLGELSRYIHRIHQLQADND
                     NDALRALLCENKGMLCSRSWTSPCNACHSSHDI"
     CDS             complement(5366..6538)
                     /codon_start=1
                     /product="IVa2"
                     /protein_id="AP_000409.1"
                     /db_xref="GI:56160741"
                     /translation="MIAPRKRKAWEYEEEEYEASRDFYQRVTSWYDGAVDLAPQLFRE
                     QHFPSYDEFYSLGGVNEKFLEAHEEVKAQEQMDSRYLQHGQLPSINMGKQPIIGVIYG
                     PTGSGKSHLLRALISCNMLDPIPETVIFITPEKNMIPPIEQTSWNLQLVEANFDCRED
                     GTIAPKTSTFRPEFMEMTYEEATAPEHLNIDHPDNIYVKVSKRGPVAIIMDECMDKLC
                     SGSSVSVLFHALPSKLFARSAHCTAFYIFVVLHNMAPRTAIGNVPTLKVNAKMHILSC
                     HIPQFQFARFLYAFAHNISKDLVVLLKAYFSFLQQNQRFSWVMYTPDPVSESFRWCSI
                     DQQYSIIPLNVNIQERFLKTAKSIIKFSETHRKQLERNPKLTDLEKLSPPGTFQET"
     CDS             complement(6501..10268)
                     /codon_start=1
                     /product="pol"
                     /protein_id="AP_000410.1"
                     /db_xref="GI:56160742"
                     /translation="MEADAGPPLTDSVLGPDSHVIRTISAKRLEETRKYFKSFRGNPL
                     RTNVYYIEEQPFRFQPTVFPIGLKKFLRTHRFLLSKRARGYDRIDYLHYARDPERSLP
                     DFKPAQVTVINFKGKTARLRTVHISEHPALPPMLIAKNVTGEWVWITSRTPVQQCPTC
                     GRHWVRRHSCNERRSAFYYHAVQGSGSDLWQHVHFSCPAQHPHIRQLYITYDIETYTV
                     FEKKGKRMHPFMLCFMLSGDPQLVSRAERLARQDDRLKALDEGFYWLDSHPGEVARRF
                     RNFRSRLQIEFAQNLVDRYAAANRDYCDQLVKDGKYGSVHKIPYELFEKPTSPLSLPD
                     NFYSVDIVVLGHNICKFDELLLATELVERRDLFPEACKCDRSFMPRVGRLLFNDIIFR
                     MPNPNYVKKDASRVERWSRGIVSHQDARSVFVRFMVRDTLQLTSGAKLSKAAAAYALD
                     LCKGHCPYEAINEFISTGRFHADADGFPVERYWEDPSVIAEQKNLWQKEHPGQQYDIV
                     QACLEYCMQDVRVTQKLAHTLHDSYDAYFQRELGMEGHFNIFVRPTIPSNTHAFWKQL
                     TFSNYVREQRATCPPSVPEPPKKKGRTKKKKQPSPDYVAEVYAPHRPMFKYIRQALRG
                     GRCYPNVLGPYLKPVYVFDICGMYASALTHPMPHGMPLDPKFTAQHVEELNRLLTNES
                     HLSYFDARIKPSILKIEAYPPPPEMLDPLPPICSRRGGRLVWTNEALYDEVVTVIDIL
                     TLHNRGWRVQVLHDEMNIVFPEWKTLCADYVTKNILAKEKADREKNEVIRSISKMLSN
                     ALYGAFATNMDTTRIIFEQDLSEADKKNIYEGTEIVKHVTLLNDDSFNGTEVTLENAP
                     NPFSEESLRQQFRYADDPEQEEPEAEEDGEEEGDDSDRESARKPKNALTEDDPLVAVD
                     LEVEATLATGPYIPEGELSSAHYARANETRFKPMRLLEATPEALTVLHLESLDKQVAN
                     KRYATQIACFVLGWSRAFFSEWCDILYGPDRGVHILRREEPRSLYGDTDSLFVTETGY
                     HRMKSRGAHRIKTESTRLTFDPENPGLYWACDCDIKCKACGSDTYSSETIFLAPKLYG
                     LKNSICVNEQCRTVGPGKIRSKGHRQSELIYDTLLRCWRRHEDVQFGAQSNIPELHTR
                     RTIFKTTLLNKVSRYDPFTIHNEQLTRVLRPWKDLTLYEHGDYLYPYDNEHPNPRTTG
                     DVRPVPIVGHEDPLAPLRWEPYAFLSEEECGQVHDLLFADDSSQEAESLGV"
     CDS             complement(join(10269..12155,15081..15086))
                     /codon_start=1
                     /product="pTP"
                     /protein_id="AP_000411.1"
                     /db_xref="GI:56160743"
                     /translation="MAAYRVFADLTGQSLATVRFCEPVITADYVLVREEPALVHPRSV
                     FLVSRVYDYRLMQLRDLAPRSPNVAAPPYNGLPPPHLLLGYQAMHRALNDYLFDNRVF
                     MQIGYDSPPQRPRRLFWTCLTDCSYAVNVGQYMRFLDLDNFHGTFTQMHNAVLMDRVA
                     ADMGRAHLRGRGIDVGRHGQVLPQLDAEHHSLLSGNGAGGLQEGVLMRTASAADAELL
                     AAIRQLRVALCHYLFCYAYDLFQTEERYRFLPGSDVFLEPNWLSYFAEAFAELDTQQL
                     VRDAERKFRGRRDVEEPTETMARCFMSTLASDAVSLAGTGLSGGAITLCSRRVTDRTG
                     LRPRDRHGRAITASEARRIRPRAVRAFVDRLPRVTRRRRRPPSPAPPPEEIEEAAMEV
                     EEPEEEEEELLDEVIRTALEAIGALQDELSGAARRHELFRFANDFYRMLLTARDAGLM
                     GESFLRKWVLYFFLAEHIASTLYYLYSHFIANREFRRYVDVLTLQVLVVGWDVNAQQV
                     FKRIWSEQSNPATIFETLWERILRDFLMMVERTGQFEGMDDADQQLFLSDIQYRDRSG
                     DIEEVLKQLNLSEELIDSIDISFRIKFKGIVAIATNEEIKANLRRVLRHRREDIEAAA
                     RRGQPL"
     CDS             12193..13329
                     /codon_start=1
                     /product="52K"
                     /protein_id="AP_000412.1"
                     /db_xref="GI:56160744"
                     /translation="MHPVLQSVRNASVSAGGPHQQQPQQQQHGVSSVRRPPSPPRYPA
                     QHAYPGAGATPTAGRGDFDGALDPDEGPVACGLAAGAGVDEVRMRERDAARRATVPEI
                     NLFKARRDVVPNGDYERDLMYHSGQAIDIDRQRVLTPEDFKGSEPAFTPAVNHMRAAE
                     LKRAAEQTAFGEELRNTCHQTRIRTALLRPEIGAGIYYLYDFVQTYLEHPDGRVKLNP
                     QLVLVAQHAGNTMLAQRLWAIAEEKNAWLRDLIEMAYMIVNDPYLNTEQQLSAICTTV
                     VELSMKYAKLAAKNGYPSMAQMAKAQEFFYRVMQAVLDLGVQVGVYNNRPARYRQKRM
                     SEIPQMTDAEYMFGLTQALESRPPQGESFADEGPSESDDEDDFI"
     CDS             13316..15043
                     /codon_start=1
                     /product="pIIIa"
                     /protein_id="AP_000413.1"
                     /db_xref="GI:56160745"
                     /translation="MTSSDTFLALAPYGRQEVADALSSLPDGKDARSLRHAPYANRLI
                     KLQSAMVPPKVDGTSERVAEIVKGLAEQGAIYPDQMGAIHSDLLNRAYTWNSMGVQES
                     IQALVNDVIHGQNRTLQDELARTKEIANASLLTQFFDSLYKTVDRGQRNFEGFKKLLR
                     LFVNNVPNAEVYGSSGSFSVQINLGGSSQNINLTNAFENLKPIWGARWDAVNNPRIGA
                     LLTPNTRALLFFVSSFYDYGAMEPGSYLDNIMRLYKEAIRADVDAEGDAIMELGEAGA
                     NLNLRFNDYKDTLNYLLQNREVVPDTAPLELSAEQEMLLKYLMRQLRQALKDGVPADI
                     SISTMTQYLDPRLYQTNKVFVEKLQNYLLAAQARNPVYYRLLVLDPNWRPPAGLYTGN
                     YVIPDRYDFEDVQSELEYAGPSRDEYFDDSLFAPGPQRRLNSAEEAQLERDIESLTGH
                     IDEELGVQSQAGWLADHRLPVAFDGALSLTERNAYNTPLPPDSHMRSRSSSVASDLGL
                     LNLSGTGGPGFFASLRPSIGSRQPTGTAVGLRPTTPYSGSGCMRGTGLARKVLNPAAS
                     RRGRKLRFY"
     CDS             15110..16657
                     /codon_start=1
                     /product="III"
                     /protein_id="AP_000414.1"
                     /db_xref="GI:56160746"
                     /translation="MYRSLRPPTSIPPPPPSGPSPYPAMINGYPPDVPVGSPANGDAE
                     LFVPLQRVMPPTGGRNSIRYRNYAPCQNTTKFFYVDNKLSDLDTYNEDANHSNFRTTV
                     IHNQDLDPSTAATETIQLDNRSCWGGELKTAVKTNCPNISSFFQSDTVRVRLMSKRDP
                     GGTDPDAGVNNPPGAEYKWYDLRIPEGNYALNEIIDLLNEGIVQLYLQEGRQNNVLKS
                     DIGVKFDTRYLDLLKDPVTGLVTPGTYVYKGYHPDIILLPGCAVDFTFSRLSLLLGIA
                     KREPYSKGFTITYEDLQGGNVPALLDLSSVQVDDQDEDVIVVADARPLLKDSKGVSYN
                     VITTGVTQPQTAYRSWLLAYHTLDSPARNKTLLTVPDMAGGIGAMYTSMPDTFTAPAG
                     FKEDNTTNLCPVVAMNLFPSFNKVFYQGASAYVQRLENATQSATAAFNRFPENEILKQ
                     APPMNVSSVCDNQPAVVQQGVLPLKNSLSGLQRVLITDDRRRPIPYVYKTIATVQPRV
                     LSSSTLQ"
     CDS             16679..16897
                     /codon_start=1
                     /product="pVII"
                     /protein_id="AP_000415.1"
                     /db_xref="GI:56160747"
                     /translation="MSILISPSDNRGWGANMRYRRRASMRGVGRRRLTLRQLLGLGSR
                     RRRRSRPTTVSNRLVVVSTRRRSSRRRR"
     CDS             16965..17495
                     /codon_start=1
                     /product="pX"
                     /protein_id="AP_000416.1"
                     /db_xref="GI:56160748"
                     /translation="MPSVLLTGGRTAKGKKRASRRRVKVPKLPKGARRKRASVTPVPT
                     VATATASERAALTNLARRLQRGDYAAWRPADYTSPAVSEAARAAASSGTPATARDLAT
                     GTLARAVPMTGTGGRRRKRTATRRRSLKGGFLPALIPIIAAAIGAIPGIAGTAVGIAN
                     LKEQQRQFNKIYGDKK"
     CDS             17559..18230
                     /codon_start=1
                     /product="pVI"
                     /protein_id="AP_000417.1"
                     /db_xref="GI:56160749"
                     /translation="MDYAALSPHLGGWALRDHHIGDSSLRGGAINWGNLGSRITSALN
                     STGRWLYNTGNRFVHSNTFNQIKQGIQDSGVIRNVANLAGETLGALTDIGRLKLQQDL
                     EKLRRKALGEEGPATQAELQALIQALQAQVAAGEPPAAPAAPAPAPPLVPTTRPIPEM
                     VTEVKPPVTSSAPAVPVDVPTTLEMRPPPPKRRRKRARPGQWRARLDSLSGTGVATAT
                     RRMCY"
     CDS             18289..21117
                     /codon_start=1
                     /product="hexon"
                     /protein_id="AP_000418.1"
                     /db_xref="GI:56160750"
                     /translation="MTALTPDLTTATPRLQYFHIAGPGTREYLSEDLQQFISATGSYF
                     DLKNKFRQTVVAPTRNVTTEKAQRLQIRFYPIQTDDTPNSYRVRYSVNVGDSWVLDMG
                     ATYFDIKGVLDRGPSFKPYGGTAYNPLAPREAIFNTWVESTGPQTNVVGQMTNVYTNQ
                     TRNDKTATLQQVNSISGVVPNVNLGPGLSQLASRADVDNIGVVGRFAKVDSAGVKQAY
                     GAYVKPVKDDGSQSLNQTAYWLMDNGGTNYLGALAVEDYTQTLSYPDTVLVTPPTAYQ
                     QVNSGTMRACRPNYIGFRDNFINLLYHDSGVCSGTLNSERSGMNVVVELQDRNTELSY
                     QYMLADMMSRHHYFALWNQAVDQYDHDVRVFNNDGYEEGVPTYAFLPDGHGAGEDNGP
                     DLSNVKIYTNGQQDKGNVVAGTVSTQLNFGTIPSYEIDIAAATRRNFIMSNIADYLPD
                     KYKFSIRGFDPVTDNIDPTTYFYMNRRVPLTNVVDLFTNIGARWSVDQMDNVNPFNHH
                     RNWGLKYRSQLLGNSRYCRFHIQVPQKYFAIKNLLLLPGTYTYEWVLRKDPNMILQSS
                     LGNDLRADGAQIVYTEVNLMANFMPMDHNTSNQLELMLRNATNDQTFADYLGAKNALY
                     NVPAGSTLLTINIPARTWEGMRGWSFTRLKASETPQLGAQYDVGFKYSGSIPYSDGTF
                     YLSHTFRSMSVLFDTSINWPGNDRLLTPNLFEIKRPVATDSEGFTMSQCDMTKDWFLV
                     QMATNYNYVYNGYRFWPDRHYFHYDFLRNFDPMSRQGPNFLDTTLYDLVSSTPVVNDT
                     GSQPSQDNVRNNSGFIAPRSWPVWTAQQGEAWPANWPYPLIGNDAISSNQTVNYKKFL
                     CDNYLWTVPFSSDFMYMGELTDLGQNPMYTNNSHSMVINFELDPMDENTYVYMLYGVF
                     DTVRVNQPERNVLAMAYFRTPFATGNAV"
     CDS             21134..21754
                     /codon_start=1
                     /product="protease"
                     /protein_id="AP_000419.1"
                     /db_xref="GI:56160751"
                     /translation="MSGTTETQLRDLLSSMHLRHRFLGVFDKSFPGFLDPHVPASAIV
                     NTGSRASGGMHWIGFAFDPAAGRCYMFDPFGWSDQKLWELYRVKYNAFMRRTGLRQPD
                     RCFTLVRSTEAVQCPCSAACGLFSALFIVSFDRYRSKPMDGNPVIDTVVGVKHENMNS
                     PPYRDILHRNQERTYYWWTKNSAYFRAHQEELRRETALNALPENHV"
     CDS             complement(join(21899..23340,23455..23662))
                     /codon_start=1
                     /product="DBP"
                     /protein_id="AP_000420.1"
                     /db_xref="GI:56160752"
                     /translation="MAETLHPETISSDEDVADFVDLEEPGPSTVIKSNRGRSRPLPPQ
                     RPTGPKDPENPLEKQKSEDLPRSHPGPRKLQKTLPPSPAVVPDSEEEGEQELFETRDP
                     VTEAEVMERTPKRAHGFRSTKPVKRTAEVMMEEEEEEVEVVAPGRGATRKKVSRREES
                     PSPVRRVTRRRETVVDDEENASDEESPEAPLSDPVVYGAQRAMATVASICEALDLQWQ
                     GASVRPDDSIWTKMGGTYVRKKHPEFRLTFSSYDSFNAQVGRFLAAVIYSRAGLEPKF
                     VPGGAHVWRHGWFPALQEPFPKCMHGVDMVTKPRTVELNPSSEAGKRALAEQNGVIEK
                     NRFGRQVVVLRFDANAVCYKDQEHSGFPHPHAHGSCAMVFSDAAKAVSAMRHDIDWTK
                     ALYPNADKRRAEECVLISTNCNCNYASDRAISGRQFCKMTPYKLNGTDDITRDMVESR
                     PDMKAHKKNPHTMVFTCCNPQAASGGAGRGLKKTEKTCAWRLSAMDLRYAYVFATELF
                     TAVMGSSEPTHVPEFRWNESYAFKTEVLAPVSPIASDDPFA"
     CDS             23680..26634
                     /codon_start=1
                     /product="100K"
                     /protein_id="AP_000421.1"
                     /db_xref="GI:56160753"
                     /translation="MADKITREEKTIATLDLVLRVVVDAGNWDVFSKRLVRYTREQYG
                     IELPEDIGDLPDTSEVSKVLLSHLGEDKAVLSAYRIAELTQPSEMDRAKVTEGGLAVL
                     NASRDESEAQNPSNPEPESIESDAVEDLGVAAESDPSDDEPDPEPEYDHREADHDSDA
                     DSGYYSADGGRPGTPVDEEPQDDSPSSEETASTVIEEAQTSASNDSHDDDTHRDDGSA
                     SEEDLERDALVAPADPFPNLRKCFERQAMMLTGALKDAADTADPPETLSVDSVQRQLE
                     RFVFNPDRRVPAEHLEVRYNFYPPFLTPKAIASYHIFAVTASIPLSCKANRSGSDLLA
                     KAKESTFFKRLPKWRLGIEIDDGLGTEVTAVTELEEAKMVPLKDDVSRLQWAKMRGEH
                     IRFFSYPSLHMPPKISRMLMETLLQPFADENQKAEEALPCLSDEEVLAIVDPTGRLHG
                     EDALKAVEKRRAAVTMAVRYTATLELMERVFREPSMVKKMQEVLHHTFHHGFVALVRE
                     TAKVNLSNYATFHGLTYNNPLNNCIMSKLLEGADKEDYVVDSIYLFLVLTWQTAMGMW
                     QQAIDDMTIQMYTEVFTKNKYRLYSLPNPTAIGKAIVDILMDYDRLTEEMRKALPNFT
                     CQSQITAFRHFLLERSNIPAVAAPFMPSDFVPLAYKQSPPLLWDQVYLLQLAFYLTKH
                     GGYLWEAPEEEANNPSNRTYCPCNLCSPHRMPGHNAALHNEILAIGTFEIRSPDGKTF
                     KLTPELWTNAYLDKFDAEDFHPFTVFHYPENASRFASTLKACVTQSPEILSLIRQIQE
                     SREEFLLTKGKGVYKDPNTGETISRQPRDTARAQHAGDGQALPAPGAYTTGGNRAETA
                     PAGAVRLAPDYQDGQFPIAKVGPHYHGPKNVRREDQGYRGGPGGVRGEREVVLSRRAG
                     GRRFGRRNTRQSGYNERANRYFGRGGGGSVRGQQGEHPTTSPSASEPPAPSRILARGT
                     PPSPERRDRQEE"
     CDS             join(26324..26630,26836..27119)
                     /codon_start=1
                     /product="33K"
                     /protein_id="AP_000422.1"
                     /db_xref="GI:56160755"
                     /translation="MAQRMLDEKTRVTEAGPEVYGESARSSFHEEQEEDVSDGETLGS
                     QDTTNGLTDISEEEEEDLFEGNKENIPPPRRPPRNRRLRAAYSLEEPLLPPSAATDKK
                     TTPHPSSHQKNTGAKAVRLRQDPVPQHIADLRGEILDILLEIESYARRRPDRHVSIRN
                     RTRESITRKLHYEKNEDKLTRMKSDAIKLLALWQTV"
     CDS             26324..26878
                     /codon_start=1
                     /product="22K"
                     /protein_id="AP_000423.1"
                     /db_xref="GI:56160754"
                     /translation="MAQRMLDEKTRVTEAGPEVYGESARSSFHEEQEEDVSDGETLGS
                     QDTTNGLTDISEEEEEDLFEGNKENIPPPRRPPRNRRLRAAYSLEEPLLPPSAATDKK
                     SKKVPKRRGKYRSWAKHRVAICQALRDAVFDRKKAGEILKRGHRLFVPATVIGYYARK
                     LSPSFLAPLSSHTAPLLPPKKHRR"
     CDS             27149..27886
                     /codon_start=1
                     /product="pVIII"
                     /protein_id="AP_000424.1"
                     /db_xref="GI:56160756"
                     /translation="MNLMNATPTEYVWKYNPVSGIPAGAQQNYGATIDWVLPGGTGFA
                     IATNDIRRQTLNPAVTRAITARFEAESDQQPYASPHETNVIAANVLDSGYPKSGLYPL
                     ELSGNQRVQLAGGLMVGRTEGRMQLAGGLTEGRVQLSGGFHGRPLVRGRSRRPPRWCG
                     AELTGNGLPEQAEVTSDTYKYFLRTQGPSQVVEEPGVFSQRQFMTTFLPSVVPHPFDS
                     TNPGDFPAQYSAIYKGRTAFEDTFWDW"
     CDS             complement(<27894..28115)
                     /note="spliced to an unidentified coding region
                     downstream"
                     /codon_start=1
                     /product="U exon"
                     /protein_id="AP_000425.1"
                     /db_xref="GI:56160757"
                     /translation="MMSNPRKYWLRLNDQAVVRFDEPLNPGFVFWLRRRYRARVTSEG
                     GERVTVTRREPFNDRELEEIYCETEHRQQK"
     CDS             28114..30495
                     /codon_start=1
                     /product="fiber-1"
                     /protein_id="AP_000426.1"
                     /db_xref="GI:56160758"
                     /translation="MNEEVPLKRVSPDETETVPKKPRTDVRDTVRAGTDDTVDLVYPF
                     WWNLGTGGGGGGGGGGGGSGTSLQPNDPLYAASGTINLRMTSPLTLSQRALALKTDST
                     LTLNTQGQLGVSLTPGDGLVLNTNGLSINADPQTLAFNNSGALEVNLDPDGPWSKTAT
                     GIDLRLDPTTLEVDNWELGVKLDPDEAIDSGPDGLCLNLDETLLLATNSTSGKTELGV
                     HLNTSGPITADDQGIDLDVDPNTMQVNTGPSGGMLAVKLKSGGGLTADPDGISVTATV
                     APPSISATAPLTYTSGTIALTTDTQTMQVNSNQLAVKLKTGGGLTADADGISVSVAPT
                     PTISASPPLTYTNGQIGLSIGDQSLQVSSGQLQVKLKSQGGIQQSTQGLGVAVDQTLK
                     IVSNTLEVNTDPSGPLTSGNNGLSLAAVTPLAVSSAGVTLNYQSPLTVTSNSLGLSIA
                     APLQAGAQGLTVNTMEPLSASAQGIQLHYGQGFQVVAGTLQLLTNPPIVVSSRGFTLL
                     YTPAFTVSNNMLGLNVDGTDCVAISSAGLQIRKEAPLYVTSGSTPALALKYSSDFTIT
                     NGALALANSGGGGSSTPEVATYHCGDNLLESYDIFASLPNTNAAKVAAYCRLAAAGGV
                     VSGTIQVTSYAGRWPKVGNSVTDGIKFAIVVSPPMDKDPRSNLSQWLGATVFPAGATT
                     ALFSPNPYGSLNTITTLPSIASDWYVPESNLVTYTKIHFKPTGSQQLQLASGELVVAA
                     AKSPVQTTKYELIYLGFTLKQNSSGTNFFDPNASSDLSFLTPPIPFTYLGYYQ"
     CDS             30536..31768
                     /codon_start=1
                     /product="fiber-2"
                     /protein_id="AP_000427.1"
                     /db_xref="GI:56160759"
                     /translation="MADQKRKLADPDAEAPTGKMARAGPGELDLVYPFWYQVAAPTEI
                     TPPFLDPNGPLYSTDGLLNVRLTAPLVIIRQSNGNAIGVKTDGSITVNADGALQIGIS
                     TAGPLTTTANGIDLNIDPKTLVVDGSSGKNVLGVLLKGQGALQSSAQGIGVAVDESLQ
                     IVDNTLEVKVDAAGPLAVTAAGVGLQYDNTQFKVTNGTLQLYQAPTSSVAAFTSGTIG
                     LSSPTGNFVSSSNNPFNGSYFLQQINTMGMLTTSLYVKVDTTTMGTRPTGAVNENARY
                     FTVWVSSFLTQCNPSNIGQGTLEPSNISMTSFEPARNPISPPVFNMNQNIPYYASRFG
                     VLESYRPIFTGSLNTGSIDVRMQVTPVLATNNTTYNLIAFTFQCASAGLFNPTVNGTV
                     AIGPVVHTCPAARAPVTV"
     CDS             complement(31812..32429)
                     /codon_start=1
                     /product="ORF22"
                     /protein_id="AP_000428.1"
                     /db_xref="GI:56160760"
                     /translation="MNDEQILEMVLQHQQRRQQEAEREEEVGDDMEDDEDDDGLQMPT
                     PLHAYQLLCYDSFELHFGGCACHGLPLHRMGLSACHLAPSDLATYVWARLEDDLNVAG
                     VYFVAMWASPGFSDFSPVFMQRPIGNVCGMLIHVDLHSRLPFLIAVSRLGEAGGSPCL
                     YMRKIDVDLDTQRVHFYTEDWFSEFANLLYYWQMSEWKHLAERMQ"
     CDS             complement(join(32431..32895,33886..33906))
                     /note="contains transmembrane domain"
                     /codon_start=1
                     /product="ORF20A"
                     /protein_id="AP_000429.1"
                     /db_xref="GI:56160774"
                     /translation="MALCPLSLITCLILQCCGRYWREFLALLVALSYSSIILCSFLFL
                     QNHLSSLNFVISVFVCSTFLVYLALGSLLYGLYRVDKDLAVPSLHSRSPSPDPLPAPI
                     SRWPGSRGGNWTVSSNPWYFELQETGAAASLASTAPLTAPPPSVVSSDDEEHPYAIIP
                     D"
     CDS             complement(join(32892..33809,33886..33906))
                     /codon_start=1
                     /product="ORF20"
                     /protein_id="AP_000430.1"
                     /db_xref="GI:56160764"
                     /translation="MALCPLSESLTVSRACGFHNEVGVIWFSFLLRHDPTCRQEEMER
                     LNEYRINRAVASLRCFDNDLMRRLHSSVTVLVTVRSAKFVCFKRRDYVLMNCIVRIVS
                     ALHLNRAEKTALLHYLSRRLLFITPGMKYDLEPWMLARRKTDFKFFTTGFLIAEKISV
                     KMALRSMSFEVSFSQVPSSVPFVRSPVVLMNACRVTVTATIMVETISRSSAVTQPVCL
                     RSMLRVMVSPELWPIVSQGLCYFPGYRRLSYANVEEWVFHVHGKYGESHPECFGQCKQ
                     CSTRQPLSLFCSAQLAYLRNVFMERRARVAGERPYS"
     misc_feature    complement(34238..36144)
                     /note="nonfunctional ORF19 due to frameshift"
     CDS             37391..38239
                     /codon_start=1
                     /product="ORF8"
                     /protein_id="AP_000431.1"
                     /db_xref="GI:56160765"
                     /translation="MARNPFRMFPGDLPYYMGTISFTSVVPVDPSQRNPTTSLREMVT
                     TGLIFNPNLTGEQLREYSFSPLVSMGRKAIFADYEGPQRIIHVTIRGRSAEPKTPSEA
                     LIMMEKAVRGAFAVPDWVAREYSDPLPHGITHVGDLGFPIGSVHALKMALDTLKIHVP
                     RGVGVPGYEGLCGTTTIKAPRQYRLLTTGVFTKKDLKRTLPEPFFSRFFNQTPEVCAI
                     KTGKNPFSTEIWCMTLGGDSPAPERNEPRNPHSLQDWARLGVMETCLRMSRRGLGSRH
                     HPYHSL"
     CDS             complement(38717..39256)
                     /codon_start=1
                     /product="ORF17"
                     /protein_id="AP_000432.1"
                     /db_xref="GI:56160766"
                     /translation="MPLYLCFGAAAPVSILWREELFWGFVAAVKRRWHTVYARTNVDI
                     QYPMAYCVGIQSLSPCKCHVTVVVCLTFLDLRMSAINEATKIMRAFFKTFFYHHGKVP
                     RGRWFKLYRNDWCKDPNLTVGNYIVASGALPLMLGWARSTGLRFSTFTYSDEALWSHR
                     RRDRRLARRREKLENKVSG"
     CDS             complement(39286..39705)
                     /codon_start=1
                     /product="ORF16"
                     /protein_id="AP_000433.1"
                     /db_xref="GI:56160776"
                     /translation="MYYFHLRVTLMEPNLAVFHDLKLTVINAWESLTVEMLSHYSVDY
                     LFRLEEFAGVYSASIFLPTHKVDWTFLKRAVALLRECIWRRFECTQVPRGVASIYAVR
                     NTWTPSANRVARHFVKRGALVGMQPCLHECTYERDAC"
     CDS             40082..41002
                     /note="probable membrane glycoprotein; member of family
                     containing FAdV-1 ORF9, ORF10 and ORF11 and FAdV-9 ORF11
                     and ORF23"
                     /codon_start=1
                     /product="ORF9"
                     /protein_id="AP_000434.1"
                     /db_xref="GI:56160767"
                     /translation="MGNPTLLLLSGLLSLTQAISIGEHENKTRHVIVWRHSSSHQCSD
                     WRTVTEWFPPQKGNPVRPPYTQRVSLDTANNTLTVKPFETNNGCWETTSQGINHPPTT
                     IQYRVWNITTTPTIQTINITKITVREGEDFTLYGPVSETMSIIEWEFIKDVTPQFILQ
                     YYLSINSTIVYASYQGRVTFNPGKNTLTLKGAKTTDSGTYKSTVNLDQVSVHNFRVGV
                     TPIEKKEEATAETPASKPTPIPRVRADARSTALWVGLALCILTVIPALIGWYFRDRLC
                     VPDPIIELEIPGQPHVTIHILKGPDDDCET"
     CDS             41113..41853
                     /note="probable membrane glycoprotein; member of family
                     containing FAdV-1 ORF9, ORF10 and ORF11 and FAdV-9 ORF11
                     and ORF23"
                     /codon_start=1
                     /product="ORF10"
                     /protein_id="AP_000435.1"
                     /db_xref="GI:56160768"
                     /translation="MDPRPLVLLLLLASHISTFRQMYFEGETIHFPMGIYGNETTLYM
                     NDIILEGTRANTTTRTISLTTTKKNAGTNLYTVISETGHNATYLITVQPLGQSIHHAY
                     TWAGNTFTLQGQVFEHGNYTRWVRLENAEPKLIISWALSNRTINKGPAYTANMDFDPG
                     NNTLTLHPVLITDAGIFQCVIDQQTNLTLTINFTVSENPPIVAHLDIHKTISRTIAIC
                     SCLLIAVIAVLCCLRQLNVNGRGNSEMI"
     CDS             join(41958..42315,42385..42645,42720..42973)
                     /note="related to leukocyte adhesion molecules such as
                     CD48; contains immunoglobulin domain; probable membrane
                     glycoprotein; member of family containing FAdV-1 ORF9,
                     ORF10 and ORF11 and FAdV-9 ORF11 and ORF23"
                     /codon_start=1
                     /product="ORF11"
                     /protein_id="AP_000436.1"
                     /db_xref="GI:56160773"
                     /translation="MLLLTVVLLVGVTLAADHPTLYAPKGGSIELGVGAKQKGQYKFE
                     WRFGNLKIVIAEMSSTNQLEIKFPDNGFQNRSEFNPTKHNLTIHNASYEDSGTYSLHQ
                     EENDGTEHTDNFKVIVQDPIPRPEVKGTTMQINGKTFTNISCHLPAGSYGNVSWHWNY
                     TDPIIVGYENQSMLVGPLGVMYSCTASNQVSKNSSAISMDTAEPSERAECAYTGYIAG
                     IIILGVLCILFIYLYANTPEVRQRITDQLEKLLGTFCDVSIEDGIPERTRRNKKRIIL
                     KEPSHRWIWIQSFA"
     CDS             join(43073..43255,43327..43436,43531..43663)
                     /note="C-type lectin"
                     /codon_start=1
                     /product="ORF26"
                     /protein_id="AP_000437.1"
                     /db_xref="GI:56160775"
                     /translation="MLPPIGCDRLPEFDVVCPRDWIGFQSKCYYFSESESNWSEAEKF
                     CRQQEAELAVRRSEEEKEFLLRQCGTGTNWLGVTRKSKDGADWVDASYDDYVPWYEIR
                     GGGDCVYLNGDRVTSAYCDTQKLFVCSCQDSYSYWLENK"
     repeat_region   43751..43804
                     /note="ITR"
                     /rpt_type=inverted
ORIGIN      
        1 gatgatgtat aataacctca aaaactaacg cagtcataac cggccataac cgcacggtgt
       61 cactcgggta caaattatga attcgatctt tggacttttc gacgcgccca gtgactgtac
      121 tttattgcgc caattcacca cgcccgggag atttcgaaat tgctatttcc gtgcagttcc
      181 gcattccgaa gtacaattta accggtttta tgggtgttcg gtgtttttct agcttaatca
      241 ttgtttttag acgacacagt gggtatctgt tttcgcttgg acttggctcc gctttgtgaa
      301 aattcaactc gatccaacat tttccttatt gatggaaggc ttttattatt tgcacaacag
      361 acatcgcgct atttacacag aacgcaaagt gctgtctttt ttattccttg ttccgggtac
      421 atcttttatt gctagtgcct cgcctatttt tagtcacgta tcttccttgt tctatagcta
      481 tatattcacg cggttttcgg tctctcctca ctcggcagat gacttcggaa gagaagctgc
      541 agagttcgtc tccggagacc ggcctcgccg ctgtcgtcct gcaaagcccc cttgaggtac
      601 gtgtgcctgc cgttcttcct cctccagtgc gaattgacat ctaccgctac ccaggctttc
      661 cgccaacgga gaccatctgg cacggtctca tcacgcagac tgagttaaac caggctttgg
      721 agagcatcgt tgagcaattg tagtaagtgt cagtccctat ttttctgttt tttcttgtat
      781 ttcctcttag acgatggacc cgttcggttc ttcttcagtc cctccgtgct ctacatcaga
      841 ccttcccgaa cccaagctct atttcgtccg cttgtcaccc catgcagtgc ctccagttag
      901 ggctacgcac ggagctgcag gatacgattt gtttagcgct tacgacatta aagtgcctgc
      961 tcgcggtcgg gcgctagttc ccacagattt agtttttcaa tttccgcccg gctgttacgg
     1021 tcggattgct cctcgctcgg gcttggccgc caaatttttc attgacgtcg gagcgggtgt
     1081 tatcgatccc gattaccgcg ggaacgttag cgtggttttg ttcaatttct ccgagagctc
     1141 gttcaacatc aggcgaggcg atagggtagc acagcttatt ctggagcgta ttatggttcc
     1201 ggagctgtcg gaactgacgc agctaggcga gacagaccgc ggggcgtcgg gtttcgggtc
     1261 cacaggtatg ggtgctgtag accgcaatca gcgctctgtg ttggaatggc tgacccctgg
     1321 ttcccgttga taggaccctt gcgacgaagt cgacttcgct gtacgcttgc aagcagattt
     1381 tgagggggac gacgacacat acggacattg tctgtgcgaa ggcagcacca gcaagaggcc
     1441 ctgctgtacg ctctgtaaca gttactgcgt gcttctttag gtatgattgt gagcgtgtgg
     1501 cagctcgcga ccatcgcgat tgagttttgc gataagtggg tggggaaata ctacagattc
     1561 cgaccgtatc atgagagact tttgcttatg cagagtcggc aagctttgga aaggagcttg
     1621 cgccgctgcg taagtgaagt tggacctccg ccagagcctc tagaatagcg atggagtccg
     1681 gcgcacgtgg tgcttcctga ctttctgcac cattaccgtg gtgtttctgg ccttctttct
     1741 gcagaaactt ctcaactaca tagatttcag agatagcgac tgcacagaat gtttttttgt
     1801 gtagttgaca ggactatgga ccagacagca acccatacag ctttgattct tctgatcgtc
     1861 ttgacggtgt tcacgggcgc ggtggtagct ttgatgttgt atattgcgat aactggactt
     1921 ccttgctcta tgctttgctc tcaataaaga ttttcagaat ggtgattcta tggtattttg
     1981 tcttttttct agacagtcat gtcgcgtgag tctgaacgtt actggacttt ggtgcacgct
     2041 ctgattgatc ggggtgtagt cagccgtgaa cagtggcaaa tggttgaccc tgcgcaatac
     2101 cagttctacc accgctccaa acagaggggt tttaaggtcc gtcacattct tcgtgatgtg
     2161 attcgccaca tgtgttggtc tcggactctg ttagattata tgtcctcggc ctcgacacct
     2221 agtccggacg atgtattacg caatcccctg tatcagttgc tgttatgtaa tggatataac
     2281 cccgctgttg tggggacagc gctgatccgg tgggcgggcc atcagagcaa ccgtaacact
     2341 gtttggattc gaggcacccc tatgtccgga gctccgtact tggcacaggc tatcgcgtac
     2401 tgctctcccc tcgtagggag cgttgattgg cgcaacaagt ctaacccatt cgaagggtgt
     2461 ccagatagtc tggtgttttg gtgggacggc ggttatgttt atgattgttg tgtgggtctg
     2521 gtgaagcagg tgttccgggg agaacatgtt attttgcctc ctgagggctt gcgtggcccc
     2581 aacccgtgct ctgaactctt caggacccca gtcttgatgt acagccaggc ggatatttgt
     2641 atgactaggc tgagatcagg ggaactaagt gcagagcatg cggtgggcct cagggattgt
     2701 atgtacctga tccgtttgac agaagatttt gactgcgcgg gtggtatatc gtgtgcagat
     2761 gtcaaacagt ttgtggcgtg gagccgcgaa caccctgggg aggttcgcga gacccacgaa
     2821 ctcaaataaa aattcgggac ttctgtgtac gttccttttc atgtttatta aacactgttc
     2881 tttcgagtga gtcatatcac gtggaagtta attgcgactg ggagccgcag aagcaggtgg
     2941 taaaagcaag ctatgcaggg atagtttacg atgtcccttg gaagacagac atagagtgtt
     3001 tgtccttcca gtcgcgtgta ggcgccttgg cgccgcgcaa cggttactgc tgtatatatt
     3061 tgttcgaggg cagggttcaa gttgcataac ctgcagtgag tagcatatgt gtataagatg
     3121 agattaagag ggagttgggg ctggtggtcg tgttgagcaa cgaaattgac gaccgttttg
     3181 gcccagtgag ctgtaagcac tcggatgagg gataaacaaa agagggaacg gggtgtctcg
     3241 cagctgcaga tgtactggat agtccagtcg gtacatcgca tctcaataac tcttatccag
     3301 ctgcagaatg acctgagctg gaggtcacac tcttcgtccg taatgcagtg gggcgagtgc
     3361 ttgaaggggt acatctgtct tttaaggaga aagagtagga aatcgggatc tgtgattagg
     3421 gtaatgccca cgcgcgtgaa caggggctcg atgtagatat gccaactgtg ttggggctcg
     3481 tcctcatcgt tgtcactatc ccaaacaagg tcgcacgact cgaatgtctg taaaacatca
     3541 aaagtttatt actgattttg aagaggggta cgtatacagg ggttacagag tttattatcg
     3601 cgtttgcaat gcagtgtcat taagcaagca caagcggcag cattagcaac aaagtcgcgt
     3661 agctctttgc gcgggtggta gcatggaggg gtcttggtgt ggtctcctgt gaggaagaag
     3721 acgaccgtgt tccgcgccgt gaactcgttg gcgagcgaga ggtccgcgca gtggattagc
     3781 atgggggtcg aggggatgtg gaacgttttc ttattcagcc tgcaggtggc agcattgcct
     3841 tccataaagt gcagcatcaa cgggtccggc ttctcgtcta cgaagggcag acagtataga
     3901 gaggcgtggg gtgcgatttc gcccagtgat agtatggagt tgattcggct gtcggagatc
     3961 gcgagcggga aacacgcgca taaggcatta aagagactct tggcgttgga aagtcttcct
     4021 ccgcagagca cgagggtgtt tagttctcct cggagccatc ggaggatggc gttagctgcc
     4081 acttttccct cgtagccttc ggcttccatc atctgatgga accagttgtc gcagacgttg
     4141 tagaacgcag ccttgagggt gtcgggctct tcggagggta actggttaat gaggctctgt
     4201 ccgggtccga accgttcctt gagggcttcg agtacacgct ctcgttcgta ggtgggtatg
     4261 aggttcttgg acgggaagtt ccactggact tcgtgtgcta caccttcgac aaacaaccgt
     4321 tcaaccaact gatccatggg ggacgtggac ggaaataagc agggtgaagg ggtgtctgga
     4381 atgcaggatg ctatttgctc ctcttcgcta cttaaagacg actgagactc gcgtcgcctc
     4441 ttggtgcact gtgggagaga attatatgtc atgtgatgag tgacaagcat tgcatgggga
     4501 ggtccacgag cgggaacaga gcattccttt gttctcgcat aggagagcgc gcaaggcgtc
     4561 gttgtcatta tctgcctgta attggtgtat gcgatgaatg tagcgggaga gctctcccag
     4621 aaagaacccg cagccgttgg cgggttcgta gaacctaata atgatatgtt cgtcgggagc
     4681 agtgggcaga tgttcgggat gggggagctg atataagcgg acgaggcatt ttttctcact
     4741 gatgtccacg agaccgtcgc gggtcattgt ggtgaatgac ctgcctttca gcagctggtt
     4801 agcaacggga tctttgaacg tgttacaatg agctgtgcag gggaaataaa gcatcttgac
     4861 taaatcttgc tgtctggcgt actggccaaa gtcgaacgcg ttaatgttgg cagtgaggac
     4921 aaattggaat aatctgagga tggatgcagt gaatatatct gcggcagagg aaggttctcc
     4981 tacgacatag agcgtgttag tataatggca caggcgacta atgctcatgg cagacatcca
     5041 cagataaatg gcgtagatgg ctaccggagc attgtaacct tcggcttcta gcatggctcg
     5101 gagatctctt tgtgaggaca gctcgaagcc ttgcagattg aaattgatcg tttgactgag
     5161 cccgtagctg cagtataatt tgcgcgcttc ttccagaagc gcgggggcga ccgattcgaa
     5221 tagttcagca tcttggggat accgagtgag ccaatctttg taggtaaaga tgttgtttcg
     5281 ctggagatcg aatattagcc tgtgtgtgac taaatcgtcg tcgtcttctc ccgtgtggcg
     5341 gttcctgagt ctcttaacgc tatccttaag tttcctgaaa cgttcctggg ggagaaagtt
     5401 tttcgagatc ggttagtttg gggtttctct ctaactgctt tctatgtgtt tcgctaaatt
     5461 tgatgataga tttggctgtt ttcaggaatc tctcctgaat gttaacattg agagggatga
     5521 tcgagtactg ctgatctata ctgcaccacc taaaggactc ggatactggg tccggagtgt
     5581 acatgaccca gctgaaccgc tggttctgct gcaggaagga aaagtaagct ttgagaagga
     5641 caacgaggtc cttcgagatg ttgtgtgcga acgcatagag gaacctagcg aactggaatt
     5701 ggggaatatg acaggatagg atgtgcattt tcgcgttcac tttgagggtg ggaacgtttc
     5761 ctatcgcggt gcgcggtgcc atgttgtgca agactacgaa aatgtagaag gctgtacagt
     5821 gggcagagcg agcaaagagc ttagaaggaa gggcgtgaaa gaggacagag acgctggagc
     5881 ctgaacagag cttatccatg cactcgtcca tgataatggc gacgggtccc cgcttggaga
     5941 ctttcacgta aatgttgtct ggatggtcga tgttgagatg ttcgggtgcg gtggcctcct
     6001 cgtaagtcat ctccataaat tcgggacgga acgtgcttgt cttaggggcg atggtgccgt
     6061 cttccctgca gtcgaaattg gcctcgacca gctgcaggtt ccaggacgtc tgttcgatgg
     6121 gtggaatcat gttcttttcc ggagtgatga agatgaccgt ttcggggatc gggtccaaca
     6181 tgttgcacga gatgagcgcc cgcagcagat gcgacttgcc ggatccggtg ggtccgtaga
     6241 tgaccccgat gatgggctgc ttgcccatgt tgatggacgg cagctgtccg tgttggaggt
     6301 agcgactgtc catctgttcc tgggctttaa cttcttcgtg ggcttcgaga aacttctcat
     6361 taacgccccc taggctgtag aactcgtcgt aggaggggaa gtgttgctcg cggaagagct
     6421 gcggtgctag gtcgacagct ccgtcgtacc agctggtgac gcgctggtag aagtcccgcg
     6481 aggcttcgta ctcttcttcc tcatactccc aggctttccg cttcctggga gctatcatct
     6541 gcgaagagta ggtcgtgaac ttgcccgcat tcctcttcgg ataggaacgc gtagggttcc
     6601 catcgtaggg gtgcgagggg gtcttcgtgc ccgacgattg ggacgggtcg tacgtctcct
     6661 gtcgtgcggg gatttgggtg ctcattgtcg taggggtaca ggtagtcccc gtgctcgtat
     6721 agggtgaggt ccttccacgg acgcagcact cgcgtgagct gctcgttgtg aatggtgaaa
     6781 gggtcgtagc gactgacctt gttcagaagc gtggttttaa agatggttct ccgcgtgtgt
     6841 agctctggga tgttgctctg cgctccgaat tgcacgtcct cgtgtctacg ccaacagcgc
     6901 agcagcgtgt cgtagatgag ttcggactgc ctgtgtccct tcgatctgat tttcccgggt
     6961 cctaccgtgc ggcactgttc gttgacgcag attgagtttt tcagtccgta cagttttggc
     7021 gctaggaaga tggtttccga gctgtacgtg tcacttccgc aggctttgca cttgatgtcg
     7081 caatcgcagg cccagtagag gccgggattt tctggatcga aagtcagtcg agtggattct
     7141 gttttgattc ggtgcgcgcc gcggcttttc atgcgatgat agcctgtttc tgtgacgaac
     7201 aggctgtcgg tatcgccata gaggctgcgc ggctcctccc ttcgcaggat gtgcactcct
     7261 ctgtccggtc cgtacaggat gtcacaccac tcgctgaaga aggccctcga ccagcccagc
     7321 acgaagcagg cgatttgcgt ggcgtatctt ttgtttgcca cctgcttgtc caggctttcc
     7381 agatggagca cggttagggc ttctggtgtg gcttcgagga gacgcatagg tttaaaccgg
     7441 gtctcgttag cgcgagcgta gtgggcggag cttagctccc cctcgggtat ataagggccc
     7501 gtcgcgaggg tcgcctcgac ttccaggtct acggcgacga gaggatcgtc ttcggtaagt
     7561 gcgtttttcg gcttacgggc actctcgcga tcgctgtcgt ctccttcttc ttccccatcc
     7621 tcttctgctt cgggctcttc ctgttcgggg tcgtctgcgt agcggaactg ttgtcgtaga
     7681 ctctcctcac tgaaggggtt aggcgcgttt tcgagggtga cttccgttcc gttgaacgag
     7741 tcgtcattga gcagcgtgac gtgtttgacg atttcagtgc cttcgtagat gtttttctta
     7801 tctgcttccg agaggtcctg ttcaaagatg atgcgcgtgg tgtccatgtt ggtggcaaac
     7861 gcaccgtaca gcgcgttgct cagcattttg gagatggatc gaatcacttc gttcttctcg
     7921 cgatcggctt tttctttggc gaggatgttt ttcgtgacgt agtcggcaca tagcgttttc
     7981 cattccggaa aaacaatgtt catctcgtca tggaggacct ggactcgcca tccccggttg
     8041 tgcagcgtga ggatatctat gacggtgacc acctcgtcgt agagagcctc gttggtccag
     8101 accagtctgc ctcccctccg ggagcagatg ggagggagtg ggtctaacat ttcgggcggg
     8161 ggagggtagg cttctatttt caggatggaa ggcttgatac gcgcatcgaa gtagctcaga
     8221 tgcgattcgt tggtcagcag ccggttgagc tcctccacgt gctgcgcggt aaattttgga
     8281 tctaggggca ttccgtgggg catggggtgg gtgagggcgg aagcgtacat gccgcagatg
     8341 tcaaagacgt agacgggttt caggtaaggt ccgagcacgt tggggtagca tcgtccgccg
     8401 cggagcgctt ggcgtatgta tttgaacatg gggcggtggg gggcgtagac ttcggccacg
     8461 tagtcggggg agggttgttt tttctttttg gttcgacctt tctttttggg gggttcgggg
     8521 acggagggag ggcatgtcgc acgctgttcg cggacgtaat tggaaaaggt aagttgcttc
     8581 caaaaggcat gagtgttgct ggggatggtg ggccgcacga agatgttaaa atggccttcc
     8641 atccctagtt ctcgttggaa ataggcgtcg tagctgtcgt gtaacgtgtg ggccagcttt
     8701 tgggtgacgc ggacgtcctg catgcagtat tcgaggcacg cttggacgat gtcgtactgc
     8761 tggcccgggt gttctttctg ccatagattc ttctgttcag cgatgacgga tgggtcttcc
     8821 cagtaccttt cgacaggaaa gccgtcggcg tccgcgtgaa agcgccccgt ggaaatgaat
     8881 tcgttgatgg cctcgtatgg gcaatgtccc ttgcagaggt ctagcgcgta ggctgccgcg
     8941 gctttggaga gtttggcccc gctggtgagc tgtagagtgt ctcgcaccat gaaccgcaca
     9001 aataccgagc gcgcatcctg atgggacacg atcccgcgag accagcgttc tacgcgggag
     9061 gcgtctttct tcacgtagtt ggggtttggc atgcggaaaa tgatatcatt gaacagaagg
     9121 cgaccgacgc gaggcatgaa ggatcgatca catttgcacg cttccgggaa taggtccctg
     9181 cgctcgacga gttccgtggc taagaggagt tcatcgaact tacatatgtt gtgacctagc
     9241 actacgatgt ctacggaata aaagttatcc gggagggaga ggggggaggt gggtttctcg
     9301 aagagctcgt acggtatttt gtgaacggag ccgtactttc cgtccttgac tagctggtcg
     9361 caataatctc ggttggcagc cgcgtagcgg tcgactagat tttgggcaaa ttctatttgc
     9421 agacgggacc tgaagttgcg aaaccttctg gcaacctcgc ccggatggct gtctagccaa
     9481 tagaagcctt cgtcgagggc tttgagacgg tcgtcctgcc gtgctaagcg ttcggcgcgg
     9541 gagaccagct gggggtctcc gctgagcatg aagcacaaca taaacggatg catgcgcttg
     9601 cctttctttt cgaacacggt atacgtctcg atatcgtagg tgatgtacaa ctgacgtatg
     9661 tgggggtgtt gggctggaca ggagaagtgg acgtgctgcc acaaatcgct gcccgatccc
     9721 tggacggcgt ggtagtagaa ggcagagcgg cgttcgttgc acgagtgtcg tctgacccag
     9781 tgtcggccgc aggtgggaca ctgttgaacc ggagtgcggc tggtgatcca gacccattct
     9841 ccggtgacgt ttttggcgat gagcatgggg ggaagggcgg gatgttcgga gatgtgcacg
     9901 gtccgcaggc gcgctgtttt gcctttaaag ttgatgacgg tgacctgggc gggcttaaag
     9961 tcggggaggg agcgttcggg gtctcgggca tagtgcagat agtctattcg gtcgtagcct
    10021 ctggctctct tagacagcag gaagcggtgg gtgcgtagga atttcttgag acctatgggg
    10081 aatacagtgg gttggaagcg gaagggctgt tcctcgatgt aatagacgtt tgtgcgtagg
    10141 gggttgcccc ggaagctctt gaagtacttt cgggtctctt ccagccgttt agcggaaatg
    10201 gttcggatga cgtgcgaatc ggggcccagc acgctgtccg tgaggggagg ccccgcgtct
    10261 gcttccattt acagaggctg acctcgtcgc gccgccgctt cgatgtcttc gcggcggtgg
    10321 cggagcacgc gtctgaggtt ggctttgatc tcctcgttgg tagcgatggc tacgatgcct
    10381 ttaaatttga tgcggaaact gatgtcgatg ctatcgatca gctcttcgct gaggttgagc
    10441 tgcttcagca cttcttcgat gtcaccggag cggtctctgt attgaatatc agagagaaac
    10501 agttgttggt ccgcatcgtc catgccttcg aattgacccg tccgttcgac catcataaga
    10561 aaatcgcgta atatacgttc ccacagggtt tcgaatatgg tggcggggtt ggattgctcg
    10621 ctccatatgc gtttaaaaac ctgctgcgcg ttgacgtccc atcccacgac gagtacttgt
    10681 aaggtcagga cgtcgacgta ccggcggaac tcgcggttgg cgatgaagtg gctgtacagg
    10741 tagtagagtg tagaggcgat atgttcggct aagaagaagt acagcaccca cttgcgcagg
    10801 aacgactctc ccatgagtcc cgcgtcgcgc gcggtcagga gcatgcggta gaagtcgttg
    10861 gcaaacctga agagttcgtg tctccgggcg gccccgctga gctcgtcttg cagtgccccg
    10921 atggcttcga gcgctgtgcg aatcacctcg tctaacagct cttcttcctc ctcttctggt
    10981 tcttctactt ccatggcggc ttcttctatt tcttcgggag ggggcgcggg ggaggggggt
    11041 ctccgtcgcc gccgcgtgac gcggggcagg cggtctacga aggcccgcac ggcacggggc
    11101 ctaatgcggc gcgcttcgga cgcggtgatg gctctgccgt ggcggtctct agggcgcagg
    11161 ccggtgcggt cggttacccg ccggctgcag agggtgatgg cgcctcctga cagacccgtt
    11221 cctgctaagg aaacggcgtc gctcgctaga gtgctcatga aacatctcgc cattgtttcc
    11281 gtaggttcct ctacgtcccg tcttcctcga aacttgcgct cggcatcccg caccagttgc
    11341 tgggtgtcta gctccgcgaa ggcttccgcg aagtaggaga gccagtttgg ttcaaggaac
    11401 acatcggatc caggtaagaa ccgatatctt tcttccgttt gaaatagatc atatgcgtag
    11461 cagaatagat agtggcagag ggcgactctt agttggcgga tggcggcgag cagttcggcg
    11521 tcggcggcag aggccgttcg catgaggacg ccttcttgca agccacccgc tccgttgccc
    11581 gacagtaggc tgtggtgttc ggcgtcgagc tgcggcaaca cttgtccgtg acggcctacg
    11641 tcgattcccc tacctcgcag atgcgcccgg cccatgtccg cggccacgcg gtccatgagt
    11701 acggcgttgt gcatctgcgt gaacgtaccg tgaaagttgt cgagatcgag aaatcgcatg
    11761 tactgcccta cattgacggc gtaggagcag tcggtcagac aggtccaaaa gaggcgtctg
    11821 ggtctttggg gtgggctatc gtaacctatc tgcataaaaa cgcggttgtc gaaaaggtaa
    11881 tcgttgagcg cgcggtgcat agcttggtac ccgaggagaa ggtgcggcgg cggcaatccg
    11941 ttgtagggcg gcgcggcgac gttcggcgat cgcggcgcga ggtctcggag ttgcattaaa
    12001 cggtagtcgt acacccggct gacgagaaac acgcttcggg ggtggaccag ggctggttct
    12061 tcccgaacga ggacatagtc agcggtgatg acgggttcgc agaagcggac ggtggctaga
    12121 ctctgtccgg tgagatccgc gaagactctg taagcctgaa attgagcccc tgacgttttt
    12181 agaccgctcg taatgcaccc cgtcctgcaa agcgttcgaa acgcgagcgt gagcgccgga
    12241 ggaccccatc aacagcaacc gcagcagcaa cagcacggtg tgtcgtcggt ccgtcgtcct
    12301 ccttcaccac cccgatatcc cgcacaacat gcctatcccg gcgcgggcgc gacacccacg
    12361 gcaggacgag gcgatttcga cggcgcgctt gatcccgatg aaggaccggt cgcgtgcggg
    12421 ctggcggccg gggccggtgt ggacgaagtt agaatgaggg agcgggacgc cgcgcggcga
    12481 gccacggtgc ccgagatcaa tctttttaag gctcgacgtg acgtggtgcc caatggggat
    12541 tacgagaggg atctgatgta ccactcggga caggcaatcg atatcgatcg gcaacgtgtg
    12601 ctcactccgg aagactttaa ggggtccgag ccggctttca cgccggctgt caaccatatg
    12661 cgcgcggccg agttgaagag ggcggctgag cagacggcat ttggggagga attgaggaat
    12721 acctgccatc agacccgcat ccgcacggct ctgttaaggc ccgagatcgg agcgggaatc
    12781 tactatctgt acgatttcgt ccagacttat ctggagcatc cggacggtcg ggtgaagctc
    12841 aatcctcagc tggtgttggt ggctcagcac gcgggcaata ctatgctggc gcagcgcttg
    12901 tgggccatcg cagaggagaa gaatgcgtgg ttgagagatt tgatagagat ggcgtacatg
    12961 atcgtgaacg atccgtacct caatacggag cagcagctgt cggccatctg cacgacggtg
    13021 gtcgagttga gcatgaaata cgccaagttg gccgccaaga acggttaccc gtccatggcg
    13081 cagatggcta aggcgcagga atttttctac cgggtcatgc aagcggtgct cgatttaggt
    13141 gtccaagtgg gggtgtataa caaccgacca gctcggtacc gtcagaagcg catgagcgag
    13201 attccgcaga tgactgacgc cgagtacatg ttcggtttga cccaggcgct ggagagcagg
    13261 cctccgcagg gcgaatcttt tgccgacgag gggccgtcag aatcggacga cgaggatgac
    13321 ttcatctgat acgtttctgg ctcttgcgcc ctacgggcgt caggaggtgg cggacgccct
    13381 cagttcgctc ccagatggca aggacgcgcg gtcgctacgt catgcaccct acgcaaatcg
    13441 cctcatcaaa ctccagagcg ccatggtgcc tccaaaagtg gacggtactt ccgagcgggt
    13501 ggccgaaatc gtgaaagggc tagccgagca aggcgccatc taccccgatc agatgggcgc
    13561 gatccactca gatttgctta atcgagctta cacgtggaat tccatggggg tgcaggagag
    13621 catccaggcg ctggtcaacg acgtgatcca cggacagaac cggacattgc aagacgagct
    13681 tgcgcggacg aaagaaatag cgaatgcttc gctcttgacc caatttttcg attccctgta
    13741 caaaacggtg gatcgtgggc agcgaaattt tgagggcttt aagaaacttt tgcgtctttt
    13801 cgtgaataac gtgccgaatg ccgaagtgta cgggtcttcg gggtccttta gcgtgcagat
    13861 aaatcttggc ggatctagtc aaaacatcaa tctgaccaat gcgtttgaga atttgaagcc
    13921 gatatggggc gcacggtggg acgcggtgaa taatcctcgc atcggggcgc ttctgacacc
    13981 caacactcga gcgttgttgt ttttcgtgag ctctttttac gactacgggg ctatggagcc
    14041 cggtagttac ttggacaata tcatgaggct gtacaaggag gctatcagag ccgatgtgga
    14101 cgcggagggt gatgccatta tggagctcgg ggaggcgggc gcaaatctca acttgcggtt
    14161 caacgattac aaggacacac taaactacct cctgcaaaat cgagaggttg tacccgacac
    14221 ggctccgctg gagctgagcg cggagcagga aatgctcttg aagtacctga tgaggcaact
    14281 acgacaggct cttaaggacg gggtcccggc ggacatttct atcagtacca tgactcagta
    14341 cctagatcct aggctgtatc agacgaacaa ggtgttcgtg gagaaattgc aaaactacct
    14401 gttggcggct caggcgcgca atcctgtgta ttaccgactg ttggtgctgg accccaactg
    14461 gcggcctccg gcaggcctat atacgggtaa ttacgtgata cccgaccgct acgactttga
    14521 ggacgtgcag agcgagcttg aatacgcggg tccctccaga gacgagtatt tcgatgattc
    14581 tttgttcgca ccaggtcctc agcgccgctt aaattcggcc gaggaggctc aattggagcg
    14641 tgacatcgaa tctttgaccg gccacattga cgaagagctg ggcgtccaat ctcaggctgg
    14701 ctggctcgcc gatcaccgcc tgcctgtcgc gttcgatggc gctctcagcc ttaccgaacg
    14761 caacgcctac aacacgccgt tgccccccga ttcccacatg cgtagccgtt ctagctccgt
    14821 cgctagcgat cttgggctat tgaacctatc tgggacgggg ggaccgggct ttttcgctag
    14881 tctgcggcct tccatcggca gccgtcaacc gaccggcacg gccgtgggcc tccgcccgac
    14941 gacaccgtac agcggttcgg ggtgtatgag gggcaccggt ctggcgcgca aagttttaaa
    15001 cccggccgcg tcgcgccggg ggcgcaagct acggttctac tgaaccctag actctgacga
    15061 agaaacttaa aaacgcttac cgccatttcg ccgcgcagaa gttggaagga tgtaccggag
    15121 cctgcgaccg ccgacgtcga ttcctcctcc gcctccctct ggtccctcgc cttatccggc
    15181 gatgatcaac ggatatcccc cggatgtgcc ggtggggtca cctgccaacg gagatgcgga
    15241 gctgttcgtg ccgctccaga gggtgatgcc gcctacgggt ggacggaaca gcattagata
    15301 ccggaattat gcgccgtgcc aaaacaccac caagtttttt tacgtagaca ataagctgag
    15361 cgacttagac acctacaacg aggacgcgaa tcacagcaat tttaggacga cagtcattca
    15421 taatcaggac ttagacccgt caacggccgc cacagagacc attcagctcg acaataggtc
    15481 gtgttggggc ggagagctaa aaacagcggt gaaaaccaat tgcccgaaca tcagctcgtt
    15541 tttccaaagt gatacagtgc gcgtgcgtct gatgagcaag cgcgatccgg ggggtaccga
    15601 cccagacgcg ggggtgaaca acccacccgg ggccgagtac aagtggtatg atctgaggat
    15661 tcccgaaggt aactacgcgt tgaacgagat cattgacctt ttgaacgaag gcatcgtcca
    15721 gctgtacctg caggaggggc gccaaaacaa tgtgctcaag agcgatatcg gggttaagtt
    15781 cgatacgcgg tatctggatt tgctgaagga ccccgtgacg gggctggtga cgcccggcac
    15841 ctacgtttac aaaggatacc atcccgacat catcctcctc cccggctgcg cggtcgactt
    15901 tacgttcagc aggcttagtc ttctgctcgg tatcgcgaag cgcgagccct actcgaaggg
    15961 gtttacgatt acttacgaag atcttcaagg agggaacgtg cccgcgctgc tcgatctgtc
    16021 ctccgtgcag gtagacgatc aagacgagga cgtgatcgtg gtggcagacg caaggcctct
    16081 tttaaaagac tccaagggcg tttcctataa cgtgatcacc actggcgtga ctcaaccgca
    16141 aaccgcttat cggtcttggc tccttgccta ccacaccctg gactcccccg cgcgcaataa
    16201 aacgttattg actgttccgg atatggcagg tggtatcggc gctatgtaca catcgatgcc
    16261 ggacacgttt accgcacctg ccggatttaa ggaagacaat acgaccaacc tttgtcctgt
    16321 ggtggccatg aacctgttcc cgagtttcaa taaggtattt taccagggcg cgtccgccta
    16381 cgtgcagcgc ttagaaaatg ccacgcaatc cgcaacggcc gctttcaacc ggtttcccga
    16441 aaacgaaatt ctaaagcagg ccccacccat gaatgtttcc tcggtgtgtg ataaccaacc
    16501 cgccgtcgtt cagcagggtg tgctaccgct gaagaattct ctgtctggcc tacagcgcgt
    16561 gttgatcacc gacgaccggc gccgtcccat tccatacgtg tacaaaacca tcgccaccgt
    16621 gcaaccgcgc gttttgagca gttcaaccct gcagtgagga gcggaaggat tttcaaacat
    16681 gtccattctg atttcaccca gtgataacag aggttgggga gcaaacatgc gttaccgccg
    16741 tagagcatcc atgcgcgggg tcggtcgccg tcgtctcacc ctgaggcagc tattgggtct
    16801 ggggtctcgc cggagacggc gatccaggcc cacgaccgtc agtaaccgtt tggtggttgt
    16861 gagcacccgc cgccgctctt cccgaagacg ccgatgaagc aagcagctga tgagatgttc
    16921 ttctgactat gtgtgccgtc gctatacaca ggagcgacgt cgttatgcct tccgttcttt
    16981 tgaccggcgg gcggaccgcc aagggcaaga agagagcctc tcgtcgtcga gtgaaagtgc
    17041 ctaagttgcc taagggagcg cgccgaaagc gtgcgtcggt gacgccggtc cctaccgtag
    17101 ctaccgcgac cgcttccgag cgcgcggctc tgacgaacct agccagacgg ctccagcgcg
    17161 gcgactacgc cgcttggagg cccgccgact acacgtcacc ggccgtttcc gaggcggctc
    17221 gcgcagccgc ctcgtccggc acccccgcga ccgcgaggga tctcgcgacg ggaaccctcg
    17281 ctcgcgccgt gcccatgacg ggtaccggcg gaaggcggcg caagcgcacc gctacccgcc
    17341 gccgatctct gaaggggggc ttcctgccgg ctctgatacc tatcattgcg gccgctatcg
    17401 gcgccattcc gggcatcgca ggcaccgccg tgggcatcgc caatctgaag gagcagcaga
    17461 gacagtttaa taagatttac ggggacaaaa agtgatgctg actggacgca ctaaaaggcc
    17521 ctttcaataa acgcgttttt gtagaaccgg ctcgcgtcat ggactacgct gcgctatcac
    17581 cgcatctcgg tgggtgggcc ctgagagacc accacatcgg cgactctagc ttgagagggg
    17641 gagccatcaa ctggggcaac ctcgggtcgc gcataaccag cgcgctgaac tccaccggtc
    17701 gctggctgta taacaccggc aaccgcttcg tgcattcgaa cactttcaac cagattaaac
    17761 aaggcataca agacagcggg gtcatacgca acgtggctaa tttggccgga gagacgctgg
    17821 gggccctgac cgacatcggc cggttgaagt tgcaacagga tctggagaag ctgcggcgta
    17881 aagctttggg ggaggaaggt ccagcgaccc aggccgaact gcaggctctc attcaggccc
    17941 tgcaggcgca agtggctgcc ggagagccgc ccgccgcacc cgcggcgccg gcgccggccc
    18001 cgccgctcgt gcccaccact cgtcctattc ccgaaatggt aacggaggtt aagcctcccg
    18061 ttacgtcttc ggcgccagcc gtccccgtag acgtgccgac cacgctggaa atgcgacctc
    18121 cgccgcccaa gcgcaggcgc aagagggcac gaccgggaca atggagggca cgcttggaca
    18181 gcctctcggg taccggagta gcgaccgcca ctagacgtat gtgttactaa aattccgtcg
    18241 ttccgctatg tctaattttt agctcaccgg ttgtctcccg aaggcgtcat gactgcgctt
    18301 actcccgacc tgaccacggc gacgccgcgg ctgcagtact ttcatatcgc gggccctggc
    18361 acccgagagt atctatccga ggatctccag cagtttatct cggccacggg gagctacttt
    18421 gacttgaaaa acaaattcag gcagacggtc gtagctccca ctcgcaatgt caccaccgaa
    18481 aaggcacaac gtctgcagat cagattctac ccgatccaga cggatgacac gccaaacagc
    18541 tatcgcgtgc gctacagcgt caacgttggg gacagctggg tgttggacat gggggcgacc
    18601 tacttcgaca taaagggtgt gctggaccgc ggaccttcct tcaagccgta cggcggaacg
    18661 gcttataatc cccttgcgcc aagagaagct attttcaaca cctgggtgga gagcactggt
    18721 cctcagacca atgtggtggg acagatgacc aacgtgtaca caaatcagac caggaacgac
    18781 aagacggcca cgcttcagca ggtcaatagc atctccgggg tggttcccaa cgtcaacctg
    18841 ggacccggcc tcagtcaact agcatcccgg gccgacgtgg ataatattgg cgtggtggga
    18901 cgtttcgcca aggtagactc agcgggcgtg aagcaggcgt acggagccta tgtcaagccc
    18961 gtgaaggacg acgggtctca gtctctgaac cagaccgcgt actggctgat ggacaacgga
    19021 ggtaccaact atctgggtgc cctggctgtg gaagactaca ctcagaccct gagttacccc
    19081 gataccgtgc tcgtgacccc tcccaccgct taccagcaag tcaactccgg caccatgcgg
    19141 gcatgcaggc ccaactacat cggcttccga gacaacttta tcaacctact gtaccacgac
    19201 tcgggcgtct gcagcggaac gctcaactcc gagcgctccg gcatgaacgt ggtcgtggaa
    19261 ctccaggaca gaaacacaga actgagttac cagtacatgc tggcggacat gatgtcccgt
    19321 catcactact tcgcgctgtg gaaccaggcc gtcgaccagt acgaccacga cgtgcgcgtc
    19381 ttcaacaacg acggctacga agagggcgtg cctacttacg ccttcctgcc cgacgggcac
    19441 ggggcgggcg aagacaacgg tcccgacctc agcaatgtca aaatttacac caacggacag
    19501 caagataagg gcaacgtggt ggccggaacg gtttccacac agctcaattt cggtaccatt
    19561 ccctcctacg agatcgacat tgctgctgcc accaggcgca acttcatcat gagcaacatt
    19621 gccgactacc tgcccgacaa atacaagttt agcattcgcg gtttcgaccc tgttacagac
    19681 aacatcgacc ctaccaccta cttttacatg aatcgcaggg ttcccttgac caacgtggta
    19741 gacctgttta ccaacattgg tgccagatgg tccgtggacc agatggacaa cgtcaatccc
    19801 ttcaaccacc accgtaactg ggggttgaag tacaggtctc agctgctcgg aaacagcaga
    19861 tactgccgtt tccatattca ggtgccgcag aaatactttg ccatcaagaa tctgctcctg
    19921 ttgcccggca cctacactta cgagtgggtc ctcagaaagg atcccaacat gattctgcag
    19981 tccagccttg gcaacgactt gcgcgcggac ggcgcgcaga tcgtgtatac cgaggtgaac
    20041 cttatggcca atttcatgcc catggaccac aataccagca accagctgga gctgatgttg
    20101 cgcaacgcta ccaacgacca gaccttcgcg gactacttgg gcgccaagaa cgctctctac
    20161 aacgttccgg ccggctccac gctgctgacc atcaatattc ccgccagaac atgggagggt
    20221 atgcggggct ggtcttttac ccgcctcaag gcctcggaga cgccccagct gggcgctcag
    20281 tacgacgtcg gtttcaagta ttcaggctcc attccctatt cggatggcac cttttacctg
    20341 tcccacacgt tccgcagtat gagcgtgttg tttgatacct ctatcaactg gcctggcaac
    20401 gaccgtctgc tcacacctaa cctgttcgag atcaagaggc cagtggccac cgacagcgaa
    20461 ggcttcacta tgtcgcagtg cgacatgacc aaggactggt tcctcgtgca gatggccacc
    20521 aactacaact acgtgtacaa cggttatagg ttctggcctg acagacacta cttccactat
    20581 gacttcctac gcaacttcga ccccatgtcg cgtcagggcc ccaacttcct ggacaccacg
    20641 ctgtacgacc tggtgtccag cactcccgtt gttaacgaca ccggctcaca gccgtctcag
    20701 gacaacgtgc gtaacaactc cggctttatc gcccctcgca gctggcccgt atggaccgca
    20761 cagcagggcg aagcctggcc cgctaactgg ccgtacccgc tgatcgggaa cgacgccatc
    20821 agttccaacc aaaccgtcaa ctacaagaag ttcctgtgcg ataactacct ctggaccgtg
    20881 ccgttcagct cggactttat gtatatggga gagctgaccg atctgggtca gaaccccatg
    20941 tacacaaaca actcccatag catggttatc aactttgagt tggaccccat ggatgagaat
    21001 acttacgtgt acatgctgta cggggtattt gataccgttc gcgtgaacca gcccgagcgt
    21061 aacgtgctag ccatggctta cttccgtacg cctttcgcca caggcaacgc tgtgtaaaaa
    21121 aaagacggct gggatgtcgg gaaccaccga gacccaactg cgggacctgc tgtcctctat
    21181 gcacctgcgg caccgcttcc tgggtgtttt tgacaaaagt ttcccaggat ttctcgatcc
    21241 gcacgtgccc gcctcagcta tcgtcaacac cggctcccgg gcctccggag gtatgcactg
    21301 gatcgggttc gcgttcgacc ctgccgcagg acgatgttac atgtttgacc ctttcgggtg
    21361 gtcagaccag aagctgtggg agttatacag agtcaagtac aacgctttca tgcgtcggac
    21421 cggcttacgg cagcccgatc gctgttttac cctggtccgt tctaccgagg ccgtgcagtg
    21481 cccctgctcg gccgcttgtg ggctttttag tgcccttttt atcgtctctt tcgaccgtta
    21541 ccggtcgaag cccatggatg gcaatcccgt gatcgacacc gtagtcggtg tgaagcacga
    21601 aaatatgaat tctccgccct accgcgacat cctgcaccgt aaccaagagc gcacctatta
    21661 ctggtggacc aagaatagcg cctattttcg tgctcatcaa gaggaactcc gacgagaaac
    21721 ggcccttaac gccctacctg aaaatcacgt ttaatgaccg actgtaaata aagaacgacg
    21781 cacacacgta ctgtacatat ttgtgaatag agcaaccgtt tattagataa acgtcaataa
    21841 atgccgaccg atagaccgac aaggctcttc actggcttta tttaaagaaa caaaaggatt
    21901 aagcgaacgg gtcgtcactg gcgatgggcg agactggcgc caacacctcc gttttaaagg
    21961 cgtacgactc gttccaacgg aactcaggca catgtgtggg ctctgaagaa cccatcacgg
    22021 cagtaaacag ctccgtagca aagacgtacg cgtagcgcag atccatggcc gacagacgcc
    22081 aggcgcaggt tttttcggtc ttcttcagac cgcggcctgc tccgcccgac gccgcctgcg
    22141 ggttgcagca ggtgaacacc atggtatgcg ggtttttctt gtgagccttc atatcgggcc
    22201 tgctctcgac catgtcgcga gtaatgtcgt ctgtgccgtt gagcttataa ggagtcattt
    22261 tacagaactg tctccctgaa atggctcgat cggaggcgta gttgcagttg caattggttg
    22321 agatgaggac acattcctct gcccggcgct tgtccgcgtt ggggtaaagc gccttcgtcc
    22381 agtctatgtc gtgacgcatc gcgctgaccg ccttggcggc gtcggaaaag accatggcgc
    22441 aactgccgtg cgcgtgggga tgagggaagc cgctgtgctc ctgatccttg tagcacaccg
    22501 cgttcgcgtc gaacctgagc accaccacct gtcgtccaaa ccggttcttc tcgattacgc
    22561 cgttctgttc ggccagagcc ctctttcccg cctcgctaga cgggttcaac tccacggtac
    22621 gaggtttcgt caccatgtcc acaccgtgca tgcatttcgg gaagggctcc tggagcgctg
    22681 ggaaccagcc atggcgccaa acgtgcgccc ctccgggcac gaacttgggc tccagacccg
    22741 cgcggctgta gataacggct gccaggaacc gccctacctg agcgttgaaa gagtcgtagc
    22801 tagaaaaggt caggcgaaat tcgggatgct ttttgcgaac gtatgtaccc cccattttgg
    22861 tccaaatgga gtcgtcgggg cgcacgctgg ctccctgcca ctgtaggtcg agagcttcgc
    22921 agatgctggc gacggtggcc atggcgcgtt gcgcgccgta gaccacgggg tctgacagag
    22981 gggcctccgg ggattcctcg tcgctggcgt tttcttcgtc atcgacaacg gtttcccgcc
    23041 ggcgggtaac tcgccttacg ggggatgggg actcctcgcg gcggctgacc ttcttgcgag
    23101 tcgcgcctcg gcccggggcg accacttcca cttcttcctc ctcctcttcc atcatgactt
    23161 ctgccgttct cttgacaggc ttggtgctgc gaaagccatg agctcttttc ggggttcttt
    23221 ccatgacttc tgcttcggtg acgggatctc gcgtttcaaa aagttcttgc tctccctcct
    23281 cttcagagtc agggactact gccggagagg gtggaagcgt cttttgaagc ttcctgggac
    23341 ctatagggta aagttaacgc ccatcgtcag cgagaccacg cctcgctggc cgatgggatc
    23401 acgagacacg ataaaagacc gcgaccaaaa cactcttggg gctagtatcc ctacccgggt
    23461 gcgagcgtgg cagatcttcg ctcttctgct tctccagtgg attctcgggg tctttcggcc
    23521 ccgtcggtct ctggggtggg agaggcctgc tcctccctct gtttgacttg attaccgtcg
    23581 acggcccggg ctcttcgagg tccacgaagt ccgccacgtc ttcgtcgctg ctgatcgtct
    23641 ctgggtgaag cgtttctgcc atcgtggctg tcatcgaaaa tggcagacaa gattacccga
    23701 gaggaaaaaa ccatagcgac gctggacctc gtgttacgcg tggtcgtcga tgctggtaac
    23761 tgggacgtgt tctcgaaacg tttggttcgc tacacacgcg aacagtacgg aatcgagctg
    23821 cccgaagata tcggggactt accggacaca tctgaggtct cgaaagtgct gttgagtcat
    23881 ttgggggaag acaaggcggt actgtccgcg taccgaatcg cggaactgac gcaaccttcc
    23941 gaaatggacc gcgctaaggt cacagaggga ggcctggccg tacttaacgc gagtcgcgat
    24001 gaaagcgaag ctcagaaccc ctcgaacccc gaacccgaga gcatcgagag cgacgccgta
    24061 gaggatctcg gcgttgcagc agagagcgac cctagcgatg acgaacccga cccagaaccc
    24121 gagtatgacc atcgagaggc ggatcatgac tctgatgcgg atagcggata ctattcggca
    24181 gatgggggac gacctggaac accagtggac gaggagcccc aggacgattc tccctcttcc
    24241 gaggagaccg catccactgt catcgaagaa gcgcagacta gcgctagcaa cgattctcat
    24301 gacgacgaca ctcaccgcga cgacggcagt gcttctgaag aggatctcga gcgggacgcc
    24361 ctcgtggccc cggccgatcc ttttcccaac ttgcggaagt gtttcgagcg ccaagccatg
    24421 atgctgaccg gggcgttaaa agacgccgcg gacacggctg atccgccaga aacgctctcc
    24481 gtcgacagcg tgcaaaggca gctcgaacgc ttcgtcttta accccgaccg ccgcgtgccc
    24541 gccgaacact tggaggtacg ctacaatttc taccctcctt tcctcacccc caaggccatc
    24601 gcgagctatc acatctttgc cgtcaccgct tccatccctc taagctgcaa agccaaccgc
    24661 agcggcagcg accttctagc caaagcaaaa gagagcactt tcttcaaacg cttacctaaa
    24721 tggcgtctcg ggatagagat cgacgacggg ttgggaacgg aagtcacggc ggtaacagag
    24781 ctggaagagg caaaaatggt tccgttaaag gacgacgtgt ctcgtctgca gtgggcaaaa
    24841 atgcgcggcg agcacattcg cttcttcagc tacccgtcgc tgcacatgcc tcccaaaatt
    24901 tcccgcatgc tgatggaaac gctgttgcaa ccgttcgcgg acgaaaacca aaaggcggaa
    24961 gaggcacttc cctgtctgtc ggacgaggaa gtgctggcca tcgtggaccc gacagggcgc
    25021 ctccacggcg aggacgcgct caaggccgtg gaaaagcgga gggccgcggt cactatggcg
    25081 gtacgctaca ccgcgaccct cgaactcatg gaacgcgtgt tccgcgaacc gtctatggtc
    25141 aaaaagatgc aggaggtcct ccaccatacc ttccaccacg gcttcgtcgc cctggtacgc
    25201 gaaaccgcaa aagtcaacct gagcaactat gcgaccttcc atgggcttac ctacaacaac
    25261 cccctgaaca actgcatcat gtccaagctc ctagaaggag cagacaagga ggactatgtg
    25321 gtggactcga tctacctttt cttggtcctg acgtggcaaa cggctatggg tatgtggcag
    25381 caggccatag acgatatgac tatccagatg tacaccgagg tctttaccaa gaataagtac
    25441 aggctgtact cgctgcccaa cccgaccgcc atcggcaagg ccatcgtgga catcctcatg
    25501 gactacgacc ggctcaccga ggaaatgcgg aaagcgctgc ccaacttcac ctgtcagagc
    25561 cagattactg ccttccgcca ttttctactg gaacggtcca acatcccagc ggtcgccgcg
    25621 cctttcatgc caagcgactt tgtgcctctg gcttacaagc agagccctcc cctcctctgg
    25681 gaccaggtct atctgctgca gctggccttc tatctcacta agcacggagg ctacctgtgg
    25741 gaagccccgg aggaagaggc caacaacccg tccaaccgga cttactgtcc ttgcaatctc
    25801 tgcagtccgc accggatgcc aggtcacaat gcggcattgc acaacgagat tctggctatc
    25861 ggaacgttcg agatccgcag tccggacggg aagaccttca agctcacgcc tgagctgtgg
    25921 accaacgcat acctcgacaa atttgacgcc gaggacttcc acccgttcac ggtgttccac
    25981 tatcccgaga acgcatcgcg gttcgcatcc actctaaaag catgcgtcac gcagagcccc
    26041 gaaatcttga gcctgattcg ccagattcag gaatcgaggg aggagtttct gctcaccaag
    26101 ggcaaggggg tgtacaaaga cccgaacacc ggagaaacca tctccagaca gccccgggac
    26161 actgcccgcg cgcagcacgc tggagacggt caagctctac cagcccctgg agcctatacc
    26221 accggaggaa atagagcgga gacagcgcct gctggagctg tacggcttgc cccggactac
    26281 caagacgggc agtttcctat cgcgaaagtc ggcccgcact accatggccc aaagaatgtt
    26341 agacgagaag accagggtta cagaggcggg cccggaggtg tacggggaga gcgcgaggtc
    26401 gtcctttcac gaagagcagg aggaagacgt ttcggacgga gaaacactag gcagtcagga
    26461 tacaacgaac gggctaaccg atatttcgga agaggaggag gaggatctgt tcgagggcaa
    26521 caaggagaac atcccaccac ctcgccgtcc gcctcggaac cgccggctcc gagccgcata
    26581 ctcgctcgag gaacccctcc ttcccccgag cgccgcgacc gacaagaaga gtaagaaagt
    26641 cccaaaaagg cgaggtaaat atcgcagctg ggctaagcac cgcgtggcga tatgccaggc
    26701 acttcgcgat gcggtctttg accgcaaaaa ggcgggcgaa atcctcaagc ggggtcaccg
    26761 gctcttcgtg cccgctactg tcataggcta ctatgctcgc aaactctctc cctcatttct
    26821 cgctcctctc tccagccaca ccgcacccct cctcccacca aaaaaacacc ggcgctaagg
    26881 ctgtgcgtct gcgccaagat ccggtgccgc agcacatcgc ggacctcaga ggggaaatac
    26941 tcgacatcct gttggaaatc gagtcgtacg cccgccgccg tcccgaccgc cacgtgtcca
    27001 ttcgcaacag aacgcgcgaa agcatcaccc gaaaactgca ttacgagaaa aatgaagata
    27061 agcttacccg tatgaagagc gatgctatca agttgctcgc tctctggcag accgtttaac
    27121 tcgtgttcct ttatagccct tcggaaccat gaacctgatg aacgccacac ccaccgaata
    27181 cgtatggaag tacaacccag tctccggcat tcccgccggc gcgcaacaga attacggcgc
    27241 cactatagac tgggtgttgc caggaggaac cggtttcgca atagcaacca acgacattcg
    27301 aagacaaacc cttaacccgg ccgtgacccg tgcaattacc gcgcgttttg aagctgagtc
    27361 agaccagcaa ccgtacgcta gccctcacga gaccaatgtt atcgcggcca atgtcctcga
    27421 ctcgggttat cccaaatccg gtctctaccc attagagctc agcggcaatc agcgcgtaca
    27481 gctggcaggc ggcctaatgg taggtcgcac tgagggcagg atgcaattag cgggcggttt
    27541 aacagaagga agagtgcaac tttctggagg tttccacgga cggccgttgg ttagagggcg
    27601 gagcagaaga ccgcccagat ggtgcggcgc cgaactgact gggaacggac tgcccgagca
    27661 agccgaagtc acttctgaca cttacaagta cttcctgaga acacagggtc ccagccaagt
    27721 ggttgaagag cccggcgtct tttcgcaaag acaatttatg actaccttcc tcccctccgt
    27781 tgtccctcat cccttcgaca gcaccaaccc cggcgatttc cccgcgcagt acagtgccat
    27841 ctacaaaggc cgcacggcct tcgaagacac cttttgggac tggtgaagcg caccttttgt
    27901 tggcgatgct ccgtttcgca ataaatttct tccaattctc tgtcgttaaa cggctcccgt
    27961 ctggtcactg tcacgcgctc gccgccctcg ctcgtcaccc gcgcgcggta ccgtcgcctc
    28021 agccagaata caaaaccggg gttcaggggt tcgtcgaacc gtaccacagc ctggtcgttt
    28081 aatctcaacc aatattttct agggttcgac atcatgaacg aggaggttcc cctaaagcgt
    28141 gtcagccctg acgaaaccga gacggttccc aaaaaaccgc gaaccgacgt tcgcgacacc
    28201 gtcagggccg gcactgacga cacggtagat ctcgtgtacc ctttttggtg gaatctcgga
    28261 acgggagggg gcggaggagg aggaggcggg ggcggcggca gtggaacctc tctccagccc
    28321 aatgacccgc tttacgccgc cagcgggacc atcaacctac gcatgacatc cccgctaacg
    28381 ttgtcacaac gagccttggc tctcaaaacg gacagcaccc tcaccctcaa cacgcaaggc
    28441 cagctgggcg tcagcctcac ccccggagac gggctcgtcc tcaacaccaa cgggctcagc
    28501 atcaacgcag acccgcaaac cctcgcattc aacaacagcg gggcgctcga agtcaaccta
    28561 gaccccgacg gaccctggtc taaaaccgcc acggggatcg atctgcgtct agatccgacg
    28621 acgctcgaag tagacaattg ggaactagga gtcaagctcg atcccgacga agccatcgat
    28681 tccgggcccg acggtctctg cctcaacctg gacgagactc tgctgctcgc caccaacagc
    28741 acatccggca aaacggagct cggggtacac ctcaacacca gcggtcccat tactgcggac
    28801 gaccagggca tcgacctgga cgtcgatccc aacaccatgc aggtgaacac aggaccttcc
    28861 ggaggcatgc tggccgtcaa actcaaatct ggcggcgggc tcaccgctga ccccgacggt
    28921 atctcggtca cggccaccgt cgcgcctccg tccatcagtg cgacagctcc tctcacctac
    28981 accagcggca ccattgcact cactacggat acgcaaacga tgcaagtcaa cagcaaccaa
    29041 ctggccgtga agctcaaaac gggaggcggt ctgacggctg acgcggacgg aatctccgtt
    29101 tcggttgcac cgaccccgac gatcagcgct tctcccccgc taacctacac caacgggcaa
    29161 atagggctct ctatcggaga ccaaagcctc caagtcagct ctggacagct ccaagtcaaa
    29221 ctgaaaagcc agggcggtat tcaacagagc acgcaggggc tgggagtggc ggttgatcaa
    29281 acccttaaga ttgtgtctaa cacgctcgag gtcaacacgg acccgagcgg acccctcacc
    29341 agcggcaaca acggtctcag cttagcggcc gtcacacccc tagcagtgtc ttccgccggc
    29401 gtcaccctga actatcagtc ccctcttaca gtcacgagta actctctcgg gctctccata
    29461 gccgcgccac tccaggcggg tgcgcaaggc ttgacggtaa acacgatgga acccttgagc
    29521 gcctcggcgc agggcatcca gctgcactac ggacagggat ttcaggtcgt cgcgggcacg
    29581 ctgcagctgc tcactaatcc ccccatcgtt gtctcatccc gcgggttcac cttactctac
    29641 actcccgcct tcacggtgag caacaatatg ttggggttga atgtagacgg cactgactgc
    29701 gtggctatca gttcagccgg cctacagatc cgtaaggaag ccccgctgta cgtgacctcg
    29761 ggaagcactc cagcattagc ccttaagtac agctccgact ttaccattac caatggtgcg
    29821 ctcgcgttag cgaacagcgg cggaggagga agttccacac ccgaggtggc cacctatcac
    29881 tgcggggata acctactcga gtcctacgac atcttcgcct ctctacccaa caccaacgcg
    29941 gctaaggtgg cggcttactg ccgtttagct gctgcaggtg gcgtggtcag cgggaccatt
    30001 caagtgacaa gctatgccgg acgatggcct aaagtgggca acagcgttac ggacggcatc
    30061 aaatttgcca tcgtcgtgtc tccccccatg gacaaagacc cacgatcgaa cctcagtcag
    30121 tggctgggtg ccaccgtatt ccctgcgggc gcgactactg ctctcttctc acccaacccg
    30181 tacggctccc tcaacaccat caccacactg ccatccatcg cctcggactg gtacgtgccc
    30241 gagtccaacc tggtcacgta taccaagatc cattttaaac caacggggtc gcagcagctg
    30301 cagctcgcga gcggagaact cgttgttgca gcggcgaaat cgcccgtgca gacgacgaaa
    30361 tacgaattga tctatctggg atttacgctt aagcagaact cctcgggtac caacttcttc
    30421 gatcccaatg cctcctccga tctatccttt ctgacaccac cgattccgtt tacttatctg
    30481 gggtactatc aatgaacttg ttaactcctg cagcagcagc agcagcagca gcagcatggc
    30541 tgaccagaaa aggaagctgg cggatccgga tgccgaggct ccgacgggca agatggcccg
    30601 cgcgggtccg ggagaactgg acctcgtcta ccctttctgg taccaagtag ccgctcccac
    30661 ggaaatcaca cctccgttct tggacccgaa cggtcccctg tactccacgg acggcttgtt
    30721 gaacgtcagg ctcacggcac ccctcgttat catccgtcaa tctaacggca acgcgatcgg
    30781 ggtcaagacc gacggaagca ttaccgtcaa tgcggacggc gcgctgcaga tcggaatcag
    30841 cacggccgga cctctcacca ctaccgccaa cggcatcgat cttaatatcg atcccaaaac
    30901 cctggtcgtt gacggtagca gcggcaagaa cgtcttggga gtgcttctga aaggacaggg
    30961 ggcgctacag agcagcgcgc aaggcatagg cgttgccgtc gacgagtctc tacaaatcgt
    31021 cgataacacc ttggaagtga aggtagatgc tgcaggtccg ctcgccgtca cagcagccgg
    31081 cgtagggttg cagtacgaca acacccaatt taaagtcacg aatgggactt tgcaactgta
    31141 ccaagcgccc actagcagcg tggccgcatt tacatccggg acgatcggct tgtcctcccc
    31201 tacgggcaat tttgtgagct ctagcaacaa cccgtttaac gggagctact tcctgcagca
    31261 gatcaatacc atgggcatgc tgactacctc gctctacgtc aaagtcgaca caaccaccat
    31321 gggtacgcgt cccacgggcg cggtaaacga gaacgcgcga tactttaccg tctgggtgag
    31381 ctccttcctc acgcagtgca acccctcgaa catcggtcaa gggaccctag agccaagcaa
    31441 catcagtatg acctcttttg aacccgccag aaaccccatc tcacctcccg tgttcaatat
    31501 gaaccaaaac ataccctact acgcttcccg attcggggta ctggagtctt accggcctat
    31561 cttcaccggc tcgctcaaca cgggaagtat cgacgtacgg atgcaagtga cgcccgtcct
    31621 cgccaccaac aacacgacct acaatctcat cgcctttacc ttccaatgcg ccagtgccgg
    31681 actgttcaat cccaccgtga acggcaccgt ggccatcgga ccggtggtgc atacctgtcc
    31741 cgctgcccgc gcccccgtta cggtctgaac aataaagaca aggtgaacca tttatacagt
    31801 ctcacgtctc tttattgcat acgctccgct aaatgtttcc attcgctcat ttgccagtaa
    31861 tacagcagat tcgcaaactc actgaaccaa tcttctgtat aaaaatgtac gcgctgcgtg
    31921 tccaaatcaa catcaatttt cctcatatac agacaggggc tgccacccgc ctcccccaag
    31981 cgcgacaccg caattaggaa tggtagcctg ctgtgcaggt ccacgtgaat taacatcccg
    32041 cacacgttcc cgatcggtcg ctgcataaat actggagaga aatcgctaaa ccccggtgac
    32101 gcccacatag ccacgaagta cacccctgcc acattcaagt catcctccaa cctggcccaa
    32161 acataagtgg ccaaatcgga aggagccagg tggcaagccg ataaccccat acgatgcaaa
    32221 ggtaacccgt ggcaagcgca tcccccgaaa tgaagttcga aagaatcgta acacagtagc
    32281 tgataggcat gaagcggcgt cggcatctga agaccgtcat catcttcgtc gtcttccatg
    32341 tcatccccaa cttcctcctc gcgctccgct tcctgttggc ggcgctgctg gtgctgcagc
    32401 accatctcca ggatctgctc gtcgttcatc ttaatccgga attatcgcgt acggatgttc
    32461 ctcgtcgtcc gaactgacaa cagaaggcgg aggagctgtc agtggtgctg tagaggctaa
    32521 cgatgctgca gcaccggtct cttgcaattc gaaataccaa gggttgctac tgacggtcca
    32581 gttcccgccc cgtgaaccag gccagcggga aatcggtgca ggtaggggat ccggtgaagg
    32641 agaccgggaa tggagggaag gaactgcgag atccttatcc actcgataca aaccgtataa
    32701 cagggagccc aacgccaggt acaccaggaa cgtactacaa acgaacacgc tgattacaaa
    32761 gtttaacgaa gacagatggt tctgtaggaa caggaagctg cacaggatga tgctgctgta
    32821 ggacagggcg accaggaggg ccaagaactc gcgccaatag cgtccacaac actgcaaaat
    32881 caaacacgta attagctata cggacgttca ccagcgactc tcgcgcgtcg ttccataaac
    32941 acattgcgca gataagccaa ctgagcagaa cagaacagag agagaggttg ccgcgtcgaa
    33001 cactgtttgc actgtccgaa acactcggga tgagactccc cgtacttccc gtgcacatga
    33061 aatacccact cttcgacgtt agcgtaggac aaccgacggt aaccggggaa gtaacacagt
    33121 ccctgcgaca cgatcggcca cagttccggc gacaccatca cgcggagcat gcttctcagg
    33181 cagacgggtt gggtcacggc gctgctgcga gaaatagttt ccaccatgat ggtggccgtc
    33241 acggtcacgc gacacgcatt catgagaaca accggagacc gcacaaaagg aacagacgaa
    33301 ggcacttgcg aaaaggacac ctcaaagctc atcgagcgga gagccatctt tacggatatc
    33361 ttctccgcaa tcagaaagcc tgtggtgaaa aacttaaaat ctgtcttcct gcgagcaagc
    33421 atccacggtt ccaagtcgta cttcatccca ggtgtaataa aaagcaacct acgtgagagg
    33481 tagtgcagca gggcggtctt ctctgcccgg ttcaggtgaa gggcactcac aatccggact
    33541 atgcaattca tgagtacgta gtctcgccgt ttgaaacaca caaactttgc gctgcgtacc
    33601 gtcactagca ccgtgacaga actatgcaat cgcctcatca gatcattatc gaaacaccgc
    33661 aagctagcca cggctctatt tatgcggtac tcgttcagtc tctccatttc ctcctgtcga
    33721 caagttggat cgtgacgtag gagaaaacta aaccatatta ctcctacttc gttatgaaag
    33781 ccacaagctc tgctgacggt taaagactcc ttaagaaaga aaaggtagta cagtcaagct
    33841 gacccataca ggtgaacccg ccccaagtca cgtaagtcaa ctcaccgaaa gaggacacag
    33901 agccatatcc gctgcttcaa agctttattg acgggtctaa aggcgtaaag aaaagaagaa
    33961 tttaccgttc tgcatctcaa accccaccac cacgcgaaaa agtccgaacg atgctgcagc
    34021 accgttcacg caaaagtccc ggacgcgcac aaataaaccc ttaatcccga taacggtgct
    34081 gcagcaccgt cacgctgctg cagcatcgtc agacgtttat gacatgcagc cgattccgtg
    34141 cggatttatg gtcccataac ggttccaggt cctttcgttg ctgcagcacc gtttcacgta
    34201 aagaagctgt acaggtcaaa ctggtccgga ttactgatta ttcgggggag agccacgtga
    34261 cgtagactcg aacgacgtcc acttccgata caaaccacat ctctctggac acaggcttgt
    34321 ccgccttgag ccaaaccatg tgattcttcc ggtccgttct gacgtcaatg ccgacacgcc
    34381 tcttggtgtt tgaacaggca tcccagtacg tagccaggac cactcggtga cgtcgaggtt
    34441 gaggtttaaa ggtcactacg gcctgtaacc cggtactcca gggccctaaa ctaacatatt
    34501 ctccggccct gcccactaca ttcgggtgat caaatatgac ataatcctta aacaatttgg
    34561 ggaacttcaa acagccacat ttgggcggga caggaagatg gtgcgcagaa acattgatat
    34621 gagagcgcca tctagggaca tcaaagcggt gcccgcctgg atggcaatcg tacttcttag
    34681 ttccggtaaa gtaataggtg tgagtccgga aacacgtaaa ctccgtcact tcctgtgtcg
    34741 tcattgccct cgcccctagt gacgtcagag tgccacgccc cttgtacagt ctaataaatt
    34801 ttaatacacc cccgccccta gcatataaaa caatgggagc ctcgcccaca ttcctatccc
    34861 taataaaata ccatctgacc gaatacccgt gttccatccc tattgtttta gtataataag
    34921 ggtcataagt ccacaactcc gcggcattgc cctctgtcac caccaacagc aaataggaag
    34981 atgccatgtc atcctctcgt aaaagcatcc tccaatcagc tacctcttcc gtgtagtact
    35041 gagttggctg actgtaatca cgccccgtga cgtaggctga ccacgcggaa ggaacacttc
    35101 cgtgcatgct cagtagctgg tcagcctggt gagtatccag ggccttcata aaggtcaaag
    35161 gcgccataat gtgataacac agtccatccg atcggaggaa atcaaaggga atatgtacat
    35221 cttcacaatg gcgcctccca gaataagacc atgcacagat ttgacctttc caccaagcac
    35281 gtgactcgca agcctcatgt ttttgaccag tcagatcgct ccgtatatac tcgtctccta
    35341 ttggtcgatc aaaaccgtac gaaccaatac tagacgcaat caccactacg taatccgcgt
    35401 catccctaga gataacacta tccgcatccc tattggctga ccaatgacca ccggaagaca
    35461 gcaaaaggtt taaccctttt gtgtgtaagt ccatcctata accctggaaa ctttccaatg
    35521 ggggatctag cgccactatg cggccaacct tttttgaccc tctgtccgga ctagaagttg
    35581 gcgggacaaa gccgcgcata cagtgccccc tagcgacatc cctatgcaat gaattcgatg
    35641 gtccttgaac tccgtaaaaa aatgagcagt ggtcctgact gcgtaatagg ccggccccct
    35701 cacatcctgc ccccacaaaa gggcgtctac cttcttacaa atatctctca gctgattggt
    35761 ccagtccaac agaatgaccg gggactctgg cgtcataatg gtatgcatac gcaaaatctt
    35821 tctcatcatt tcactggtcc atttatatgt gccgtcatag cgcgccctat taataagcgg
    35881 acacacatcg ggatacatgt cctgaaccag aataatgagc tccccgctat ctttaccatc
    35941 caataccccg agccgccgca tttgactgac aacccagggg ccgtccgaaa aagtcaaaaa
    36001 agtctcattc caccatacaa ttaacttggg ccacgaagga aaatccggcg aataggtgcc
    36061 catcaagcgc ctgacgtcag ccttaggata tggcggatcc catctggaat ccgacccatt
    36121 aaagcacgaa gatagggcag acatcggcca atggccagga gaatgggtag aattaataag
    36181 gactccgcct ccatttccga gcttttaaaa aaaagagaaa atggaaatca gccaagagac
    36241 caccaccccg tgattggatg attggtcatc agaagatcga taagggaatt tattttctgg
    36301 gagccccccc cccccctact cctatttaaa aaataaccct ttcctcacca agctcagaag
    36361 acagaggagg agagtagagc gccgctcaga ggtcatccgc cgagagaaaa tcccgcgcag
    36421 agaacagagc tctcaggtag gggtctggag ctctctggaa aaatcgcggg ctcttataca
    36481 cttactctcc gcccattcga aagccgcgcc tgactagagt acacactata aattccattc
    36541 cggtgactta ctactaggcg ctggccactt atcaaaagaa acagttctaa gaataggaca
    36601 aagtccaacc gcaataaaac acccttgtca aacatgataa gagtgttctc gagaaggtac
    36661 tggaaaagca aacagtccaa ctcccaagtt aaatattacg caaagaggcg taacgagaaa
    36721 agactagaaa gtgtaaacac acctctccta gttatatata aacccagcgg ggcagtccct
    36781 agaagaacac tacctcaatc cagttacaca ttaacccggg aacctattat tgattaacta
    36841 gacagtactt cctcattttc tactggaact ttccactgcc ctccggggat tttccattgg
    36901 caatcattaa cttgactttg tactttatgt ttactctcca tagcaacgca ccttatatgg
    36961 aaaatatgct cctccccgga ccgcccatcg taccacctga gcaggtaggc tgtacctttt
    37021 cctattggcc cattatgagc tcacctggtt aatcatatac ccgctccgcc tatataggta
    37081 gcataccggg acaggttccc tcacagtcta ttgcagactg ccgaagagag aggagctccg
    37141 cataggactg ggaccagaac cccgagactc tgccggtaat attttaattt catttaatcg
    37201 aatcaaataa atcaaaaatc aactcaaacc catgattctc aatggaaatt tcttgtgatt
    37261 ttctttcgcg cgcgaccacc ccctatggca cccccctgta cacccccctg tacacccccc
    37321 tgtacaaggg aacctacccc cctgtacagc gaccaccccc catggacacc cccctgtaca
    37381 ttctacaggt atggcccgca acccattccg catgttccct ggggaccttc catactacat
    37441 ggggaccatt tcctttactt cggtggtccc tgtggaccct agccagcgga atcccaccac
    37501 tagccttaga gaaatggtga ccaccggcct gatttttaac cctaacctga ccggcgagca
    37561 actgcgggaa tactcattca gccccctagt gtccatgggg agaaaggcaa tcttcgcaga
    37621 ctacgagggt ccccagcgca ttatccacgt taccattagg gggcgctccg cggaacccaa
    37681 gacccccagt gaggccctca ttatgatgga gaaggcggtc cgtggcgcgt tcgcggttcc
    37741 tgattgggtg gccagggaat actcggatcc cctcccccac ggcataaccc acgtggggga
    37801 cctgggcttc cccattggtt ccgtgcatgc cctgaagatg gcgctagaca cactgaagat
    37861 ccatgtccct cgcggagtgg gggtccctgg ctatgagggt ctctgtggga ccaccaccat
    37921 caaagccccc cgacaatatc ggctcctgac cactggagtt ttcaccaaaa aagatctgaa
    37981 aagaacactt ccagaaccat tcttcagccg attttttaac caaactcccg aagtttgtgc
    38041 catcaagact ggcaaaaatc cgttttctac agaaatttgg tgtatgactc tcggcgggga
    38101 tagccccgcc cccgagagaa atgaacccag aaatccccat tctctccaag attgggcaag
    38161 actgggtgtc atggaaacct gcctacgtat gagtaggcgg ggactcgggt ctcggcacca
    38221 cccctaccat tctctgtaac caatccctga ataaagattt gcataacaga actttgactc
    38281 ctccttttat gtgggtgggg taatgggcgg cacttggggg taatggcggt tcctattgga
    38341 tgggtaacac cgactccgcc ctacaaagtt aatgattgat ttttcggact tagaaaaatt
    38401 tcgactgtca cctggatgtt tttccccact taacctctag ggggagatag atcgcgtcca
    38461 aggggaggag ctcaataccg gaccgcctat taggtgtggc ttcgggctcc gcctagtggg
    38521 aggagacagg aaaaccacgc ctagtgacgc tgggtcaaag tccaagggga gtggtttatg
    38581 cgcaccgcct tggggcgtgg tttgggcggc gcaaggtaac ccttggactg ggaggagact
    38641 tctgtccctt gggcgtgtca aacaggtaaa ccccacccgc gcgattaatg attaattttt
    38701 cggacttaga aaattttcaa cctgatactt tattttcaag cttttcccgc cgacgggcaa
    38761 gcctcctatc tctccgtcta tgactccaca gagcctcatc tgaatatgta aatgtgctga
    38821 accgcaaccc cgtagaccgc gcccacccca gcatcaaagg taacgccccc gatgccacaa
    38881 tgtaattacc cactgttaaa ttaggatcct tacaccaatc atttctgtac aatttaaacc
    38941 accgcccacg cgggactttc ccgtggtggt agaaaaaggt tttgaaaaac gcgcgcatta
    39001 ttttcgtggc ttcattaata gcggacatgc gcagatccag aaaggtcaga cacaccacca
    39061 cggtcacatg acatttgcat ggagacaggg attggatacc gacacaatac gccatcggat
    39121 actgaatgtc cacattggtc cgtgcatata cagtgtgcca cctcctcttg accgcagcca
    39181 cgaatcccca gaagagttct tcccgccaca aaatcgaaac cggggcggcg gccccaaagc
    39241 acaaatacaa aggcatcctc ctgaggctct agaaaaaaca actcattaac aggcatcccg
    39301 ctcataggta cattcgtgta aacagggctg catgccaacc aatgccccgc gttttacaaa
    39361 gtgacgggcc accctattgg cggagggggt ccacgtattg cgcaccgcgt aaatagaagc
    39421 cacccctcgc ggaacctgtg tacattcaaa tctcctccaa atacattcgc gcagtaaagc
    39481 caccgccctt ttcaagaaag tccaatcaac cttatgcgtg ggcaaaaaaa tagaagctga
    39541 atataccccc gcaaactcct ccaatcggaa caggtaatct acactatagt gggacagcat
    39601 ctcaacagtt aaactttccc aggcatttat caccgtcaat ttcagatcat ggaatacggc
    39661 caagttaggc tccatcaagg tcacgcggag gtggaagtaa tacatcccga aataccctgt
    39721 taaaaaaaat agaaaaatga actaaccgac aataagatcg gcagtaccca gtttcgatct
    39781 ggggacctcc ggagtgcaag tccgacgctc ttacggctga gctacactgt cgatcttgat
    39841 ccgctagggt acgcagtccg gagaagaaat atactaagtg agacccggtc ctatatatac
    39901 aggttggttc aaaggaacct ttgtacccat taaaacaggt gcgtgactgt agaagccaca
    39961 cccctacctg taccgataag gcacaccctg agcaaacaaa ccataaaggt atacttcctt
    40021 attcagacag gtataaatgg aacctccgca caacagtccg gtaccatttt ccatcgcgaa
    40081 aatgggcaac cctactctgc tccttctttc aggtctcctt tctctgaccc aggccatttc
    40141 catcggagaa cacgaaaaca aaacccggca tgtgattgta tggcggcact cctcctccca
    40201 ccaatgctct gattggagaa cagtcacgga atggttcccg ccccaaaaag gcaacccggt
    40261 gagaccaccc tacacccagc gggtttccct ggatacggca aacaataccc tcacggtaaa
    40321 acccttcgag acaaacaacg ggtgttggga aactacgtca caaggcatta accatccacc
    40381 aaccaccatt cagtaccggg tatggaacat caccaccacg cccaccatac agacaatcaa
    40441 cattaccaaa ataactgttc gggaggggga ggactttacc ttatacggac ctgtgtccga
    40501 aaccatgagt attatcgaat gggaattcat caaggatgtc acgccccagt tcatcctcca
    40561 atactatctc tccattaact ctactattgt gtacgcaagc taccaaggga gagttacctt
    40621 taaccccggt aaaaacacac taaccttaaa aggcgcgaag accaccgaca gcggcaccta
    40681 caagtccacg gtgaacctcg accaggtatc cgtccacaac ttccgagtag gagtcacgcc
    40741 catcgagaaa aaagaagaag ctaccgcaga gacacctgcc agcaagccca cgcccatacc
    40801 acgtgtccga gcggatgctc gaagtactgc cctatgggtt ggacttgccc tttgcatcct
    40861 gactgttata cccgccctta ttgggtggta cttcagagat aggctctgtg ttcccgatcc
    40921 aatcattgaa ctggaaatcc ccggacaacc ccatgtaaca atacacatat tgaaaggtcc
    40981 cgatgatgat tgcgaaactt aatgattgac aaacgtaata aaaaagctgt gacgcacata
    41041 agtacgtgtc tgtgtcattc atccatacct atatatggtg atagcccctt cctcaataca
    41101 caccgagccg cgatggaccc cagaccactt gttctgctcc tcctcctagc gtcccatata
    41161 agtacattcc ggcaaatgta ctttgaaggg gaaaccatcc atttccctat gggcatatat
    41221 ggaaatgaga ccaccctcta tatgaatgac atcatcctgg aaggaacacg cgccaatacg
    41281 accacccgta caatcagcct cacgaccacc aagaagaatg cgggaactaa cctgtacact
    41341 gtgatctccg aaacgggaca caacgccacc tatctgataa ctgtacaacc gctgggacaa
    41401 tcgatacacc acgcctacac ttgggctgga aatactttta ccttacaagg acaggtattt
    41461 gaacacggta attatacacg atgggtgcgg ctggagaatg cggaaccgaa actcattatc
    41521 agctgggcat tgtccaacag aacaataaac aaaggaccgg cctatactgc aaacatggac
    41581 tttgatcccg gaaacaacac cctcactctc caccctgtgc tgataacaga tgccgggatt
    41641 ttccaatgcg tcattgatca gcaaacaaac ctaaccctca ccataaactt tacagtctcc
    41701 gagaatccac caatcgtagc acacctggat atccataaaa ctatttctag aacaattgcc
    41761 atttgtagct gtttgcttat cgcggtaatt gcggtcttgt gttgcctacg tcagctcaat
    41821 gtaaacgggc ggggaaattc cgaaatgata taaaacaata aagcagtgtg cgtcatggaa
    41881 acttttctca ggtgcttcct cattcacaca ggtatatata gggaatggaa aattagacag
    41941 atacccacac cggaacaatg ctacttctca cagtagttct gttggtgggg gtcaccctcg
    42001 ctgcggacca tcctactcta tacgctccga aagggggcag tatagaattg ggtgtggggg
    42061 ctaaacagaa agggcaatac aaatttgaat ggcggtttgg aaatctaaaa attgtgatag
    42121 ccgaaatgtc atccactaac caattagaaa tcaaatttcc cgataacggt ttccaaaatc
    42181 gatccgagtt taaccccacc aaacataact taaccattca taatgccagc tacgaggaca
    42241 gcggaaccta ctcactccac caggaagaaa atgatggcac ggaacacacg gacaacttca
    42301 aagtgattgt tcaaggtatg tcattatata catatttaca atatgcatta atatcaccta
    42361 tctaatagag cattaattat ccagacccga ttccacgccc tgaagtcaag ggaaccacta
    42421 tgcaaatcaa cgggaaaact ttcaccaata tatcctgcca tctaccggcc ggttcctacg
    42481 gcaatgtctc ctggcattgg aattataccg acccaatcat agtcgggtac gaaaatcaga
    42541 gcatgctcgt tggaccttta ggggtaatgt attcatgtac ggcatccaat caagtctcaa
    42601 aaaactccag tgcaataagt atggacaccg ccgaaccatc agagagtaag tagcgccctc
    42661 tatagacatt atatagaata taactgaaca cattaagaaa cctctgtaat tatttatagg
    42721 agcggagtgc gcatatacag gatacattgc gggcattata atcttaggag tgctttgcat
    42781 attgttcatt tacctatatg caaatacccc tgaagtgcgg cagagaataa ccgaccaatt
    42841 agaaaagctt ctcggaacat tctgtgacgt cagtatagaa gacggaatac cggaacgcac
    42901 cagaagaaac aaaaaaagaa tcatcttaaa ggagccctcc cataggtgga tctggattca
    42961 gtcatttgca taatatgctg tgtcataacc gccaccatca ccatagcaat cattgggcgt
    43021 aagtattgtg acgtaagaaa aggcatgtct aaaaaaacgg tcactcacca taatgctgcc
    43081 cccgataggt tgcgaccgcc ttccggagtt tgacgtagta tgcccgcgag actggatcgg
    43141 atttcaaagc aagtgctact acttttcgga gtcagagtcc aattggagtg aagccgaaaa
    43201 attttgtaga cagcaagagg cggagctagc agttcggcgt tccgaggagg aaaaggtaaa
    43261 aagttaaatt ccaggaaact cctaattccc cgaaaaatta caaaaattaa cggagaccct
    43321 ttacaggagt tccttctgcg ccaatgcgga acaggaacta actggctggg cgtaaccagg
    43381 aagtcgaagg acggagctga ttgggtggat gcatcgtacg atgattacgt accatggtga
    43441 gtcatgttat acgtcacatc cgggatgtga cgtatgcgga agttgatccg ggagtgaaaa
    43501 cccggaagta acctgttaat ttgcatacag gtatgaaatt cggggaggcg gagactgcgt
    43561 gtatttaaat ggagaccgag tgacgtcagc ctactgtgat acccagaagc tatttgtctg
    43621 ttcctgtcaa gattcgtatt cgtattggtt agaaaacaaa taaatcaata aactaattta
    43681 tgatatcatt catatttatg ggtgtggttt tattatgcgt cataaaacta ttttgcgtat
    43741 agcgacacgc tgcggttatg gccggttatg actgcgttag tttttgaggt tattatacat
    43801 catc
//



spacer
spacer